Phospholipid phosphatase-related protein type 5

Overview
NamePhospholipid phosphatase-related protein type 5
Smed IDSMED30031006
Length (bp)1944
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phospholipid phosphatase-related protein type 5 (SMED30031006) t-SNE clustered cells

Violin plots show distribution of expression levels for Phospholipid phosphatase-related protein type 5 (SMED30031006) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phospholipid phosphatase-related protein type 5 (SMED30031006) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phospholipid phosphatase-related protein type 5 (SMED30031006) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031006

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30031006SMESG000037098.1 dd_Smed_v4_2507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031006SMESG000037098.1 dd_Smed_v4_2507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031006SMESG000037098.1 dd_Smed_v4_2507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031006SMESG000037098.1 dd_Smed_v4_2507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031006SMESG000037098.1 Contig47965uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031006SMESG000037098.1 Contig47965newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30031006SMESG000037098.1 dd_Smed_v4_2507_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Human
Match: PLPPR5 (phospholipid phosphatase related 5 [Source:HGNC Symbol;Acc:HGNC:31703])

HSP 1 Score: 106.686 bits (265), Expect = 1.133e-24
Identity = 74/240 (30.83%), Postives = 121/240 (50.42%), Query Frame = 3
Query:  552 IPEMGVYIHSFSFPIFVIIVGEMLLFCM-------ANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQES 1250
            +P + +Y  +   P+ VIIVGE  +FC+        NQ   +L    C   +I   +RR  RF   Y FG+    + V+  ++  G L P+FL+LC P  +A G   +   +S         E A          C  N   I+R +R + PS  AA+S+YAA+Y+T+Y+    K    + L  P + + L+ ++ L G+N V    N W+DVI G+++G +IA +L V V+  F+ +++
Sbjct:   63 VPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCC---YINPLVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISG--------EEA----------CTGNPDLIMR-ARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTR-LAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQA 279          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Human
Match: PLPPR5 (phospholipid phosphatase related 5 [Source:HGNC Symbol;Acc:HGNC:31703])

HSP 1 Score: 106.686 bits (265), Expect = 1.262e-24
Identity = 74/240 (30.83%), Postives = 121/240 (50.42%), Query Frame = 3
Query:  552 IPEMGVYIHSFSFPIFVIIVGEMLLFCM-------ANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQES 1250
            +P + +Y  +   P+ VIIVGE  +FC+        NQ   +L    C   +I   +RR  RF   Y FG+    + V+  ++  G L P+FL+LC P  +A G   +   +S         E A          C  N   I+R +R + PS  AA+S+YAA+Y+T+Y+    K    + L  P + + L+ ++ L G+N V    N W+DVI G+++G +IA +L V V+  F+ +++
Sbjct:   63 VPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCC---YINPLVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISG--------EEA----------CTGNPDLIMR-ARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTR-LAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQA 279          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Human
Match: PLPPR5 (phospholipid phosphatase related 5 [Source:HGNC Symbol;Acc:HGNC:31703])

HSP 1 Score: 107.457 bits (267), Expect = 1.572e-24
Identity = 74/240 (30.83%), Postives = 121/240 (50.42%), Query Frame = 3
Query:  552 IPEMGVYIHSFSFPIFVIIVGEMLLFCM-------ANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQES 1250
            +P + +Y  +   P+ VIIVGE  +FC+        NQ   +L    C   +I   +RR  RF   Y FG+    + V+  ++  G L P+FL+LC P  +A G   +   +S         E A          C  N   I+R +R + PS  AA+S+YAA+Y+T+Y+    K    + L  P + + L+ ++ L G+N V    N W+DVI G+++G +IA +L V V+  F+ +++
Sbjct:   63 VPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCC---YINPLVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISG--------EEA----------CTGNPDLIMR-ARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTR-LAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQA 279          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Human
Match: PLPPR1 (phospholipid phosphatase related 1 [Source:HGNC Symbol;Acc:HGNC:25993])

HSP 1 Score: 93.5893 bits (231), Expect = 3.663e-20
Identity = 62/222 (27.93%), Postives = 109/222 (49.10%), Query Frame = 3
Query:  591 PIFVIIVGEMLLFCMANQTAKLLA------AGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            P  +I +GE+ ++ + +    L+A       G C  L+    +RR+ RF+  + FG+    + V+  ++  G L P FL++C P  ++     HH  ++                  N N+C   D  ++ K+R S PS  AA+S+Y+A+Y T+Y+    K    + L  P + +  +  + L G+N V    N  +DVI G+ILG A+A +L + V+  F+
Sbjct:   81 PTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLN--PLLRRIIRFTGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFIN------------------NGNIC-TGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSR-LAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFK 280          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Human
Match: PLPPR1 (phospholipid phosphatase related 1 [Source:HGNC Symbol;Acc:HGNC:25993])

HSP 1 Score: 93.5893 bits (231), Expect = 3.663e-20
Identity = 62/222 (27.93%), Postives = 109/222 (49.10%), Query Frame = 3
Query:  591 PIFVIIVGEMLLFCMANQTAKLLA------AGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            P  +I +GE+ ++ + +    L+A       G C  L+    +RR+ RF+  + FG+    + V+  ++  G L P FL++C P  ++     HH  ++                  N N+C   D  ++ K+R S PS  AA+S+Y+A+Y T+Y+    K    + L  P + +  +  + L G+N V    N  +DVI G+ILG A+A +L + V+  F+
Sbjct:   81 PTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLN--PLLRRIIRFTGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFIN------------------NGNIC-TGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSR-LAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFK 280          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Celegans
Match: plpr-1 (PhosphoLipid Phosphatase Related homolog [Source:UniProtKB/TrEMBL;Acc:Q22250])

HSP 1 Score: 91.6633 bits (226), Expect = 1.251e-19
Identity = 76/278 (27.34%), Postives = 135/278 (48.56%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMANQTAKLLAA--GICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYL--LIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQE 1247
            Y+ R+ ++ P   + F   +++  + N +     E+F +    P +  Y  +F+ P  VI++GE++ +  + +  K++ A  G C P+H+    RRL+RF + YL G+L + + VD +K+  G  RP FLSLC   ++A      H+        SP P  A          C       +R +  + PS+ A +S YAA + ++Y++ +  +     L  L+ F  M L ++     IN     +N W D+ V +++G  +A++L   VL    FQE
Sbjct:   56 YYLRFTSVFPYHHRVFYCRDVHLYKPNFVP----EDFNVYVSYPLL--YTLAFTIPPLVILIGEVMFWLFSTKPRKIVYANCGEC-PVHL--FTRRLFRFVIIYLAGLLIVQIFVDTIKLMTGYQRPYFLSLCNVSITACTAPLEHS-------PSPSPHLA----------CNYRGADELRYAWLTFPSLHAVVSSYAACFASLYIYYMINLRGAPLLRPLLIFGFMGLCIVDSFSRINGY---KNHWRDIWVAWVIGIFMAWFLCYCVL---CFQE 301          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Celegans
Match: plpp-1.1 (PhosphoLipid PhosPhatase homolog [Source:UniProtKB/TrEMBL;Acc:A0A238ULT2])

HSP 1 Score: 64.6994 bits (156), Expect = 6.204e-11
Identity = 49/183 (26.78%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  699 IRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQE 1247
            + RLY F   +  G+    + VD+ K +IG  RP+F+ +C P +               Y T   P+   LY  T++  C   D   + +++ S  S  +A S YAA + ++YL           LL+P +   L   +    +  V   ++ W+DV+VG I+G+AI  ++ + V   F+ +E
Sbjct:  106 VVRLYCFIGYFFVGVCFNQLMVDIAKYTIGRQRPHFMDVCRPDIG--------------YQTCSQPD---LY-ITDFK-CTTTDTKKIHEAQLSFYSGHSAFSFYAAWFTSLYLQARLFRPLFSRLLLPVIQFLLFGGAAYVSLTRVSDYKHHWSDVLVGAIMGSAIGVFVALFVAEVFKRRE 269          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Celegans
Match: plpp-1.1 (PhosphoLipid PhosPhatase homolog [Source:UniProtKB/TrEMBL;Acc:A0A238ULT2])

HSP 1 Score: 64.6994 bits (156), Expect = 6.483e-11
Identity = 49/183 (26.78%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  699 IRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQE 1247
            + RLY F   +  G+    + VD+ K +IG  RP+F+ +C P +               Y T   P+   LY  T++  C   D   + +++ S  S  +A S YAA + ++YL           LL+P +   L   +    +  V   ++ W+DV+VG I+G+AI  ++ + V   F+ +E
Sbjct:  106 VVRLYCFIGYFFVGVCFNQLMVDIAKYTIGRQRPHFMDVCRPDIG--------------YQTCSQPD---LY-ITDFK-CTTTDTKKIHEAQLSFYSGHSAFSFYAAWFTSLYLQARLFRPLFSRLLLPVIQFLLFGGAAYVSLTRVSDYKHHWSDVLVGAIMGSAIGVFVALFVAEVFKRRE 269          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Celegans
Match: plpp-1.1 (PhosphoLipid PhosPhatase homolog [Source:UniProtKB/TrEMBL;Acc:A0A238ULT2])

HSP 1 Score: 64.3142 bits (155), Expect = 7.565e-11
Identity = 49/183 (26.78%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  699 IRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQE 1247
            + RLY F   +  G+    + VD+ K +IG  RP+F+ +C P +               Y T   P+   LY  T++  C   D   + +++ S  S  +A S YAA + ++YL           LL+P +   L   +    +  V   ++ W+DV+VG I+G+AI  ++ + V   F+ +E
Sbjct:  106 VVRLYCFIGYFFVGVCFNQLMVDIAKYTIGRQRPHFMDVCRPDIG--------------YQTCSQPD---LY-ITDFK-CTTTDTKKIHEAQLSFYSGHSAFSFYAAWFTSLYLQARLFRPLFSRLLLPVIQFLLFGGAAYVSLTRVSDYKHHWSDVLVGAIMGSAIGVFVALFVAEVFKRRE 269          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Celegans
Match: plpp-1.1 (PhosphoLipid PhosPhatase homolog [Source:UniProtKB/TrEMBL;Acc:A0A238ULT2])

HSP 1 Score: 64.3142 bits (155), Expect = 7.671e-11
Identity = 49/183 (26.78%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  699 IRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQE 1247
            + RLY F   +  G+    + VD+ K +IG  RP+F+ +C P +               Y T   P+   LY  T++  C   D   + +++ S  S  +A S YAA + ++YL           LL+P +   L   +    +  V   ++ W+DV+VG I+G+AI  ++ + V   F+ +E
Sbjct:  108 VVRLYCFIGYFFVGVCFNQLMVDIAKYTIGRQRPHFMDVCRPDIG--------------YQTCSQPD---LY-ITDFK-CTTTDTKKIHEAQLSFYSGHSAFSFYAAWFTSLYLQARLFRPLFSRLLLPVIQFLLFGGAAYVSLTRVSDYKHHWSDVLVGAIMGSAIGVFVALFVAEVFKRRE 271          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Fly
Match: laza (gene:FBgn0037163 transcript:FBtr0078508)

