A disintegrin and metalloproteinase with thrombospondin motifs 2

Overview
NameA disintegrin and metalloproteinase with thrombospondin motifs 2
Smed IDSMED30031005
Length (bp)1366
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of A disintegrin and metalloproteinase with thrombospondin motifs 2 (SMED30031005) t-SNE clustered cells

Violin plots show distribution of expression levels for A disintegrin and metalloproteinase with thrombospondin motifs 2 (SMED30031005) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of A disintegrin and metalloproteinase with thrombospondin motifs 2 (SMED30031005) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for A disintegrin and metalloproteinase with thrombospondin motifs 2 (SMED30031005) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031005

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30031005SMESG000051172.1 SmedASXL_016093SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031005SMESG000051172.1 dd_Smed_v4_16551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031005SMESG000051172.1 dd_Smed_v4_16551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031005SMESG000051172.1 dd_Smed_v4_16551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30031005SMESG000051172.1 dd_Smed_v4_16551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031005SMESG000051172.1 dd_Smed_v6_16551_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Human
Match: LEXM (lymphocyte expansion molecule [Source:HGNC Symbol;Acc:HGNC:26854])

HSP 1 Score: 79.337 bits (194), Expect = 2.261e-15
Identity = 71/291 (24.40%), Postives = 133/291 (45.70%), Query Frame = 1
Query:   97 SAFGSSVPKFTCYGIHPKLQSTNSF--------YSKSVPPNVGPGSYNVKHQEKSSKNRFSSEM---WKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATKILQSKGR-RFSDDIKDCYPGPSTYGI---PQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQY-NFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITN 921
            + FG    +F    ++P  +  ++F        YS  V  ++GPG+Y+ K +   SK +   E+   W       +   +P+F  +   + +  K+++LGPG Y +++ +++L +   +T+ L S G  RF     + YPGP  YG    P   +++    R ++    L+ R  N           +GPG Y  +S +   +    G RG YD  + DRS+P+  GH+++          + +F  E++  H+K H   G F +  + P+ P +R++W +    P  +  
Sbjct:   27 APFGVQSHRFDISAVYPNWKKFSTFTEAPYSTRYSTQVS-HIGPGTYSSK-ETCFSKKKLMKEVDTGWAKAQEATRLTQLPHFQYQAIMKEKRLKEQKLGPGSYNLKDFLEQLREKPCSTRGLLSSGEVRFRGLTGNYYPGPGNYGEKGNPYTKLEENAWNRSHSEG--LMCRMSNKPHPRPHQGSGLGPGTYFFKSDLETYVARSVGTRGPYDTFSGDRSKPLPYGHYSMQKKKPRELMNFKSFVEELNSHHNKKH---GVFSKLPRNPKTPTERIYWANLSQCPRTLAT 310          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Human
Match: LEXM (lymphocyte expansion molecule [Source:HGNC Symbol;Acc:HGNC:26854])

HSP 1 Score: 78.9518 bits (193), Expect = 3.113e-15
Identity = 71/291 (24.40%), Postives = 133/291 (45.70%), Query Frame = 1