HSP 1 Score: 72.0182 bits (175), Expect = 3.218e-13
Identity = 55/206 (26.70%), Postives = 101/206 (49.03%), Query Frame = 3
Query:  669 ICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGI----GKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENW--WTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNRRI 1268
            IC         R L+R   ++ FG +   +T ++ K ++G LRP+F   C P+L  +G+S      S+      Y E    +  TN NL  +     +R+   S PS  +++S Y+ + + +Y+HG+    G +   +++L       L+L++ LC ++L  + + W  W+DV+ G +LG   A  +T A +     +++ S  RI
Sbjct:   49 ICKRFRTRLYFRNLWRAEATFSFGFIATYLTTELAKHAVGRLRPHFFHGCQPRLD-DGSS-----CSDLQNAELYVEQ---FHCTNNNLSTRQ----IRELHVSFPSAHSSLSFYSMVLLALYVHGVWRGRGGVRVLRHVL-----QFLLLMAALC-VSLSRVADYWHHWSDVLAGALLGVTYA-AITAAYVGNLLRRQTSSTGRI 234          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Fly
Match: CG11426 (gene:FBgn0037166 transcript:FBtr0078506)

HSP 1 Score: 67.0106 bits (162), Expect = 1.247e-11
Identity = 67/238 (28.15%), Postives = 104/238 (43.70%), Query Frame = 3
Query:  708 LYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNRRILRHIALLQSGYRSKESKECDIKTDSMFEPVRLRRATTQPSHCPCHITTSPP 1421
            L R S  + FG+L      +V K +IG LRP+FL++C P++ A+G S   + V+   Y   Y    + +   +           VR++R S PS  ++++ YA IYV +YL         K L   FV  A+V+++    ++ V    + W+DV+ G +LG A A      + R   F +  SN        +L  G R + +                  AT Q   CP   TT PP
Sbjct:  131 LGRQSTYFCFGLLLTFDATEVGKYTIGRLRPHFLAVCQPQI-ADG-SMCSDPVNLHRYMENYDCAGEGFTVED-----------VRQARLSFPSGHSSLAFYAMIYVALYLQRKITWRGSK-LSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVLSGSLLGVAGALITAHYIAR--MFDDGASN--------ILSGGLRRENTA-----------------ATLQEEVCP---TTPPP 324          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Fly
Match: CG11438 (gene:FBgn0037164 transcript:FBtr0345586)

HSP 1 Score: 61.2326 bits (147), Expect = 1.039e-9
Identity = 48/192 (25.00%), Postives = 83/192 (43.23%), Query Frame = 3
Query:  660 AAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQF 1235
            A G      I H +  LYR  + YL+G+  +  T  + K+ +G LRP+FL++C P L    +     N+  +  +         +  +N N+     + + +    S PS  A+++MYA +Y+ IYL         K LL   +    V+      +  +    + W+DV+ G  LG   A+  +  V   F
Sbjct:   88 AGGKRDSCRIAHRLGVLYRQVIFYLYGLAMVTFTTMLTKLCLGRLRPHFLAVCQPMLPDGSSCQDAQNLGRYIDS---------FTCSNANMTDYQFKELYQ----SFPSGHASMAMYAMLYLAIYLQAALSTRVSK-LLKHLLQFLFVMFGWYVSLTRIIDYYHHWSDVLAGAALGVVFAWLTSAYVADLF 265          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Fly
Match: CG11438 (gene:FBgn0037164 transcript:FBtr0078504)

HSP 1 Score: 61.2326 bits (147), Expect = 1.039e-9
Identity = 48/192 (25.00%), Postives = 83/192 (43.23%), Query Frame = 3
Query:  660 AAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQF 1235
            A G      I H +  LYR  + YL+G+  +  T  + K+ +G LRP+FL++C P L    +     N+  +  +         +  +N N+     + + +    S PS  A+++MYA +Y+ IYL         K LL   +    V+      +  +    + W+DV+ G  LG   A+  +  V   F
Sbjct:   88 AGGKRDSCRIAHRLGVLYRQVIFYLYGLAMVTFTTMLTKLCLGRLRPHFLAVCQPMLPDGSSCQDAQNLGRYIDS---------FTCSNANMTDYQFKELYQ----SFPSGHASMAMYAMLYLAIYLQAALSTRVSK-LLKHLLQFLFVMFGWYVSLTRIIDYYHHWSDVLAGAALGVVFAWLTSAYVADLF 265          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Fly
Match: wun (gene:FBgn0016078 transcript:FBtr0306111)

HSP 1 Score: 58.5362 bits (140), Expect = 7.387e-9
Identity = 40/173 (23.12%), Postives = 84/173 (48.55%), Query Frame = 3
Query:  729 YLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQ-FQFQ 1244
            Y FG +   +T D+ K SIG LRP+F+++C P++ A+G++      +  Y      +G              +   ++++ R S PS  ++ + +A +Y+ +YL         K LL   +    ++++    ++ V   ++ W+DV+ G ++G+  A  ++  + +  F FQ
Sbjct:  196 YAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQM-ADGSTCDDAINAGKYIQEFTCKGVG------------SSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMTWRGSK-LLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVVSYGLPKSWFNFQ 354          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Zebrafish
Match: plppr5b (phospholipid phosphatase related 5b [Source:ZFIN;Acc:ZDB-GENE-070620-15])

HSP 1 Score: 103.219 bits (256), Expect = 1.279e-23
Identity = 77/284 (27.11%), Postives = 130/284 (45.77%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMA------NQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSN 1259
            Y+F +     +  + F  YE  +T+                 IP   +Y      P  +I V E +LF +       +   K +  G C  L+    +RR +RF   YLFG+    + V+  ++  G L P+FL++C P  +A G       +S+                     C  N+  I+R +R + PS  AA+S+YAA+Y+ +Y+    K    + L  P +++ L+ ++ L GIN V    N W+DVI G+I+G AIA +L V V+  F+ ++ + +
Sbjct:   26 YYFEYTDTFNVHVQGFFCYETAYTKPYLGPEDT-------SAIPPALLYAVVTGVPTLMITVTETVLFLIQYTSKDLDSREKTMVTGDCCYLN--PLVRRTFRFLGVYLFGLFTTDIFVNAGQVVTGNLAPHFLTVCKPNFTALGCQQALRYISH------------------QEACTGNEDDILR-ARKTFPSKEAALSVYAAVYMAMYITFTVKAKGTR-LAKPVMSLGLMCLAFLTGINRVAEYRNHWSDVIAGFIIGVAIATFLVVCVVHNFKGKQLLDD 280          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Zebrafish
Match: plppr5a (phospholipid phosphatase related 5a [Source:ZFIN;Acc:ZDB-GENE-070705-281])

HSP 1 Score: 97.0561 bits (240), Expect = 1.213e-21
Identity = 73/235 (31.06%), Postives = 112/235 (47.66%), Query Frame = 3
Query:  552 IPEMGVYIHSFSFPIFVIIVGEMLLFCMA------NQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            IP   +Y      P  VI V E +LF +       +   K++  G C  L+    +RR +RF   Y FG+    + V+  ++  G L P FL++C P  +A G       V  F                  + C  N+  I+  +R S PS  AAIS+YAA+YV +Y+    K    + L  P +++ L+ ++ L GIN V    N W DVI G+I+G AIA ++ V V++ F+
Sbjct:   52 IPPAILYAVVAGVPALVITVTESVLFLLQYVSEDLDNREKIIVMGDCCYLN--PLVRRTFRFLGVYAFGLFATDIFVNAGQVVTGNLSPYFLTVCKPNYTALGC----QQVVRFI--------------NQQDACTGNEDDILH-ARKSFPSKEAAISVYAALYVAMYITCSVKAKGTR-LAKPVLSLGLMCLAFLTGINRVVEYRNHWADVIAGFIIGGAIAVFMVVCVVKNFK 264          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Zebrafish
Match: plppr2a (phospholipid phosphatase related 2a [Source:ZFIN;Acc:ZDB-GENE-040426-1171])

HSP 1 Score: 97.0561 bits (240), Expect = 2.267e-21
Identity = 73/276 (26.45%), Postives = 124/276 (44.93%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCM---ANQTAKLLAAGIC--SPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            Y+F +    P+  + F  ++  F++                 +P + VY    + P   I+ GE+++F M     Q   ++ A  C  +PL     +RR+ RF   Y FG+    +  +  ++  G   P+FLS C P  +A G    H+N               L   T    C  N   IV  +R S PS  AA+S+Y+A+Y  +Y+  + +    + L  P +++ L+ +++L G+  V    N W+DV+ G+  G AIA +L   V+  FQ
Sbjct:   48 YYFEYTDTFPVHIQGFFCFDKAFSKPYPGPDET-------SNVPPVLVYSLIAAIPTITILAGEVMVFFMRAEGTQEKTIVTADCCYFNPL-----LRRIIRFLGVYTFGVFTTTIFANAGQVVTGNQTPHFLSACRPNYTALGC---HSN---------------LQYITERKACTGNPL-IVASARKSFPSKDAALSVYSAVYTVMYVTLVFRTKGTR-LTKPTLSLTLLCLAMLVGVVRVAEYRNHWSDVLAGFFTGGAIAVFLVTCVINNFQ 291          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Zebrafish
Match: plppr2a (phospholipid phosphatase related 2a [Source:ZFIN;Acc:ZDB-GENE-040426-1171])

HSP 1 Score: 96.2857 bits (238), Expect = 2.918e-21
Identity = 73/276 (26.45%), Postives = 124/276 (44.93%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCM---ANQTAKLLAAGIC--SPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            Y+F +    P+  + F  ++  F++                 +P + VY    + P   I+ GE+++F M     Q   ++ A  C  +PL     +RR+ RF   Y FG+    +  +  ++  G   P+FLS C P  +A G    H+N               L   T    C  N   IV  +R S PS  AA+S+Y+A+Y  +Y+  + +    + L  P +++ L+ +++L G+  V    N W+DV+ G+  G AIA +L   V+  FQ
Sbjct:   17 YYFEYTDTFPVHIQGFFCFDKAFSKPYPGPDET-------SNVPPVLVYSLIAAIPTITILAGEVMVFFMRAEGTQEKTIVTADCCYFNPL-----LRRIIRFLGVYTFGVFTTTIFANAGQVVTGNQTPHFLSACRPNYTALGC---HSN---------------LQYITERKACTGNPL-IVASARKSFPSKDAALSVYSAVYTVMYVTLVFRTKGTR-LTKPTLSLTLLCLAMLVGVVRVAEYRNHWSDVLAGFFTGGAIAVFLVTCVINNFQ 260          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Zebrafish
Match: plppr2b (phospholipid phosphatase related 2b [Source:ZFIN;Acc:ZDB-GENE-121030-5])

HSP 1 Score: 93.2041 bits (230), Expect = 2.790e-20
Identity = 73/280 (26.07%), Postives = 125/280 (44.64%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCM---ANQTAKLLAAGIC--SPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQES 1250
            Y+F +    P+  + F  Y+  F++       +        K P + VY    + P   I++GE+  F     A+Q   ++ A  C  +PL     +RR+ RF   Y FG+    +  +  ++  G   P+FLS C P  +A G                    + +   T    C  N   ++  +R S PS  +A+SMY+A+Y  +Y+  + +    + L  P + + L+ +++L GI  V    N W+DV+ GY+ G AIA +L   V+  FQ  +S
Sbjct:   17 YYFEYTDTFPVHIQGFFCYDKTFSKPYPGPEDD-------SKAPPVLVYSLVTAIPTVTILLGELASFFTKPEASQEKTIVTADCCYFNPL-----LRRIVRFLGVYSFGLFTTTIFANAGQVVTGNQTPHFLSTCRPNYTALGCH------------------SPMQYITERRACTGNPY-LIASARKSFPSKDSALSMYSAVYTVMYVTLVWRTKGTR-LTKPTLCLTLLSLAVLVGIVRVAEYRNHWSDVLAGYLTGGAIAAFLVTCVINNFQQTQS 264          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Xenopus
Match: PLPPR5 (phospholipid phosphatase related 5 [Source:NCBI gene;Acc:100491270])