Query:   97 SAFGSSVPKFTCYGIHPKLQSTNSF--------YSKSVPPNVGPGSYNVKHQEKSSKNRFSSEM---WKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATKILQSKGR-RFSDDIKDCYPGPSTYGI---PQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQY-NFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITN 921
            + FG    +F    ++P  +  ++F        YS  V  ++GPG+Y+ K +   SK +   E+   W       +   +P+F  +   + +  K+++LGPG Y +++ +++L +   +T+ L S G  RF     + YPGP  YG    P   +++    R ++    L+ R  N           +GPG Y  +S +   +    G RG YD  + DRS+P+  GH+++          + +F  E++  H+K H   G F +  + P+ P +R++W +    P  +  
Sbjct:   27 APFGVQSHRFDISAVYPNWKKFSTFTEAPYSTRYSTQVS-HIGPGTYSSK-ETCFSKKKLMKEVDTGWAKAQEATRLTQLPHFQYQAIMKEKRLKEQKLGPGSYNLKDFLEQLREKPCSTRGLLSSGEVRFRGLTGNYYPGPGNYGEKGNPYTKLEENAWNRSHSEG--LMCRMSNKPHPRPHQGSGLGPGTYFFKSDLETYVARSVGTRGPYDTFSGDRSKPLPYGHYSMQKKKPRELMNFKSFVEELNSHHNKKH---GVFSKLPRNPKTPTERIYWANLSQCPRTLAT 310          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Xenopus
Match: ENSXETT00000045218.1 (lymphocyte expansion molecule [Source:NCBI gene;Acc:100491026])

HSP 1 Score: 127.487 bits (319), Expect = 5.284e-32
Identity = 113/388 (29.12%), Postives = 176/388 (45.36%), Query Frame = 1
Query:   88 MSKSAFGSSVPKFTCYGIHPKLQSTNSF--------YSKSVPPNVGPGSYNVKHQEKSS---KNRFSSEMWKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATK-ILQSKGRRFSDDIKDCYPGPSTYGI---PQDIIDQADIRRKYANSVPLLDRG-GNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQY---NFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYKIGKSKAGFGSSDIRMNKFALANFMGENNTLIGPGRYNCDSKGIGESGNSFESAFKSLVSK-ISDPKTIDVLRSRVR 1191
             S + FGS   +F    +HP  + T S+         +  +   +GPG+YN +  + S    +   S+  WK     EK  T+P+ + KE  +     K+ LGPG Y ++  +  L K     + +  +K  RF  + + C PGP +YG    P  ++++     K A+S  ++D   G  + LP+     +GPG YN++S IN+ L H  G RG YD  +  R QPI  GH A   +    PG Y   +F  +++  H K +   G F    QYP+ P +R+F     N P  + N   P  Y+          S A F SS  R  K +     G NN  +G GRY+      G++     S+F S   + +S+P    +L  R+R
Sbjct:    6 FSGAPFGSQSARFDVSAVHPDSKKTGSYTQVPYCRRATSELERRLGPGTYNAEQSDFSPSVLEKNASAPAWKRAQETEKLTTMPHLLYKETYERNRLLKQNLGPGRYNIKSFLDLLEKKPSCIRGVCSTKEERFKKNEQFCTPGPGSYGKGGNPYSLLEERV--SKSASSKGIMDTSPGEGHSLPST-GCELGPGTYNLKSSINETLAHVVGNRGPYDLFSASREQPILYGHFAEPKNRGPEPGAYKVKSFTEDLESHHRKKY---GVFGNLAQYPKVPTERIFI----NRPKTMGNP-GPGLYDPKPFYEPKRHSAAPFLSSAKRFEKKSCRLLFGSNNP-VGVGRYDVAKHLRGKAATPLRSSFLSKTERYLSNPARDKILEERLR 381          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Mouse
Match: Lexm (lymphocyte expansion molecule [Source:MGI Symbol;Acc:MGI:2681853])

HSP 1 Score: 87.0409 bits (214), Expect = 5.036e-18
Identity = 91/347 (26.22%), Postives = 159/347 (45.82%), Query Frame = 1
Query:   97 SAFGSSVPKFTCYGIHPKLQSTNSF----YSK--SVP-PNVGPGSYNVKHQEKSSK--NRFSSEMWKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATKILQSKGR-RFSDDIKDCYPGPSTYGI---PQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFH----IGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQY----NFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYKIGKSKAGFGSSDIRMNKFALANFMGENNTLIGPGRY 1074