HSP 1 Score: 107.842 bits (268), Expect = 3.511e-25
Identity = 81/284 (28.52%), Postives = 135/284 (47.54%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRK--NEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCM-------ANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQES 1250
            Y+F +     +  + F  Y+ ++T+      ESS+    +L   +   GV       P+ VIIVGE ++FC+        NQ   LL    C   +I   +RR  RF   Y FG+    + V+  ++  G L P+FL++C P  +A G       +                  T+ N C  N   +V K+R + PS  AA+S+YAA+Y+ +Y+    K    + L  P + + L+ ++ L GIN V    N W+DVI G+++G +IA +L   V+  F+ +++
Sbjct:   25 YYFEYTDTFTVNVQGFFCYDSSYTKPYPGPDESSDIPPVLLLSLV--TGV-------PVLVIIVGETVVFCLQVATRDFENQEKTLLTGDCC---YINPLVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLTVCKPNYTALGCQQFTQFI------------------TDANACTGNP-DLVIKARRTFPSKDAALSVYAALYLAMYITSTIKAKGTR-LAKPVLCLGLMCLAFLTGINRVAEYRNHWSDVIAGFLIGISIAIFLVACVVNNFKGRQA 276          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Xenopus
Match: PLPPR5 (phospholipid phosphatase related 5 [Source:NCBI gene;Acc:100491270])

HSP 1 Score: 107.842 bits (268), Expect = 3.895e-25
Identity = 81/284 (28.52%), Postives = 135/284 (47.54%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRK--NEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMA-------NQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQES 1250
            Y+F +     +  + F  Y+ ++T+      ESS+    +L   +   GV       P+ VIIVGE ++FC+        NQ   LL    C   +I   +RR  RF   Y FG+    + V+  ++  G L P+FL++C P  +A G       +                  T+ N C  N   +V K+R + PS  AA+S+YAA+Y+ +Y+    K    + L  P + + L+ ++ L GIN V    N W+DVI G+++G +IA +L   V+  F+ +++
Sbjct:   28 YYFEYTDTFTVNVQGFFCYDSSYTKPYPGPDESSDIPPVLLLSLV--TGV-------PVLVIIVGETVVFCLQVATRDFENQEKTLLTGDCC---YINPLVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLTVCKPNYTALGCQQFTQFI------------------TDANACTGNP-DLVIKARRTFPSKDAALSVYAALYLAMYITSTIKAKGTR-LAKPVLCLGLMCLAFLTGINRVAEYRNHWSDVIAGFLIGISIAIFLVACVVNNFKGRQA 279          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Xenopus
Match: PLPPR5 (phospholipid phosphatase related 5 [Source:NCBI gene;Acc:100491270])

HSP 1 Score: 107.842 bits (268), Expect = 4.560e-25
Identity = 81/284 (28.52%), Postives = 135/284 (47.54%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRK--NEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMA-------NQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQES 1250
            Y+F +     +  + F  Y+ ++T+      ESS+    +L   +   GV       P+ VIIVGE ++FC+        NQ   LL    C   +I   +RR  RF   Y FG+    + V+  ++  G L P+FL++C P  +A G       +                  T+ N C  N   +V K+R + PS  AA+S+YAA+Y+ +Y+    K    + L  P + + L+ ++ L GIN V    N W+DVI G+++G +IA +L   V+  F+ +++
Sbjct:   26 YYFEYTDTFTVNVQGFFCYDSSYTKPYPGPDESSDIPPVLLLSLV--TGV-------PVLVIIVGETVVFCLQVATRDFENQEKTLLTGDCC---YINPLVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLTVCKPNYTALGCQQFTQFI------------------TDANACTGNP-DLVIKARRTFPSKDAALSVYAALYLAMYITSTIKAKGTR-LAKPVLCLGLMCLAFLTGINRVAEYRNHWSDVIAGFLIGISIAIFLVACVVNNFKGRQA 277          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Xenopus
Match: plppr3 (phospholipid phosphatase related 3 [Source:NCBI gene;Acc:100145312])

HSP 1 Score: 92.4337 bits (228), Expect = 8.344e-19
Identity = 71/277 (25.63%), Postives = 126/277 (45.49%), Query Frame = 3
Query:  579 SFSFPIFVIIVGEMLLFCMANQ------TAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQF---QESVSNRRILRHIALLQSGYRSKESKECDIKTDSMFEPVRLRRATTQ 1382
            +F+ P   I+VGE +L+C+ ++      +   + AG C   +    +RR  RF   ++FG+    +  DV++++ G   P FL++C P  +  G S      SN Y T               ++C  ND+  +  +R + PS  A +S +AA+Y+++Y + I  I     LL P +  +    + +CG+  +    +   DV  G+++GA IA YL    +  F     + S+S        AL Q G+ S   +   + TD +    R + +  Q
Sbjct:   82 AFAAPAASIMVGEGVLYCIQSKLKGRSSSEGSINAGGC---NFNSFLRRTVRFVGVHVFGLCATALVTDVIQLATGYHAPFFLTVCKPNYTRLGTSC----ASNPYITQ--------------DICTGNDQHAILSARKTFPSQHATLSAFAAVYISMYFNSI--ISDSTKLLKPLLVFSFSFAAGVCGLTQITQYRSHPVDVYSGFLIGAGIAAYLAYHAVGNFHSSTEETSISPPTKDPLQALTQRGHESVYHQNKSLSTDELTPRPRSQESQRQ 335          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Xenopus
Match: plppr3 (phospholipid phosphatase related 3 [Source:NCBI gene;Acc:100145312])

HSP 1 Score: 92.0485 bits (227), Expect = 9.279e-19
Identity = 71/277 (25.63%), Postives = 126/277 (45.49%), Query Frame = 3
Query:  579 SFSFPIFVIIVGEMLLFCMANQ------TAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQF---QESVSNRRILRHIALLQSGYRSKESKECDIKTDSMFEPVRLRRATTQ 1382
            +F+ P   I+VGE +L+C+ ++      +   + AG C   +    +RR  RF   ++FG+    +  DV++++ G   P FL++C P  +  G S      SN Y T               ++C  ND+  +  +R + PS  A +S +AA+Y+++Y + I  I     LL P +  +    + +CG+  +    +   DV  G+++GA IA YL    +  F     + S+S        AL Q G+ S   +   + TD +    R + +  Q
Sbjct:   82 AFAAPAASIMVGEGVLYCIQSKLKGRSSSEGSINAGGC---NFNSFLRRTVRFVGVHVFGLCATALVTDVIQLATGYHAPFFLTVCKPNYTRLGTSC----ASNPYITQ--------------DICTGNDQHAILSARKTFPSQHATLSAFAAVYISMYFNSI--ISDSTKLLKPLLVFSFSFAAGVCGLTQITQYRSHPVDVYSGFLIGAGIAAYLAYHAVGNFHSSTEETSISPPTKDPLQALTQRGHESVYHQNKSLSTDELTPRPRSQESQRQ 335          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Mouse
Match: Plppr5 (phospholipid phosphatase related 5 [Source:MGI Symbol;Acc:MGI:1923019])

HSP 1 Score: 105.531 bits (262), Expect = 1.844e-24
Identity = 74/239 (30.96%), Postives = 119/239 (49.79%), Query Frame = 3
Query:  552 IPEMGVYIHSFSFPIFVIIVGEMLLFCM-------ANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQE 1247
            +P + +Y  +   P+ VIIVGE  +FC+        NQ   +L    C   +I   +RR  RF   Y FG+    + V+  ++  G L P+FL+LC P  +A G   +   +S         E A          C  N   I+R +R + PS  AA+S+YAA Y+T+Y+    K    + L  P + + L+ ++ L G+N V    N W+DVI G+++G +IA +L V V+  F+ ++
Sbjct:   63 VPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCC---YINPLVRRTVRFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISG--------EEA----------CTGNPDLIMR-ARKTFPSKEAALSVYAATYLTMYITSTIKAKGTR-LAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQ 278          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Mouse
Match: Plppr5 (phospholipid phosphatase related 5 [Source:MGI Symbol;Acc:MGI:1923019])

HSP 1 Score: 105.531 bits (262), Expect = 1.983e-24
Identity = 74/239 (30.96%), Postives = 119/239 (49.79%), Query Frame = 3
Query:  552 IPEMGVYIHSFSFPIFVIIVGEMLLFCM-------ANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQE 1247
            +P + +Y  +   P+ VIIVGE  +FC+        NQ   +L    C   +I   +RR  RF   Y FG+    + V+  ++  G L P+FL+LC P  +A G   +   +S         E A          C  N   I+R +R + PS  AA+S+YAA Y+T+Y+    K    + L  P + + L+ ++ L G+N V    N W+DVI G+++G +IA +L V V+  F+ ++
Sbjct:   63 VPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCC---YINPLVRRTVRFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISG--------EEA----------CTGNPDLIMR-ARKTFPSKEAALSVYAATYLTMYITSTIKAKGTR-LAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQ 278          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Mouse
Match: Plppr5 (phospholipid phosphatase related 5 [Source:MGI Symbol;Acc:MGI:1923019])

HSP 1 Score: 105.916 bits (263), Expect = 3.556e-24
Identity = 74/239 (30.96%), Postives = 119/239 (49.79%), Query Frame = 3
Query:  552 IPEMGVYIHSFSFPIFVIIVGEMLLFCM-------ANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQE 1247
            +P + +Y  +   P+ VIIVGE  +FC+        NQ   +L    C   +I   +RR  RF   Y FG+    + V+  ++  G L P+FL+LC P  +A G   +   +S         E A          C  N   I+R +R + PS  AA+S+YAA Y+T+Y+    K    + L  P + + L+ ++ L G+N V    N W+DVI G+++G +IA +L V V+  F+ ++
Sbjct:   63 VPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCC---YINPLVRRTVRFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISG--------EEA----------CTGNPDLIMR-ARKTFPSKEAALSVYAATYLTMYITSTIKAKGTR-LAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQ 278          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Mouse
Match: Plppr5 (phospholipid phosphatase related 5 [Source:MGI Symbol;Acc:MGI:1923019])

HSP 1 Score: 99.3673 bits (246), Expect = 8.749e-23
Identity = 68/226 (30.09%), Postives = 112/226 (49.56%), Query Frame = 3
Query:  594 IFV-IIVGEMLLFCM-------ANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQE 1247
            IFV IIVGE  +FC+        NQ   +L    C   +I   +RR  RF   Y FG+    + V+  ++  G L P+FL+LC P  +A G   +   +S     +  P+                   ++ ++R + PS  AA+S+YAA Y+T+Y+    K    + L  P + + L+ ++ L G+N V    N W+DVI G+++G +IA +L V V+  F+ ++
Sbjct:   20 IFVEIIVGETAVFCLQLATRDFENQEKTILTGDCC---YINPLVRRTVRFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGNPD-------------------LIMRARKTFPSKEAALSVYAATYLTMYITSTIKAKGTR-LAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQ 222          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Mouse
Match: Plppr3 (phospholipid phosphatase related 3 [Source:MGI Symbol;Acc:MGI:2388640])

HSP 1 Score: 97.4413 bits (241), Expect = 4.867e-21
Identity = 69/273 (25.27%), Postives = 123/273 (45.05%), Query Frame = 3
Query:  579 SFSFPIFVIIVGEMLLFCMANQTAKLLAAGICSPLHIPHT-----IRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQES------VSNRRILRHIALLQSGYRSKESKECDIKTDSMFEPVRL 1364
            +F+ P   I+VGE +++C+ ++       G+   ++         +RR  RF   ++FG+    +  DV++++ G   P FL++C P  +  G S   N         PY            ++C  +D   +  +R + PS  A +S +AA+YV++Y + +  I     LL P +  A  + + +CG+  +    +   DV  G+++GA IA YL    +  FQ   +         +  LR  AL Q G+ S   +   + TD +  P RL
Sbjct:   80 AFAAPAASIMVGEGMVYCLQSRLWGRGPGGVEGSINAGGCNFNSFLRRTVRFVGVHVFGLCATALVTDVIQLATGYHTPFFLTVCKPNYTLLGTSCESN---------PY---------ITQDICSGHDTHAILSARKTFPSQHATLSAFAAVYVSMYFNAV--ISDTTKLLKPILVFAFAIAAGVCGLTQITQYRSHPVDVYAGFLIGAGIAAYLACHAVGNFQAPPAEKVPTPAPAKDALR--ALTQRGHESMYQQNKSVSTDELGPPGRL 330          
BLAST of Phospholipid phosphatase-related protein type 5 vs. UniProt/SwissProt
Match: sp|Q32ZL2|PLPR5_HUMAN (Phospholipid phosphatase-related protein type 5 OS=Homo sapiens OX=9606 GN=PLPPR5 PE=2 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 6.060e-24
Identity = 74/240 (30.83%), Postives = 121/240 (50.42%), Query Frame = 3
Query:  552 IPEMGVYIHSFSFPIFVIIVGEMLLFCM-------ANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQES 1250
            +P + +Y  +   P+ VIIVGE  +FC+        NQ   +L    C   +I   +RR  RF   Y FG+    + V+  ++  G L P+FL+LC P  +A G   +   +S         E A          C  N   I+R +R + PS  AA+S+YAA+Y+T+Y+    K    + L  P + + L+ ++ L G+N V    N W+DVI G+++G +IA +L V V+  F+ +++
Sbjct:   63 VPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCC---YINPLVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISG--------EEA----------CTGNPDLIMR-ARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTR-LAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQA 279          
BLAST of Phospholipid phosphatase-related protein type 5 vs. UniProt/SwissProt
Match: sp|Q8BJ52|PLPR5_MOUSE (Phospholipid phosphatase-related protein type 5 OS=Mus musculus OX=10090 GN=Plppr5 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.290e-23
Identity = 74/239 (30.96%), Postives = 119/239 (49.79%), Query Frame = 3
Query:  552 IPEMGVYIHSFSFPIFVIIVGEMLLFCM-------ANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQE 1247
            +P + +Y  +   P+ VIIVGE  +FC+        NQ   +L    C   +I   +RR  RF   Y FG+    + V+  ++  G L P+FL+LC P  +A G   +   +S         E A          C  N   I+R +R + PS  AA+S+YAA Y+T+Y+    K    + L  P + + L+ ++ L G+N V    N W+DVI G+++G +IA +L V V+  F+ ++
Sbjct:   63 VPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCC---YINPLVRRTVRFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISG--------EEA----------CTGNPDLIMR-ARKTFPSKEAALSVYAATYLTMYITSTIKAKGTR-LAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQ 278          
BLAST of Phospholipid phosphatase-related protein type 5 vs. UniProt/SwissProt
Match: sp|Q6GM05|PLPR5_XENLA (Phospholipid phosphatase-related protein type 5 OS=Xenopus laevis OX=8355 GN=plppr5 PE=2 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 1.991e-23
Identity = 79/280 (28.21%), Postives = 133/280 (47.50%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRK--NEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCM-------ANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            Y+F +     +  + F  Y+ ++T+      ESS+    +L   +   GV       P+ VIIVGE ++FC+        NQ   LL    C   +I   +RR  RF   Y FG+    + V+  ++  G L P+FL++C P  +A G       +++    +  P+                   +V K+R + PS  AA+S+YAA+Y+ +Y+    K    + L  P + + L+ ++ L GIN V    N W+DVI G+++G +IA +L V V+  F+
Sbjct:   26 YYFEYTDTFTVNVQGFFCYDSSYTKPYPGPDESSDIPPVLLLSLV--TGV-------PVLVIIVGETVVFCLQVATRDFENQEKTLLTGDCC---YINPLVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLTVCKPNYTALGCRQFTQFITDANACTGIPD-------------------LVIKARRTFPSKDAALSVYAALYLAMYITSTIKAKGTR-LAKPVLCLGLMCLAFLTGINRVAEYRNHWSDVIAGFLIGISIAVFLVVCVVNNFK 273          
BLAST of Phospholipid phosphatase-related protein type 5 vs. UniProt/SwissProt
Match: sp|Q6IQH6|PLPR1_DANRE (Phospholipid phosphatase-related protein type 1 OS=Danio rerio OX=7955 GN=plppr1 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.164e-20
Identity = 66/231 (28.57%), Postives = 114/231 (49.35%), Query Frame = 3
Query:  591 PIFVIIVGEMLLFCMANQTAKLLA------AGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNRR 1265
            P  +I VGE+ ++ M +    LLA       G C  L+    IRR+ RF   + FG+    + V+  ++  G L P FL++C P  +     + H  ++N                   N+C  N + +V ++R S PS  A++S+Y+A+YVT+Y+    K    + L  P + + L+  + L G+N V    N  +DV+ G+ILG++IA +L + V+  F+   S   ++
Sbjct:   80 PTAIIFVGEISMYIMKSTGEALLAQEKTIVTGECCYLN--PLIRRIIRFIGVFAFGLFATDIFVNAGQVVTGNLAPYFLNVCKPNYTGLDCHFSHQFIAN------------------GNICTGN-QVVVERARRSFPSKDASLSVYSAVYVTMYITSTIKTKSSR-LAKPVLCLGLLCAAFLTGLNRVSEYRNHCSDVVAGFILGSSIALFLGICVVNNFKGTHSTPTKQ 288          
BLAST of Phospholipid phosphatase-related protein type 5 vs. UniProt/SwissProt
Match: sp|Q7TPB0|PLPR3_MOUSE (Phospholipid phosphatase-related protein type 3 OS=Mus musculus OX=10090 GN=Plppr3 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.101e-19
Identity = 70/273 (25.64%), Postives = 124/273 (45.42%), Query Frame = 3
Query:  579 SFSFPIFVIIVGEMLLFCMANQTAKLLAAGICSPLHIPHT-----IRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQES------VSNRRILRHIALLQSGYRSKESKECDIKTDSMFEPVRL 1364
            +F+ P   I+VGE +++C+ ++       G+   ++         +RR  RF   ++FG+    +  DV++++ G   P FL++C P  +  G S      SN Y T               ++C  +D   +  +R + PS  A +S +AA+YV++Y + +  I     LL P +  A  + + +CG+  +    +   DV  G+++GA IA YL    +  FQ   +         +  LR  AL Q G+ S   +   + TD +  P RL
Sbjct:   80 AFAAPAASIMVGEGMVYCLQSRLWGRGPGGVEGSINAGGCNFNSFLRRTVRFVGVHVFGLCATALVTDVIQLATGYHTPFFLTVCKPNYTLLGTSCE----SNPYITQ--------------DICSGHDTHAILSARKTFPSQHATLSAFAAVYVSMYFNAV--ISDTTKLLKPILVFAFAIAAGVCGLTQITQYRSHPVDVYAGFLIGAGIAAYLACHAVGNFQAPPAEKVPTPAPAKDALR--ALTQRGHESMYQQNKSVSTDELGPPGRL 330          
BLAST of Phospholipid phosphatase-related protein type 5 vs. TrEMBL
Match: V4B5G6 (acidPPc domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_157415 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.337e-47
Identity = 99/301 (32.89%), Postives = 171/301 (56.81%), Query Frame = 3
Query:  336 ANERSKMATCLILVTTLLDXXXXXXXXXXEYFFRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            +N  +   + L   T LL+  ++  +  +EYF RW  + P+RK SF  Y+ + +  ++ ++    EF     +P   VY  SFS P F+I++GE+  +   ++  + +   I     IP  +RRL+RF   ++FG   LMV VD++KI +G LRP+FL +C           H +N S    +S +P G        ++LC+  +R  +R++RTS PSM  A++ YAA+++ +YLHG  + H  + ++ PF++   ++++LL G++ +GL  ++WTD +VGY +G+++A YL   VL  FQ
Sbjct:   10 SNNSTGFKSILFCATVLLEFIVLSTIILLEYFLRWTEVFPIRKASFSCYDPDLSCTSK-DAELLSEFAFSAVVPPEAVYALSFSIPPFIILIGEIGFYTFTDEAQRTINI-IKDQCSIPQLLRRLFRFIGVFIFGGFTLMVFVDIIKIMVGRLRPDFLEVC-----------HISNRS--VCSSIFPGGEP---HGTHDLCENPNRLELRQARTSFPSMNGALTAYAALFIGMYLHGAMRSHTVR-IIRPFISFVFIMLALLSGLSEIGLCLSFWTDTVVGYCMGSSLAVYLAYVVLNNFQ 291          
BLAST of Phospholipid phosphatase-related protein type 5 vs. TrEMBL
Match: A0A210QFK6 (Lipid phosphate phosphatase-related protein type 5 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08183 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.603e-42
Identity = 96/309 (31.07%), Postives = 166/309 (53.72%), Query Frame = 3
Query:  312 SKQNNAGCANERSKMATCLILVTTLLDXXXXXXXXXXEYFFRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            +++++ G   E+      L+L T LL++ I++ +  +EYF RW  + P+ + SF   +   + ++    S F  FI  G +P   +Y  SF  P FV++VGE+ ++   ++  K +    C+ + +P  +RRL RF+  ++FG   +MV  DV K+  G LRP FL LC               V++    +   +G+         LC + D  ++R +RTS PSM +A+S Y+A+++ IYLHG  +    + ++ PF+++A V+++LLCG+   GL    W DV+VG  +G A+  Y   A+L  F+
Sbjct:   20 TREDDGGEDTEKKARKNSLVLATFLLELIILVFMVVLEYFLRWTTLFPIVRLSFSCNDPLISVRSA--ESGFSTFIYEGSVPHATIYALSFCVPPFVVLVGEIGVWAFTDERQKPIWLS-CNGMKVPQVVRRLIRFTGVFVFGAFTVMVFADVTKLLTGRLRPVFLELC--------------RVNHTLCDAQGGQGSD-------ELCTETDEMMLRYARTSFPSMYSALSAYSAVFLAIYLHGALRTRSVR-IIRPFLSLAFVMLALLCGLLEYGLRVCHWDDVVVGLAMGVAVGVYFGSAILHNFR 303          
BLAST of Phospholipid phosphatase-related protein type 5 vs. TrEMBL
Match: K1Q609 (Lipid phosphate phosphatase-related protein type 5 OS=Crassostrea gigas OX=29159 GN=CGI_10014457 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.657e-41
Identity = 101/315 (32.06%), Postives = 162/315 (51.43%), Query Frame = 3
Query:  312 SKQNNAGCANERSKMATCLILVTTLLDXXXXXXXXXXEYFFRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSA---NGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQE 1247
             +++    A ++ K  + L+ VTT L++ +V  V  ++   R   I PLR++ F   +   +R+     S+F  F     +P+  VY  SF  P+F+I+ GE+ L+  A    + +   +C    +P   RRL RF   ++FG   LMV VDV K+  G LRPNFL LC    +A   NGN                          + +LC + D  +++ +R+S PSM AA+S YAA++++ Y+HG  +    + +L PF+ +   ++SLLCG+  +G+G + WTD+  G+  G+ IA YL   VLR F   E
Sbjct:    5 DRRSTESGAAKKQKEPSSLVCVTTFLELMVVAFVITVDILIRLTNIFPLRRQPFSCADETISRQTS--RSQFIGFAFDHDLPDSIVYSLSFCLPLFIILAGEVGLWAFAEDRQRTIRV-LCQNCRVPQVTRRLVRFVGVFVFGAFTLMVFVDVTKLMTGRLRPNFLELCKINQTACRMNGN------------------------LGDDSLCLEKDEMVIKHARSSFPSMDAALSSYAAMFISTYVHGALRSRSVR-VLRPFLTVLFCMLSLLCGLVKLGIGSSHWTDIAAGFASGSFIAVYLGRYVLRGFNEHE 291          
BLAST of Phospholipid phosphatase-related protein type 5 vs. TrEMBL
Match: R7TIN0 (acidPPc domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_222391 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.560e-37
Identity = 86/299 (28.76%), Postives = 160/299 (53.51%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNRRILRHIALLQSGYRSKESKE 1322
            YF R   + P+R+  F   + N        S+ ++EF     +    +    F  P F++ + E+ L+  +++  K + A +C    +    RR+ R+  ++LFGIL  M+ VDV+K+ +G LRPNFL +C P +S   + Y  NNVS                     +C + +  ++R +R S PS+ +A++ +++ ++ IYLH I +    + +L PF+ +  VL++++CG+   GL  N+WTD +VG+++GA  A Y+ + VL   +F+E +S++R+ + +    S  R+ E ++
Sbjct:   76 YFLRATDVFPVREIPFSCTDANIMYTGG--SASYDEFAYNADVSYNVIVPLCFCLPPFLVFICEIALWAFSDEPQKTIRA-LCRDCRMSQVFRRMIRYIGTFLFGILITMIFVDVIKLFVGRLRPNFLEICKPDMSKCTDGY-TNNVS---------------------ICSERNTDVIRDARLSFPSLMSAMTAFSSCFMAIYLHHIIRAPSVR-ILRPFLGLGFVLLAVICGLARYGLNYNYWTDSLVGFVIGAVFAVYICIFVLN--EFRERLSSQRLYQRLRSFMSDQRALELRD 346          
BLAST of Phospholipid phosphatase-related protein type 5 vs. TrEMBL
Match: A0A2T7NRS5 (acidPPc domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_17126 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 6.152e-37
Identity = 116/374 (31.02%), Postives = 184/374 (49.20%), Query Frame = 3
Query:  306 TVSKQNNAGCANERSKMATCLILVTTLLDXXXXXXXXXXEYFFRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLL--FCMANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNRRILRHIALLQSGYRSK--ESKECDIKTDSMFEPVRLRRATTQPSHCPCHITTS 1415
            ++S+ ++ G    R      LI VT  ++  ++I V  IEYF RW    PLR+++F   +   +  +  +     +F  G  +P+  +Y+ SF  P FV+ +GE+ L  F    Q +  L    C    +P   RRL RF   +LFGI  LM+ VDV K+ IG LRP+FL  C   ++    S                 G  L  S     C   D + +R +RTS PS+ +A++ YAAI++++Y+HG  + H  + +L  F+ +  +++SLL G+  VG   + WTDV VG+ +G  ++ YLTVAVL   QF+E V+   +L  + L  + +     E K    +       + + R    P H P H+  S
Sbjct:   30 SMSEASDFGSPWRRGHRQGILICVTFAIEFLLLIFVIIIEYFLRWTDAFPLRRQNFSCSDPEISCSSH-DQQLMADFAFGANVPDSVIYVLSFCVPGFVVFIGELGLCTFSEGQQKSVRLVNRDCK---VPQVGRRLLRFLGVFLFGIFALMLFVDVTKLLIGRLRPDFLHTCRVNVALCNTSL--------------SSGLSLDDSA----CLNTDTTEIRAARTSFPSLTSALTSYAAIFLSVYVHGALRCHVVR-ILRAFLVLVFIMLSLLSGLAEVGRCHSHWTDVAVGFGVGVVMSTYLTVAVLN--QFREHVTQTEMLHMLRLFMADHCMPFYEDKAHLARPSDPLTSMHIPRPHLPPGHIPGHLRRS 378          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Cavefish
Match: plppr5b (phospholipid phosphatase related 5 [Source:NCBI gene;Acc:103026103])