            + FG    +F    ++P  +  ++F    YS+  SV   ++GPG+YN K    S K   +     W   +   +   +P+F  +  K+ + ++  + GPG Y +++ + +L K   + + L S G  RF   I + YPGP  YG    P   +++    R +++   L+ R  N      PP FH    +GPG Y I+S +   +   TG RG YD  + +RS P+  GH+++     + P +     +F +E++  H K      K+ R+   P+ P +R+FWT     P ++ +   P S+ L     +   ++  F  +  R    A    +G  N  +G GRY
Sbjct:   24 APFGVQSHRFDVSAVYPNQKKFSTFTEAPYSRHHSVELSHIGPGTYNSKDTCFSKKFLEQKLGSGWSQAHEATRLTQLPHFHYQAIKKEKEQQVHKRGPGSYNIKDFITELQKKPQSKRGLLSSGETRFRGFIGNYYPGPGNYGEKGNPYTQLEEKAWNRSHSDG--LMCRVSNK-----PPLFHQGSGLGPGTYTIKSDLETFVKKSTGNRGPYDIFSGERSSPLPYGHYSV---QKMKPKELTDYKSFLDEMNSQHKKKQGVFSKYPRD---PKHPTERIFWTTLSQCPKNM-DIAGPGSW-LPHETEQKHVNRPPFLLASKRCGLKAYQMILGTWNP-VGVGRY 354          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Mouse
Match: Lexm (lymphocyte expansion molecule [Source:MGI Symbol;Acc:MGI:2681853])

HSP 1 Score: 87.0409 bits (214), Expect = 5.036e-18
Identity = 91/347 (26.22%), Postives = 159/347 (45.82%), Query Frame = 1
Query:   97 SAFGSSVPKFTCYGIHPKLQSTNSF----YSK--SVP-PNVGPGSYNVKHQEKSSK--NRFSSEMWKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATKILQSKGR-RFSDDIKDCYPGPSTYGI---PQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFH----IGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQY----NFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYKIGKSKAGFGSSDIRMNKFALANFMGENNTLIGPGRY 1074
            + FG    +F    ++P  +  ++F    YS+  SV   ++GPG+YN K    S K   +     W   +   +   +P+F  +  K+ + ++  + GPG Y +++ + +L K   + + L S G  RF   I + YPGP  YG    P   +++    R +++   L+ R  N      PP FH    +GPG Y I+S +   +   TG RG YD  + +RS P+  GH+++     + P +     +F +E++  H K      K+ R+   P+ P +R+FWT     P ++ +   P S+ L     +   ++  F  +  R    A    +G  N  +G GRY
Sbjct:   24 APFGVQSHRFDVSAVYPNQKKFSTFTEAPYSRHHSVELSHIGPGTYNSKDTCFSKKFLEQKLGSGWSQAHEATRLTQLPHFHYQAIKKEKEQQVHKRGPGSYNIKDFITELQKKPQSKRGLLSSGETRFRGFIGNYYPGPGNYGEKGNPYTQLEEKAWNRSHSDG--LMCRVSNK-----PPLFHQGSGLGPGTYTIKSDLETFVKKSTGNRGPYDIFSGERSSPLPYGHYSV---QKMKPKELTDYKSFLDEMNSQHKKKQGVFSKYPRD---PKHPTERIFWTTLSQCPKNM-DIAGPGSW-LPHETEQKHVNRPPFLLASKRCGLKAYQMILGTWNP-VGVGRY 354          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Mouse
Match: Lexm (lymphocyte expansion molecule [Source:MGI Symbol;Acc:MGI:2681853])

HSP 1 Score: 87.0409 bits (214), Expect = 5.036e-18
Identity = 91/347 (26.22%), Postives = 159/347 (45.82%), Query Frame = 1
Query:   97 SAFGSSVPKFTCYGIHPKLQSTNSF----YSK--SVP-PNVGPGSYNVKHQEKSSK--NRFSSEMWKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATKILQSKGR-RFSDDIKDCYPGPSTYGI---PQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFH----IGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQY----NFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYKIGKSKAGFGSSDIRMNKFALANFMGENNTLIGPGRY 1074