HSP 1 Score: 102.064 bits (253), Expect = 2.491e-23
Identity = 78/279 (27.96%), Postives = 129/279 (46.24%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRK--NEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMA------NQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            Y+F +     +  + F  Y+  +T+      E+S          IP   +Y      P  VI V E +LF M       +   K +  G C  L+    +RR +RF   Y+FG+    + V+  ++  G L P+FL++C P  +A G       +S+                     C  N+  I+R +R + PS  AA+S+Y+A+Y+ +Y+    K    + L  P +++ L+ ++ L GIN V    N W+DVI G+I+G AIA +L V V+  F+
Sbjct:   29 YYFEYTDTFNVHVQGFFCYDSAYTKPYLGPEETS---------AIPPAVLYAVVSGVPTLVITVTEAVLFLMQYTSKDPDTRKKTIVTGDCCYLN--PLVRRTFRFLGVYMFGLFTTDIFVNAGQVVTGNLAPHFLTVCKPNYTALGCQQALRYISH------------------QEACTGNEEVILR-ARKTFPSKEAALSVYSALYLAMYITCTVKAKGTR-LAKPVMSLGLMCLAFLTGINRVAEYRNHWSDVIAGFIIGVAIATFLVVCVVHNFK 276          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Cavefish
Match: plppr5b (phospholipid phosphatase related 5 [Source:NCBI gene;Acc:103026103])

HSP 1 Score: 102.834 bits (255), Expect = 2.543e-23
Identity = 78/279 (27.96%), Postives = 129/279 (46.24%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRK--NEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMA------NQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            Y+F +     +  + F  Y+  +T+      E+S          IP   +Y      P  VI V E +LF M       +   K +  G C  L+    +RR +RF   Y+FG+    + V+  ++  G L P+FL++C P  +A G       +S+                     C  N+  I+R +R + PS  AA+S+Y+A+Y+ +Y+    K    + L  P +++ L+ ++ L GIN V    N W+DVI G+I+G AIA +L V V+  F+
Sbjct:   29 YYFEYTDTFNVHVQGFFCYDSAYTKPYLGPEETS---------AIPPAVLYAVVSGVPTLVITVTEAVLFLMQYTSKDPDTRKKTIVTGDCCYLN--PLVRRTFRFLGVYMFGLFTTDIFVNAGQVVTGNLAPHFLTVCKPNYTALGCQQALRYISH------------------QEACTGNEEVILR-ARKTFPSKEAALSVYSALYLAMYITCTVKAKGTR-LAKPVMSLGLMCLAFLTGINRVAEYRNHWSDVIAGFIIGVAIATFLVVCVVHNFK 276          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Cavefish
Match: plppr2a (phospholipid phosphatase-related protein type 5 [Source:NCBI gene;Acc:103038737])

HSP 1 Score: 100.523 bits (249), Expect = 1.416e-22
Identity = 76/276 (27.54%), Postives = 123/276 (44.57%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCM---ANQTAKLLAAGIC--SPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            Y+F +    P+  + F  Y+ +F++                K+P + VY    + P   I+ GE++ F M     Q   ++ A  C  +PL     +RR+ RF   Y FG+    +  +  ++  G   P+FLS C P  +A G        SN  Y             T    C  N   IV  +R S PS  AA+S+Y+A+Y  +Y+  + +    + L  P +++ L+ +++L G+  V    N W DV+ GY  G AIA +L   V+  FQ
Sbjct:   35 YYFEYTDTFPVHVQGFFCYDKSFSKPYPGPDET-------SKVPPVLVYSLVTAVPTITILAGELMAFFMKSEGTQEKTIVTADCCYFNPL-----LRRIIRFLGVYSFGLFTTTIFANAGQVVTGNQTPHFLSACRPNYTALGCQ------SNLQYI------------TERRACTGNPL-IVASARKSFPSKDAALSVYSAVYTVMYVTLVFRTKGTR-LTKPTLSLTLLCLAMLVGVVRVAEYRNHWADVLAGYFTGGAIAVFLVTCVINNFQ 278          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Cavefish
Match: plppr2a (phospholipid phosphatase-related protein type 5 [Source:NCBI gene;Acc:103038737])

HSP 1 Score: 97.4413 bits (241), Expect = 7.854e-22
Identity = 78/278 (28.06%), Postives = 126/278 (45.32%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRK--NEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCM---ANQTAKLLAAGIC--SPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            Y+F +    P+  + F  Y+ +F++      E+S         K+P + VY    + P   I+ GE++ F M     Q   ++ A  C  +PL     +RR+ RF   Y FG+    +  +  ++  G   P+FLS C P  +A G        SN  Y             T    C  N   IV  +R S PS  AA+S+Y+A+Y  +Y+  + +    + L  P +++ L+ +++L G+  V    N W DV+ GY  G AIA +L   V+  FQ
Sbjct:   31 YYFEYTDTFPVHVQGFFCYDKSFSKPYPGPDETS---------KVPPVLVYSLVTAVPTITILAGELMAFFMKSEGTQEKTIVTADCCYFNPL-----LRRIIRFLGVYSFGLFTTTIFANAGQVVTGNQTPHFLSACRPNYTALGCQ------SNLQYI------------TERRACTGNPL-IVASARKSFPSKDAALSVYSAVYTVMYVTLVFRTKGTR-LTKPTLSLTLLCLAMLVGVVRVAEYRNHWADVLAGYFTGGAIAVFLVTCVINNFQ 274          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Cavefish
Match: plppr1 (phospholipid phosphatase related 1 [Source:HGNC Symbol;Acc:HGNC:25993])

HSP 1 Score: 95.1301 bits (235), Expect = 7.603e-21
Identity = 67/244 (27.46%), Postives = 120/244 (49.18%), Query Frame = 3
Query:  552 IPEMGVYIHSFSFPIFVIIVGEMLLFCMANQTAKLLA------AGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNRR 1265
            IP + +Y    + P  +I +GE+ ++ M +    L+A       G C  L+    IRR+ RF   + FG+    + V+  ++  G L P FL++C P  +     ++H  +S                  N N+C  N + +V ++R S PS  A++S+Y+A+YVT+Y+    K    + L  P + +  +  + L G+N V    N  +DVI G+ILG+++A +L + V+  F+   S   ++
Sbjct:   67 IPPLVLYCVVAAVPTAIIFIGEISMYVMKSTREALIAQEKTIVTGECCYLN--PLIRRIIRFIGVFAFGLFATDIFVNAGQVVTGNLAPYFLTVCKPNYTGMECRFNHQFIS------------------NGNICTGN-QVVVERARRSFPSKDASLSVYSAVYVTMYITSTIKTKSSR-LAKPVLCLGTLCAAFLTGLNRVSEYRNHCSDVIAGFILGSSVALFLGLCVVNNFRGAHSTPAKQ 288          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Sea Lamprey
Match: plpp1a (phospholipid phosphatase 1a [Source:ZFIN;Acc:ZDB-GENE-080225-26])