            + FG    +F    ++P  +  ++F    YS+  SV   ++GPG+YN K    S K   +     W   +   +   +P+F  +  K+ + ++  + GPG Y +++ + +L K   + + L S G  RF   I + YPGP  YG    P   +++    R +++   L+ R  N      PP FH    +GPG Y I+S +   +   TG RG YD  + +RS P+  GH+++     + P +     +F +E++  H K      K+ R+   P+ P +R+FWT     P ++ +   P S+ L     +   ++  F  +  R    A    +G  N  +G GRY
Sbjct:   24 APFGVQSHRFDVSAVYPNQKKFSTFTEAPYSRHHSVELSHIGPGTYNSKDTCFSKKFLEQKLGSGWSQAHEATRLTQLPHFHYQAIKKEKEQQVHKRGPGSYNIKDFITELQKKPQSKRGLLSSGETRFRGFIGNYYPGPGNYGEKGNPYTQLEEKAWNRSHSDG--LMCRVSNK-----PPLFHQGSGLGPGTYTIKSDLETFVKKSTGNRGPYDIFSGERSSPLPYGHYSV---QKMKPKELTDYKSFLDEMNSQHKKKQGVFSKYPRD---PKHPTERIFWTTLSQCPKNM-DIAGPGSW-LPHETEQKHVNRPPFLLASKRCGLKAYQMILGTWNP-VGVGRY 354          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. UniProt/SwissProt
Match: sp|B1H283|LEXM_RAT (Lymphocyte expansion molecule OS=Rattus norvegicus OX=10116 GN=Lexm PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 2.573e-17
Identity = 93/345 (26.96%), Postives = 153/345 (44.35%), Query Frame = 1
Query:   97 SAFGSSVPKFTCYGIHPKLQSTNSF----YSK--SVP-PNVGPGSYNVKHQEKSSKNRFSSEM----WKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATKILQSKGR-RFSDDIKDCYPGPSTYGIPQDIIDQADIRRKYANSVPLLDRGGNSNRLPT--PPSFH----IGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQY-NFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYKIGKSKAGFGSSDIRMNKFALANFMGENNTLIGPGRY 1074
            + FG    +F    +HP  +  ++F    YS+  SV   ++GPG+YN K  E     +F  +     W       +   +P+F  +  K+   ++  + GPG Y +++ + +L K   + + L S G  RF   I + YPGP  YG   +   Q +      NS       G   RL +  PP  H    +GPG Y I+S I   +   TG RG YD  + +RS P+  GH+++          + +F +E++  H K    +G F +  + P+ P +R++WT     P D+ N   P S+ L     +   ++  F  +  R    A    +G  N  +G GRY
Sbjct:   11 APFGVQSHRFDVSAVHPNQKKFSTFTEAPYSRHHSVELSHIGPGTYNSK--ETCFSKKFLEQKLGAGWARAQEASRLTQLPHFHFQAIKKEREQQANKRGPGSYNIKDFLTELQKKPQSKRGLLSSGETRFRGLIGNYYPGPGNYGEKGNPYTQLE-----KNSWNRSHSDGLMCRLSSKPPPLSHQGSGLGPGTYTIKSDIETFVEKSTGTRGPYDIFSGERSSPVPYGHYSVQKKKPRELTSFKSFVDELNAPHKK---KQGGFSKYPRDPKHPTERIYWTTLSQCPKDV-NVAGPGSW-LPHETEQKHVNRPPFLLASKRSGLKACQMLLGTWNP-VGVGRY 342          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. UniProt/SwissProt
Match: sp|A2AVQ5|LEXM_MOUSE (Lymphocyte expansion molecule OS=Mus musculus OX=10090 GN=Lexm PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.522e-17
Identity = 91/347 (26.22%), Postives = 159/347 (45.82%), Query Frame = 1
Query:   97 SAFGSSVPKFTCYGIHPKLQSTNSF----YSK--SVP-PNVGPGSYNVKHQEKSSK--NRFSSEMWKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATKILQSKGR-RFSDDIKDCYPGPSTYGI---PQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFH----IGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQY----NFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYKIGKSKAGFGSSDIRMNKFALANFMGENNTLIGPGRY 1074
            + FG    +F    ++P  +  ++F    YS+  SV   ++GPG+YN K    S K   +     W   +   +   +P+F  +  K+ + ++  + GPG Y +++ + +L K   + + L S G  RF   I + YPGP  YG    P   +++    R +++   L+ R  N      PP FH    +GPG Y I+S +   +   TG RG YD  + +RS P+  GH+++     + P +     +F +E++  H K      K+ R+   P+ P +R+FWT     P ++ +   P S+ L     +   ++  F  +  R    A    +G  N  +G GRY