HSP 1 Score: 72.4034 bits (176), Expect = 7.211e-15
Identity = 49/181 (27.07%), Postives = 87/181 (48.07%), Query Frame = 3
Query:  708 LYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQES 1250
            LYR   ++LFG        DV K S+G LRP+FL +C P  +         N S  Y T     G               D +++ ++R S  S  A+ SMY  +++ +Y+    +    + +L P +   L+L+++  G++ +    + W+DV+VG+  GAA+A +  V V   F+ +++
Sbjct:    2 LYRTLGAFLFGCAVNQSLTDVAKFSVGRLRPHFLDVCKPDRALY-------NCSEGYITRVVCTG---------------DPAVISEARKSFYSGHASFSMYTMVFLALYVESRLRWRGAR-ILRPLLQFVLLLVAVFVGLSRLSDYRHHWSDVLVGFCAGAAVAIFTVVRVSGLFEARDA 159          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004167.1 (pep scaffold:Pmarinus_7.0:GL482427:29:3570:-1 gene:ENSPMAG00000003808.1 transcript:ENSPMAT00000004167.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 6.303e-11
Identity = 41/166 (24.70%), Postives = 77/166 (46.39%), Query Frame = 3
Query:  552 IPEMGVYIHSFSFPIFVIIVGEMLLFCMA--NQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLH 1043
            +P + ++  +F+ P   I++GE ++FC     Q +   A+G     +    +RR  RF   ++FG+   ++  D++++S G   P FL++C P  +    S            SPY            ++C   D   +   R + PS  A I+ +AAIY++ +L+
Sbjct:   43 VPLLMLFSLAFAVPSATIMIGEGIVFCCLCRRQGSSADASGAVIGCNFSSYLRRAVRFVGVHVFGLCAALLVADILQLSTGFHAPYFLTVCKPNYTLLNTSCDE---------SPY---------VMQDICTGQDADAISAGRKTFPSEHATIAAFAAIYISKFLY 190          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004168.1 (pep scaffold:Pmarinus_7.0:GL482427:101:9483:-1 gene:ENSPMAG00000003808.1 transcript:ENSPMAT00000004168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 3.205e-10
Identity = 40/162 (24.69%), Postives = 74/162 (45.68%), Query Frame = 3
Query:  552 IPEMGVYIHSFSFPIFVIIVGEMLLFCM--ANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVT 1031
            +P + ++  +F+ P   I++GE ++FC     Q +   A+G     +    +RR  RF   ++FG+   ++  D++++S G   P FL++C P  +    S            SPY            ++C   D   +   R + PS  A I+ +AAIY++
Sbjct:   72 VPLLMLFSLAFAVPSATIMIGEGIVFCCLCRRQGSSADASGAVIGCNFSSYLRRAVRFVGVHVFGLCAALLVADILQLSTGFHAPYFLTVCKPNYTLLNTSCDE---------SPY---------VMQDICTGQDADAISAGRKTFPSEHATIAAFAAIYIS 215          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Nematostella
Match: EDO33490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS23])

HSP 1 Score: 72.4034 bits (176), Expect = 7.969e-14
Identity = 48/186 (25.81%), Postives = 89/186 (47.85%), Query Frame = 3
Query:  705 RLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNR 1262
            R  +  + +LFG     +  DV K S+G LRP+FL++C P  S         N +  + TS    G               D +I+R++R S PS  ++ + Y   ++ +Y+     I    YLL P + +  +++ +LCG++ +   ++ W+DV  G  LG  IA+ +    ++ F+  E ++ +
Sbjct:  140 RFAKIVVVFLFGAAVNTLLTDVGKYSVGRLRPHFLTMCKPDTSLF-------NCTTEFITSVVCTG---------------DPAIIREARLSFPSGHSSFAAYTMCFLILYIQARVDIPQ-SYLLKPLLQLIPLVLGILCGLSRISDYKHHWSDVFAGLALGTTIAYGVVWFHIKWFKDIERMTQK 302          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Nematostella
Match: EDO45164 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTY2])

HSP 1 Score: 64.6994 bits (156), Expect = 9.444e-12
Identity = 51/207 (24.64%), Postives = 92/207 (44.44%), Query Frame = 3
Query:  594 IFVIIVGEMLLFCMANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLT 1214
            I V++V ++   CM   T  LL            +  RL      ++FG +   +  D+ K+S+G  RP FL++C P                     P        Q T  ++C   D++ + ++R S PS  ++ + Y  +++++YL  I        LL PF+ ++ + + LLC ++ +    + W DV+ G  +G  IAFY+ 
Sbjct:   64 ISVVVVAKL---CMRQSTVYLLR----------FSCPRLCVILFMFVFGGIVTSLITDIGKLSVGRQRPYFLAVCKPD--------------------PLKINCTAGQYTEVSVCT-GDKAEILEARLSFPSGHSSFAAYTMVFLSLYLEAIIPTRK-TVLLKPFLQVSAISLGLLCALSRIFDYRHHWGDVLAGLAIGTLIAFYVV 235          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Nematostella
Match: EDO33491 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS24])

HSP 1 Score: 58.5362 bits (140), Expect = 1.584e-9
Identity = 47/178 (26.40%), Postives = 85/178 (47.75%), Query Frame = 3
Query:  705 RLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            R  +  + +LFG     +  DV K S+G LRP+FL++C P  S         N +  + TS    G               D +I+R++R S PS  ++ + Y   ++ +Y+     I    YLL P + +  +++ +LCG++ +   ++ W+DV  G  LG  IA+ +    ++ F+
Sbjct:   94 RFAKIVVVFLFGAAVNTLLTDVGKYSVGRLRPHFLTVCKPDTSLF-------NCTTEFITSVVCTG---------------DPAIIRQARLSFPSGHSSFAAYTMCFLILYIQARVDIPQ-SYLLKPLLQLIPLILGILCGLSRISDYKHHWSDVFAGLALGTTIAYVVVWFHIKWFK 248          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Nematostella
Match: EDO34952 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMY4])

HSP 1 Score: 55.4546 bits (132), Expect = 1.175e-8
Identity = 47/169 (27.81%), Postives = 81/169 (47.93%), Query Frame = 3
Query:  708 LYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLT 1214
            L+R ++ +L+GI  L +  +V+ +  G L PNFL++C P            N + F     Y            ++C   D   V+++R S PS+   ++MY  ++V + L     +   K LL   + +A +L +L  G++ V    + W+DV  G ILG+A A+ L 
Sbjct:   71 LHRMAV-FLYGIPLLFLIFNVVSVMTGRLTPNFLAVCKP------------NTTLFDCNEGY---------ITKDVC-TGDALDVKRARLSFPSVNTLVAMYCMVFVALSLQAAECLSRTK-LLRTALQVAAILGALAVGMSRVKDYSHHWSDVAAGVILGSAAAWLLV 215          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Medaka
Match: plppr5b (phospholipid phosphatase related 5 [Source:NCBI gene;Acc:101157682])

HSP 1 Score: 103.99 bits (258), Expect = 4.338e-24
Identity = 77/279 (27.60%), Postives = 133/279 (47.67%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRK--NEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMA------NQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            Y+F +     +  + F  Y+  +T+      +SS          +P + +Y      P  +I V E +LF +       ++T K +A G C  L+    +RR +RF   Y FG+  + + V+  ++  G L P FL++C P  +A G       +S+                   + C  N   I+R +R S PS  AA+S+YAA+Y+ +Y+    +    + L  P +++ L+ ++ L G+N V    N W+DVI G+I+G AIA +L V+V+  F+
Sbjct:   17 YYFEYTDTFAVHVQGFFCYDSTYTKPYLGPEDSS---------AVPPLLLYAAVAGLPTLLITVTETVLFLVQYTSKEFDRTEKTVATGDCCYLN--PLVRRTFRFLGVYAFGLFTVDIFVNAGQVVTGNLAPYFLTVCKPNYTALGCQQALRYISH------------------QDACTGNQEDILR-ARKSFPSKEAALSVYAALYLAMYVTYTVQAKGTR-LAKPVLSLGLMCLAFLTGLNRVAEYRNHWSDVIAGFIIGMAIATFLVVSVVHNFK 264          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Medaka
Match: plppr5b (phospholipid phosphatase related 5 [Source:NCBI gene;Acc:101157682])

HSP 1 Score: 104.76 bits (260), Expect = 4.844e-24
Identity = 76/279 (27.24%), Postives = 133/279 (47.67%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRK--NEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMA------NQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            Y+F +     +  + F  Y+  +T+      +SS          +P + +Y      P  +I V E +LF +       ++T K +A G C   ++   +RR +RF   Y FG+  + + V+  ++  G L P FL++C P  +A G       +S+                   + C  N   I+R +R S PS  AA+S+YAA+Y+ +Y+    +    + L  P +++ L+ ++ L G+N V    N W+DVI G+I+G AIA +L V+V+  F+
Sbjct:   17 YYFEYTDTFAVHVQGFFCYDSTYTKPYLGPEDSS---------AVPPLLLYAAVAGLPTLLITVTETVLFLVQYTSKEFDRTEKTVATGDCC--YLNPLVRRTFRFLGVYAFGLFTVDIFVNAGQVVTGNLAPYFLTVCKPNYTALGCQQALRYISH------------------QDACTGNQEDILR-ARKSFPSKEAALSVYAALYLAMYVTYTVQAKGTR-LAKPVLSLGLMCLAFLTGLNRVAEYRNHWSDVIAGFIIGMAIATFLVVSVVHNFK 264          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Medaka
Match: plppr5b (phospholipid phosphatase related 5 [Source:NCBI gene;Acc:101157682])

HSP 1 Score: 103.605 bits (257), Expect = 5.965e-24
Identity = 77/279 (27.60%), Postives = 133/279 (47.67%), Query Frame = 3
Query:  426 YFFRWVAILPLRKKSFQFYEMNFTRK--NEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMA------NQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            Y+F +     +  + F  Y+  +T+      +SS          +P + +Y      P  +I V E +LF +       ++T K +A G C  L+    +RR +RF   Y FG+  + + V+  ++  G L P FL++C P  +A G       +S+                   + C  N   I+R +R S PS  AA+S+YAA+Y+ +Y+    +    + L  P +++ L+ ++ L G+N V    N W+DVI G+I+G AIA +L V+V+  F+
Sbjct:   17 YYFEYTDTFAVHVQGFFCYDSTYTKPYLGPEDSS---------AVPPLLLYAAVAGLPTLLITVTETVLFLVQYTSKEFDRTEKTVATGDCCYLN--PLVRRTFRFLGVYAFGLFTVDIFVNAGQVVTGNLAPYFLTVCKPNYTALGCQQALRYISH------------------QDACTGNQEDILR-ARKSFPSKEAALSVYAALYLAMYVTYTVQAKGTR-LAKPVLSLGLMCLAFLTGLNRVAEYRNHWSDVIAGFIIGMAIATFLVVSVVHNFK 264          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Medaka
Match: ENSORLT00000034831.1 (phospholipid phosphatase-related protein type 4 [Source:NCBI gene;Acc:101157087])

HSP 1 Score: 98.5969 bits (244), Expect = 6.968e-21
Identity = 66/236 (27.97%), Postives = 117/236 (49.58%), Query Frame = 3
Query:  579 SFSFPIFVIIVGEMLLFC------MANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNRRI 1268
            +F+ P   I++GE +L+C       A QT   + A  C   +    IRR  RF   ++FG+    +  +V+++S G+  P +L +C P L+       H N+S+        + A + +    ++C   D  ++   R S PS  A ++ +AA+Y+++Y + +  +     LL P +  + V++++L G+  +    N   DV  G++LGAAIA YL V  +  FQ  E  S  R+
Sbjct:   83 AFAVPTVTILIGEAILYCYLSRNLSATQTEASINAAGC---NFNSYIRRAVRFIGVHVFGLCMTALITNVLQLSTGQHTPYWLDVCKPNLT-------HINMSSC-------DEAFILE----DICSGPDAGLINSGRKSFPSQHATLAAFAAVYISMYFNTV--LTDSAKLLKPLLVFSFVILAILTGLTRIIQFRNHPVDVYCGWMLGAAIAVYLGVYAVGNFQPSEDRSRSRL 295          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Medaka
Match: plppr1 (phospholipid phosphatase related 1 [Source:NCBI gene;Acc:101166890])

HSP 1 Score: 93.2041 bits (230), Expect = 2.331e-20
Identity = 68/235 (28.94%), Postives = 114/235 (48.51%), Query Frame = 3
Query:  552 IPEMGVYIHSFSFPIFVIIVGEMLLFCMANQTAKLLA------AGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQ 1238
            +P + +Y    + P  +I VGE+ ++ M +    LLA       G C  L+    IRR+ RF   + FG+    + V+  ++  G L P FLS+C P  +     ++H  +                   + N+C  N   +V  +R S PS  A++S+Y+A+YVT+Y+    K    + L  P + +  +  + L G+N V    N  +DV+ G+ILG+AIA +L V V+  F+
Sbjct:   67 VPPLILYCVVAAAPTVIIFVGEISMYVMKSTREALLAQEKTIVTGDCCYLN--PLIRRIIRFIGVFAFGLFATDIFVNAGQVVTGGLSPYFLSVCKPNYTGTECRFNHQFI------------------VHGNICTGNP-VVVENARRSFPSKDASLSVYSAVYVTMYITSTIKTKSSR-LAKPVLCLGTLCSAFLAGLNRVSEYRNHCSDVVAGFILGSAIALFLGVCVVNNFK 279          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Planmine SMEST
Match: SMESG000037098.1 (SMESG000037098.1)

HSP 1 Score: 1045.42 bits (2702), Expect = 0.000e+0
Identity = 511/515 (99.22%), Postives = 513/515 (99.61%), Query Frame = 3
Query:  258 MYDSSDSFEGNWLTRATVSKQNNAGCANERSKMATCLILVTTLLDXXXXXXXXXXEYFFRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMANQTAKLLAAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNRRILRHIALLQSGYRSKESKECDIKTDSMFEPVRLRRATTQPSHCPCHITTSPPTTGIFKLNSEETSTFFPLNKPNRKSVTLPISSPHIPMSHKQASTDKTATVENGCTNYPADNRLSAFNLPYKEINRNQRNSMMNPNFPKISQELINMLNAKQETKKQEREIIDLDKTRSSENPVSQFV 1802
            MYDSSDSFEGNWLTRATVSKQNNAGCANERSKMATCLILVTTLLDVAIVIAVAAIEYFFRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMANQTAKLL AGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLS+NGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDR+IVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNRRILRHIALLQSGYRSKESKECDIKTD MFEPVRLRRATTQPSHCPCHITTSPPTTGIFKLNSEETSTFFPLNKPNRKSVTLPISSPHIPMSHKQASTDKTATVENGCTNYPADNRLSAFNLPYKEINRNQRNSMMNPNFPKISQELINMLNAKQETKKQEREIIDLDKTRSSENPVSQFV
Sbjct:    1 MYDSSDSFEGNWLTRATVSKQNNAGCANERSKMATCLILVTTLLDVAIVIAVAAIEYFFRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHSFSFPIFVIIVGEMLLFCMANQTAKLLPAGICSPLHIPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSSNGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRNIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNRRILRHIALLQSGYRSKESKECDIKTDCMFEPVRLRRATTQPSHCPCHITTSPPTTGIFKLNSEETSTFFPLNKPNRKSVTLPISSPHIPMSHKQASTDKTATVENGCTNYPADNRLSAFNLPYKEINRNQRNSMMNPNFPKISQELINMLNAKQETKKQEREIIDLDKTRSSENPVSQFV 515          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Planmine SMEST
Match: SMESG000018237.1 (SMESG000018237.1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.180e-11
Identity = 50/194 (25.77%), Postives = 88/194 (45.36%), Query Frame = 3
Query:  690 PHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNRRIL 1271
            P  +  +Y F   +LFG+    +  +  K  IG LRP+F++ C          ++  N SN+ Y              +   C Q +  I++  R S PS  ++ S Y AI +TIYL     + H + L +  V    + ++++CG++ V   ++ W+DV+ G   G  +A  +    LR   ++E  +  R L
Sbjct:   94 PAVVINIYMFCGIFLFGVAFDQMLTNSSKFLIGRLRPHFINAC-------QVDFNKVNCSNYNYV-----------IIDDTFCLQTNPKILKDMRLSFPSGHSSCSAYCAIALTIYLIKRWNLRHFQVLRV-LVQALFIGLAVMCGLSRVSDYKHHWSDVLTGLCSGTVVAIVMWYVFLRAKNYREVNNEERHL 268          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Planmine SMEST
Match: SMESG000018250.1 (SMESG000018250.1)

HSP 1 Score: 57.7658 bits (138), Expect = 6.822e-9
Identity = 49/200 (24.50%), Postives = 87/200 (43.50%), Query Frame = 3
Query:  687 IPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLC---LPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNRRILRH 1277
            +P  I   Y F   + FG+       ++ K  IG LRP+FL  C   + KL+ + ++Y             Y E +          C +     ++  R S PS  +++S Y A+  TIYL     + H + L +  + +  + ++++CG + +   ++ W+DV  G   G  +A  +    LR     E V+N +  RH
Sbjct:   98 LPVVIMNCYTFCGIFFFGVGFDQSLTNLTKFVIGRLRPHFLDACKLDISKLNCSDHAY------------VYIENSA---------CAEKSARALKHMRMSFPSGHSSLSAYGAVAFTIYLTKRWNLGHFQILRV-LIQILYIGLAIMCGFSRISDYKHHWSDVAYGMCSGTVVAIVIWYVFLR-VNVDEEVTNGK--RH 272          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Planmine SMEST
Match: SMESG000018250.1 (SMESG000018250.1)

HSP 1 Score: 57.7658 bits (138), Expect = 7.505e-9
Identity = 49/200 (24.50%), Postives = 87/200 (43.50%), Query Frame = 3
Query:  687 IPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLC---LPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNRRILRH 1277
            +P  I   Y F   + FG+       ++ K  IG LRP+FL  C   + KL+ + ++Y             Y E +          C +     ++  R S PS  +++S Y A+  TIYL     + H + L +  + +  + ++++CG + +   ++ W+DV  G   G  +A  +    LR     E V+N +  RH
Sbjct:  105 LPVVIMNCYTFCGIFFFGVGFDQSLTNLTKFVIGRLRPHFLDACKLDISKLNCSDHAY------------VYIENSA---------CAEKSARALKHMRMSFPSGHSSLSAYGAVAFTIYLTKRWNLGHFQILRV-LIQILYIGLAIMCGFSRISDYKHHWSDVAYGMCSGTVVAIVIWYVFLR-VNVDEEVTNGK--RH 279          
BLAST of Phospholipid phosphatase-related protein type 5 vs. Planmine SMEST
Match: SMESG000018250.1 (SMESG000018250.1)