Sbjct:   24 APFGVQSHRFDVSAVYPNQKKFSTFTEAPYSRHHSVELSHIGPGTYNSKDTCFSKKFLEQKLGSGWSQAHEATRLTQLPHFHYQAIKKEKEQQVHKRGPGSYNIKDFITELQKKPQSKRGLLSSGETRFRGFIGNYYPGPGNYGEKGNPYTQLEEKAWNRSHSDG--LMCRVSNK-----PPLFHQGSGLGPGTYTIKSDLETFVKKSTGNRGPYDIFSGERSSPLPYGHYSV---QKMKPKELTDYKSFLDEMNSQHKKKQGVFSKYPRD---PKHPTERIFWTTLSQCPKNM-DIAGPGSW-LPHETEQKHVNRPPFLLASKRCGLKAYQMILGTWNP-VGVGRY 354          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. UniProt/SwissProt
Match: sp|Q3ZCV2|LEXM_HUMAN (Lymphocyte expansion molecule OS=Homo sapiens OX=9606 GN=LEXM PE=2 SV=4)

HSP 1 Score: 78.9518 bits (193), Expect = 1.495e-14
Identity = 71/291 (24.40%), Postives = 133/291 (45.70%), Query Frame = 1
Query:   97 SAFGSSVPKFTCYGIHPKLQSTNSF--------YSKSVPPNVGPGSYNVKHQEKSSKNRFSSEM---WKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATKILQSKGR-RFSDDIKDCYPGPSTYGI---PQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQY-NFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITN 921
            + FG    +F    ++P  +  ++F        YS  V  ++GPG+Y+ K +   SK +   E+   W       +   +P+F  +   + +  K+++LGPG Y +++ +++L +   +T+ L S G  RF     + YPGP  YG    P   +++    R ++    L+ R  N           +GPG Y  +S +   +    G RG YD  + DRS+P+  GH+++          + +F  E++  H+K H   G F +  + P+ P +R++W +    P  +  
Sbjct:   27 APFGVQSHRFDISAVYPNWKKFSTFTEAPYSTRYSTQVS-HIGPGTYSSK-ETCFSKKKLMKEVDTGWAKAQEATRLTQLPHFQYQAIMKEKRLKEQKLGPGSYNLKDFLEQLREKPCSTRGLLSSGEVRFRGLTGNYYPGPGNYGEKGNPYTKLEENAWNRSHSEG--LMCRMSNKPHPRPHQGSGLGPGTYFFKSDLETYVARSVGTRGPYDTFSGDRSKPLPYGHYSMQKKKPRELMNFKSFVEELNSHHNKKH---GVFSKLPRNPKTPTERIYWANLSQCPRTLAT 310          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. TrEMBL
Match: A0A1I8HJX0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031511g1 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 3.064e-53
Identity = 140/407 (34.40%), Postives = 216/407 (53.07%), Query Frame = 1
Query:   91 SKSAFGSSVPKFTCYGIHPK--LQSTNSFYSKSVPPNVGPGSYNVKHQEKSSKNRFSSEM----WKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMK---KLSKDNHATKILQSKGRRFSDDI-KDCYPGPSTYG---IPQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQ--RGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYNFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYK---IGKSKAGFGSSDIRMNKFALANFMGENNTLIGPGRYNC----DSKGIGESGNSFESAFKSLVSKISDPKTIDVLRSRVRPINLPEMKKKKETHLATE 1245
            S + FG    +F   GIHPK  L  T +     +  ++GPGSY+V    + S  R +S      WK  Y++ +Q  IP+ + KE+   + E+KR+LGPGYY+V  S     ++SK      +L+++  RF     ++  PGP +YG   +P    ++ D +R++   V +LD GG+  R P      +GPG Y I S  + +   + G+  RG Y+  +LDR QP+KTGH+A + + NLGPGQYNF + +   +       GKFL+  QYP KP  R++W  P   P D TN+VS ASY+ +   +K     KS+AGF S+  R +K +L  F  +N   +GPGRY+     D+  +    N F S  ++ +S         V R R+R  ++P  ++ +  H+ATE