HSP 1 Score: 57.7658 bits (138), Expect = 7.906e-9
Identity = 49/200 (24.50%), Postives = 87/200 (43.50%), Query Frame = 3
Query:  687 IPHTIRRLYRFSLSYLFGILCLMVTVDVMKISIGELRPNFLSLC---LPKLSANGNSYHHNNVSNFYYTSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVTIYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGYILGAAIAFYLTVAVLRQFQFQESVSNRRILRH 1277
            +P  I   Y F   + FG+       ++ K  IG LRP+FL  C   + KL+ + ++Y             Y E +          C +     ++  R S PS  +++S Y A+  TIYL     + H + L +  + +  + ++++CG + +   ++ W+DV  G   G  +A  +    LR     E V+N +  RH
Sbjct:   93 LPVVIMNCYTFCGIFFFGVGFDQSLTNLTKFVIGRLRPHFLDACKLDISKLNCSDHAY------------VYIENSA---------CAEKSARALKHMRMSFPSGHSSLSAYGAVAFTIYLTKRWNLGHFQILRV-LIQILYIGLAIMCGFSRISDYKHHWSDVAYGMCSGTVVAIVIWYVFLR-VNVDEEVTNGK--RH 267          
The following BLAST results are available for this feature:
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLPPR51.133e-2430.83phospholipid phosphatase related 5 [Source:HGNC Sy... [more]
PLPPR51.262e-2430.83phospholipid phosphatase related 5 [Source:HGNC Sy... [more]
PLPPR51.572e-2430.83phospholipid phosphatase related 5 [Source:HGNC Sy... [more]
PLPPR13.663e-2027.93phospholipid phosphatase related 1 [Source:HGNC Sy... [more]
PLPPR13.663e-2027.93phospholipid phosphatase related 1 [Source:HGNC Sy... [more]
back to top
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plpr-11.251e-1927.34PhosphoLipid Phosphatase Related homolog [Source:... [more]
plpp-1.16.204e-1126.78PhosphoLipid PhosPhatase homolog [Source:UniProtK... [more]
plpp-1.16.483e-1126.78PhosphoLipid PhosPhatase homolog [Source:UniProtK... [more]
plpp-1.17.565e-1126.78PhosphoLipid PhosPhatase homolog [Source:UniProtK... [more]
plpp-1.17.671e-1126.78PhosphoLipid PhosPhatase homolog [Source:UniProtK... [more]
back to top
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
laza3.218e-1326.70gene:FBgn0037163 transcript:FBtr0078508[more]
CG114261.247e-1128.15gene:FBgn0037166 transcript:FBtr0078506[more]
CG114381.039e-925.00gene:FBgn0037164 transcript:FBtr0345586[more]
CG114381.039e-925.00gene:FBgn0037164 transcript:FBtr0078504[more]
wun7.387e-923.12gene:FBgn0016078 transcript:FBtr0306111[more]
back to top
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plppr5b1.279e-2327.11phospholipid phosphatase related 5b [Source:ZFIN;A... [more]
plppr5a1.213e-2131.06phospholipid phosphatase related 5a [Source:ZFIN;A... [more]
plppr2a2.267e-2126.45phospholipid phosphatase related 2a [Source:ZFIN;A... [more]
plppr2a2.918e-2126.45phospholipid phosphatase related 2a [Source:ZFIN;A... [more]
plppr2b2.790e-2026.07phospholipid phosphatase related 2b [Source:ZFIN;A... [more]
back to top
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLPPR53.511e-2528.52phospholipid phosphatase related 5 [Source:NCBI ge... [more]
PLPPR53.895e-2528.52phospholipid phosphatase related 5 [Source:NCBI ge... [more]
PLPPR54.560e-2528.52phospholipid phosphatase related 5 [Source:NCBI ge... [more]
plppr38.344e-1925.63phospholipid phosphatase related 3 [Source:NCBI ge... [more]
plppr39.279e-1925.63phospholipid phosphatase related 3 [Source:NCBI ge... [more]
back to top
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plppr51.844e-2430.96phospholipid phosphatase related 5 [Source:MGI Sym... [more]
Plppr51.983e-2430.96phospholipid phosphatase related 5 [Source:MGI Sym... [more]
Plppr53.556e-2430.96phospholipid phosphatase related 5 [Source:MGI Sym... [more]
Plppr58.749e-2330.09phospholipid phosphatase related 5 [Source:MGI Sym... [more]
Plppr34.867e-2125.27phospholipid phosphatase related 3 [Source:MGI Sym... [more]
back to top
BLAST of Phospholipid phosphatase-related protein type 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q32ZL2|PLPR5_HUMAN6.060e-2430.83Phospholipid phosphatase-related protein type 5 OS... [more]
sp|Q8BJ52|PLPR5_MOUSE1.290e-2330.96Phospholipid phosphatase-related protein type 5 OS... [more]
sp|Q6GM05|PLPR5_XENLA1.991e-2328.21Phospholipid phosphatase-related protein type 5 OS... [more]
sp|Q6IQH6|PLPR1_DANRE5.164e-2028.57Phospholipid phosphatase-related protein type 1 OS... [more]
sp|Q7TPB0|PLPR3_MOUSE1.101e-1925.64Phospholipid phosphatase-related protein type 3 OS... [more]
back to top
BLAST of Phospholipid phosphatase-related protein type 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4B5G61.337e-4732.89acidPPc domain-containing protein OS=Lottia gigant... [more]
A0A210QFK62.603e-4231.07Lipid phosphate phosphatase-related protein type 5... [more]
K1Q6091.657e-4132.06Lipid phosphate phosphatase-related protein type 5... [more]
R7TIN03.560e-3728.76acidPPc domain-containing protein OS=Capitella tel... [more]
A0A2T7NRS56.152e-3731.02acidPPc domain-containing protein OS=Pomacea canal... [more]
back to top
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plppr5b2.491e-2327.96phospholipid phosphatase related 5 [Source:NCBI ge... [more]
plppr5b2.543e-2327.96phospholipid phosphatase related 5 [Source:NCBI ge... [more]
plppr2a1.416e-2227.54phospholipid phosphatase-related protein type 5 [S... [more]
plppr2a7.854e-2228.06phospholipid phosphatase-related protein type 5 [S... [more]
plppr17.603e-2127.46phospholipid phosphatase related 1 [Source:HGNC Sy... [more]
back to top
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
plpp1a7.211e-1527.07phospholipid phosphatase 1a [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000004167.16.303e-1124.70pep scaffold:Pmarinus_7.0:GL482427:29:3570:-1 gene... [more]
ENSPMAT00000004168.13.205e-1024.69pep scaffold:Pmarinus_7.0:GL482427:101:9483:-1 gen... [more]
back to top
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO334907.969e-1425.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451649.444e-1224.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334911.584e-926.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349521.175e-827.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phospholipid phosphatase-related protein type 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plppr5b4.338e-2427.60phospholipid phosphatase related 5 [Source:NCBI ge... [more]
plppr5b4.844e-2427.24phospholipid phosphatase related 5 [Source:NCBI ge... [more]
plppr5b5.965e-2427.60phospholipid phosphatase related 5 [Source:NCBI ge... [more]
ENSORLT00000034831.16.968e-2127.97phospholipid phosphatase-related protein type 4 [S... [more]
plppr12.331e-2028.94phospholipid phosphatase related 1 [Source:NCBI ge... [more]
back to top
BLAST of Phospholipid phosphatase-related protein type 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037098.10.000e+099.22SMESG000037098.1[more]
SMESG000018237.12.180e-1125.77SMESG000018237.1[more]
SMESG000018250.16.822e-924.50SMESG000018250.1[more]
SMESG000018250.17.505e-924.50SMESG000018250.1[more]
SMESG000018250.17.906e-924.50SMESG000018250.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031006 ID=SMED30031006|Name=Phospholipid phosphatase-related protein type 5|organism=Schmidtea mediterranea sexual|type=transcript|length=1944bp
CCTACCCCCGGTCAGCACACGGGATAATTTCTACCACCAAACAGAGTGGA
TCAGAGAAATTTTAAATCCAACGAAAGTTTGCAGTAAAACAAATTCAGCA
GTGCACGAGATCTCAGTCAATTAAGCGATGAATGATGATATTGGATCTCG
TGGATTCGTCATTAGGAATACGGCTAAACGTCTCGTATATCATCGCATTA
TTCATTGTATCACTTCCGATCTCTCTTGATCTGTGTAAAACATTTCTAAG
TCAATCCATGTATGACAGCAGCGACTCATTTGAAGGCAATTGGTTGACGA
GAGCGACAGTCTCAAAACAGAACAATGCAGGCTGCGCGAACGAAAGGAGT
AAAATGGCAACTTGTCTTATTCTCGTCACGACGTTACTTGATGTTGCAAT
TGTGATTGCAGTGGCCGCAATTGAATACTTTTTCAGGTGGGTTGCAATTT
TGCCATTACGCAAAAAGTCTTTTCAGTTTTACGAAATGAATTTCACTAGA
AAGAATGAAATGGAGTCTTCCGAATTTGAGGAATTCATATTAGGCGGCAA
AATACCAGAAATGGGAGTTTATATTCATTCATTCAGCTTTCCAATTTTTG
TTATTATAGTTGGCGAGATGCTTTTATTTTGTATGGCCAATCAAACTGCC
AAACTCCTTGCTGCGGGAATATGCTCACCCCTTCATATTCCACATACAAT
AAGGCGGCTTTACAGATTTTCATTGTCCTACCTTTTCGGTATTTTGTGCC
TGATGGTCACGGTTGACGTCATGAAGATATCAATCGGTGAACTGCGACCG
AATTTCCTATCGCTTTGCCTTCCAAAGCTTTCAGCCAATGGCAACAGTTA
TCACCATAATAATGTCAGTAATTTCTATTACACATCACCATACCCAGAAG
GGGCAAAATTATATCAGTCAACAAATTACAATTTGTGCCAGCAAAACGAT
CGCAGTATTGTCAGAAAATCAAGAACCTCCTGCCCCTCGATGAGAGCAGC
TATCAGCATGTACGCAGCCATTTATGTCACGATTTATCTACATGGAATCG
GAAAGATTCATCATTGCAAGTACCTTCTCATCCCTTTTGTCAATATGGCG
CTGGTGCTCATTTCCTTGCTGTGTGGAATCAACCTGGTTGGACTCGGGGA
GAATTGGTGGACTGATGTCATTGTTGGATACATCCTCGGTGCGGCTATTG
CATTTTATTTGACTGTTGCTGTTCTTCGTCAATTCCAATTCCAAGAATCT
GTGTCAAACAGAAGAATTCTTCGACATATTGCGTTGTTGCAGAGTGGTTA
CAGAAGCAAGGAATCTAAGGAATGTGACATCAAAACAGATAGCATGTTTG
AGCCCGTCAGACTAAGAAGAGCAACTACCCAACCCTCACACTGCCCATGC
CATATCACTACCAGTCCTCCAACAACTGGAATATTCAAGCTCAATTCTGA
AGAGACTAGCACATTTTTCCCATTGAACAAGCCAAACCGAAAATCAGTCA
CCCTTCCTATCAGCTCCCCACATATACCAATGAGTCACAAGCAGGCCAGC
ACCGATAAGACAGCAACCGTGGAAAATGGGTGCACAAACTATCCAGCTGA
TAACAGATTATCTGCGTTCAATTTGCCCTACAAAGAGATTAACAGAAACC
AGAGAAACTCGATGATGAATCCAAACTTTCCCAAGATCAGTCAGGAGCTG
ATCAACATGCTAAATGCCAAGCAGGAAACCAAAAAACAAGAACGAGAAAT
AATTGACCTTGATAAAACACGCAGCAGTGAAAATCCAGTTTCCCAATTTG
TTTAAATATTTTTTGACTTCCAATTTGCCTACCAAGGTGGTACAACAACA
TAATTGTTTATTCGCTTGTTTACTTTCATTACGGTTATTTGGGCATCAAT
ATGTGATCCTTGCATCCTTATCCGTGATTTTTATTGTTTATTAT
back to top

protein sequence of SMED30031006-orf-1

>SMED30031006-orf-1 ID=SMED30031006-orf-1|Name=SMED30031006-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=558bp
MMILDLVDSSLGIRLNVSYIIALFIVSLPISLDLCKTFLSQSMYDSSDSF
EGNWLTRATVSKQNNAGCANERSKMATCLILVTTLLDVAIVIAVAAIEYF
FRWVAILPLRKKSFQFYEMNFTRKNEMESSEFEEFILGGKIPEMGVYIHS
FSFPIFVIIVGEMLLFCMANQTAKLLAAGICSPLHIPHTIRRLYRFSLSY
LFGILCLMVTVDVMKISIGELRPNFLSLCLPKLSANGNSYHHNNVSNFYY
TSPYPEGAKLYQSTNYNLCQQNDRSIVRKSRTSCPSMRAAISMYAAIYVT
IYLHGIGKIHHCKYLLIPFVNMALVLISLLCGINLVGLGENWWTDVIVGY
ILGAAIAFYLTVAVLRQFQFQESVSNRRILRHIALLQSGYRSKESKECDI
KTDSMFEPVRLRRATTQPSHCPCHITTSPPTTGIFKLNSEETSTFFPLNK
PNRKSVTLPISSPHIPMSHKQASTDKTATVENGCTNYPADNRLSAFNLPY
KEINRNQRNSMMNPNFPKISQELINMLNAKQETKKQEREIIDLDKTRSSE
NPVSQFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016311dephosphorylation
GO:0006644phospholipid metabolic process
GO:0007165signal transduction
GO:0010976positive regulation of neuron projection development
GO:0046839phospholipid dephosphorylation
GO:0051491positive regulation of filopodium assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002028dorsal-ventral muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043216PLPP
IPR036938P_Acid_Pase_2/haloperoxi_sf
IPR000326P_Acid_Pase_2/haloperoxidase
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0008195phosphatidate phosphatase activity
GO:0016787hydrolase activity
GO:0042577lipid phosphatase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 526..546
NoneNo IPR availableGENE3DG3DSA:1.20.144.10coord: 140..384
e-value: 5.9E-21
score: 76.6
NoneNo IPR availablePANTHERPTHR10165:SF102coord: 96..374
NoneNo IPR availableTMHMMTMhelixcoord: 290..307
NoneNo IPR availableTMHMMTMhelixcoord: 346..368
NoneNo IPR availableTMHMMTMhelixcoord: 314..336
NoneNo IPR availableTMHMMTMhelixcoord: 79..101
NoneNo IPR availableTMHMMTMhelixcoord: 196..218
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 145..167
IPR000326Phosphatidic acid phosphatase type 2/haloperoxidaseSMARTSM00014acid_phosph_2coord: 196..361
e-value: 4.1E-6
score: 36.3
IPR000326Phosphatidic acid phosphatase type 2/haloperoxidasePFAMPF01569PAP2coord: 198..365
e-value: 7.6E-14
score: 51.6
IPR043216Phospholipid phosphatasePANTHERPTHR10165LIPID PHOSPHATE PHOSPHATASEcoord: 96..374
IPR036938Phosphatidic acid phosphatase type 2/haloperoxidase superfamilySUPERFAMILYSSF48317Acid phosphatase/Vanadium-dependent haloperoxidasecoord: 179..371