Sbjct:   11 SGAPFGFQSTRFDVSGIHPKRKLPGTLTQVPGGISADLGPGSYDVLQYNEFSDKRVASRAQGPNWKRAYDVHRQSQIPHLLYKEQHAEKEEQKRKLGPGYYDVAGSQDYRLEVSKRG----LLEAREPRFRGHTGQEGNPGPGSYGKSGVPHLHKEEMDEKRRHCGRVGMLDCGGS--RAPPQQGTDLGPGTYQIPSFTDLLAAKKAGKNSRGPYEVFSLDRDQPVKTGHYARMSTGNLGPGQYNFKDGVADLNRPEKRNHGKFLKMVQYPAKPCDRIYWMTPATVPPDPTNKVSAASYHPTDPNFKKESFSKSEAGFLSTSNRQDKRSLM-FFTKNFNQVGPGRYDIQRQEDTAHVNAHTNDFVSKTEARLSHGQQ----QVYRERLRDKDIPPGRRFRVDHVATE 406          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. TrEMBL
Match: A7SMX3 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g233391 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 8.479e-39
Identity = 121/394 (30.71%), Postives = 201/394 (51.02%), Query Frame = 1
Query:   91 SKSAFGSSVPKFTCYGIHPKLQSTNSF----YSK----SVPPNVGPGSYNVKH---QEKSSKNRFSSEMWKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATK-ILQSKGRRFSDDIKDCYPGPSTYG---IPQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYN---FGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYKIGKSKAG----FGSSDIRMNKFALANFMGENNTLIGPGRYNCDSKGIGESGNSFESAFKSLVSK---ISDPKTIDVLRSR-VRP 1194
            S + FG    +F    IHPK ++  +F    Y K     V   +GPGSYN++     +KS   R S   W+  Y   +   IP+ + KE+ + +  +KR LGPG Y +++ M+ +++   +T+   +++  RF    +   PGP TYG   IP  ++++ +  RK  ++V +LD G +  R       H+ PG Y +ES  +++ +H   +RG YD    +R++PI  G+ A+ +  NLGPG+Y+   F +E    H + H   GKFL+  ++P+ P +R++       P D  ++  P SY    S   +GK +A     FGSS  RM++ A   F+G  N  +GPGRY+ D     +  +    AF S   +   I D   ++ +R++ VRP
Sbjct:    7 SGAPFGVQTSRFDVSSIHPKSKTPGTFTQVPYDKKCMTEVNRRLGPGSYNIEAGGFNKKSVLERASGPGWERAYETSRLAKIPHLLYKEQWEKKQYQKRMLGPGTYNIKDFMELMAEKPRSTRGECETRAARFESSTQSGVPGPGTYGKGGIPNAVLEEKE--RKSVSNVGMLDSGKSYRRQLPEVGSHLCPGQYEMESFTDEMASHVVSKRGPYDLFTGERNKPITVGYFAMPLRQNLGPGEYDLKSFLSENTGEHKQRH---GKFLKVTRFPDYPTERIYCCSLSQCPRD-PSEPGPGSY----SAKDLGKPEAAKRPPFGSSAGRMDRHARRFFLGSTNP-VGPGRYSVDRYENAQHIDGHTGAFNSKTRRYDLIRDKYMMERIRAKDVRP 389          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. TrEMBL
Match: A0A210Q094 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09195 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.315e-34
Identity = 118/376 (31.38%), Postives = 184/376 (48.94%), Query Frame = 1
Query:  124 FTCYGIHPKLQSTNSF----YSKS----VPPNVGPGSYNVKH---QEKSSKNRFSSEMWKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATK-ILQSKGRRFSDDIKDCYPGPSTYG---IPQDIIDQADIRRKYANSVPLLDRGGNSNR-LPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYNFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYKIGKSKAGFGSSDIRMNKFALANFMGENNTLIGPGRYNCDSKGIGESGNSFESAFKSLVSKISDPKTIDVLRSRVRPINL 1203
            F   G+HPK +   +F    Y K     +   +GPGSY V +     KS + R S   W   Y +E+   +P+ + K++ + +    R+LGPG Y++++ ++   +   + + I Q+   RF D   D  PGP TYG   +P   I Q +  +K A+++ +LD G ++ R LPT  S  +GPG YN +S   + +N  T  RG YD  + DR++PI  GH A     NLGPGQY+  + +D         +GKF + KQ P K  +R+F       P +  +   P SY   +      K+  GF S+  R +K +   F   N   +GPGRY+       +  N  +S FKS   K+ +      L+ RVRP ++
Sbjct:   27 FDVSGVHPKSKYPGTFTEIPYDKKSIDVLNRRLGPGSYKVDNGGFSSKSVEERASGPGWSRAYEVERMAALPHLLHKDQWELKKMLARKLGPGSYDIKDFLQNGDEKPRSYRGICQTLSYRFKDQSVDNTPGPGTYGDGGVPHAAIIQKE--KKSASTIGMLDAGSSTPRNLPTVGS-ELGPGTYNFKSFAEERVNKVTSLRGPYDLFSGDRNKPITVGHLAAPKLANLGPGQYDLQSFVDDLKTVHRKRQGKFGKVKQPPTKATERIFCHTLQQCPKE-ESFPGPGSYEPVELSKPGSKNAPGFLSTAQRNDKMS-QRFFTRNFNPVGPGRYDIQKWEEAQHRNGNDSVFKSRTGKL-NAAMEKFLKERVRPKDV 396          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. TrEMBL
Match: N1PB98 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226751 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.517e-32
Identity = 108/363 (29.75%), Postives = 177/363 (48.76%), Query Frame = 1
Query:  103 FGSSVPKFTCYGIHPKLQSTNSF----YSK----SVPPNVGPGSYNVK---HQEKSSKNRFSSEMWKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHAT-KILQSKGRRFSDDIKDC--YPGPSTYG---IPQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYNFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYN--LSQSLYKIGKSKAGFGSSDIRMNKFALANFMGENNTLIGPGRYNCDSKGIGESGNSFESAFKS 1134
            FG    +F   GIHPK ++  +F    Y K    S+   +GPG Y++      +KS + R     W   Y +++   +P+ + K++ + +   K++LGPG Y +++ +++  +   +T  I+ +K  RF + +      PGP TYG   +P   +++    +K A+++ LL   G    LPT  S  +GPG Y  +S   ++    T  RG YD  + DR++PIKTGH A + + NLGPGQY   + +D +  +     G+F + +QYPEK   R++       P +   +  P  Y   ++  +    K   GF SS  R +K +   F G  N  +GPGRY        +  N   S FKS
Sbjct:   11 FGVQTARFDVSGIHPKNKTPGTFTQTPYCKKSNTSLSCQLGPGRYDIGLGGFSDKSVEERAGGPGWARAYEVQRLAALPHLLHKQQWELKRLLKKKLGPGSYNIKDFLEQSGEKPRSTLGIIHTKEERFKEKLTQAQETPGPGTYGEGGVPHAAVEEKA--KKSASTIGLLGASGAERSLPTVGS-GLGPGTYQFKSFTEKIDEKVTSLRGPYDLFSGDRNKPIKTGHLASVTNSNLGPGQYKIKSFVDDWSTEHKQRTGRFFKMEQYPEKAIDRIYSFSLPQNPRN-REEPGPGQYEPKMADQVISHAKKSPGFLSSSQRSDKLSTKFFTGNQNP-VGPGRYVIQKLEDAQHRNGHTSVFKS 368          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. TrEMBL
Match: A0A1S3JSZ9 (lymphocyte expansion molecule OS=Lingula unguis OX=7574 GN=LOC106175621 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 2.807e-32
Identity = 114/386 (29.53%), Postives = 184/386 (47.67%), Query Frame = 1
Query:   97 SAFGSSVPKFTCYGIHPKLQSTNSFYS--------KSVPPNVGPGSYNVK---HQEKSSKNRFSSEMWKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHAT-KILQSKGRRFSDDIKDCYPGPSTYGI---PQDIIDQADIRRKYANSVPLLDRGGNSNR-LPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYNFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYKIGKSKAGFGSSDIRMNKFALANFMGENNTLIGPGRYNCDSKGIGESGNSFESAFKSLVSKISDPKTIDVLRSRVRPINLP 1206
            + FG+   +F    +HPK +   +F          +S+    GPG Y V+      KS + R S   W  QY +++   +P+ + KE+ + +   KR+L PG Y +++ ++   +   +   I  +K  RF + + +  PGP TYGI   P   ++Q ++     ++V +LD   +  R LP   S  +GPG YN ES   Q+    T  RG YD  +  R++PI TGH A+   H LGPGQY+  + +D +        GK  + +Q+P+KP +R+  +     P ++     P +YN  +       +  GF SS  R ++ A   F   N   +G GRY+       +  N  ES FKS   KIS  K    L+ R+R  ++P
Sbjct:    9 APFGTQTARFDVSAVHPKNKMPGTFTQTPYCRVSMESLNRTRGPGKYAVEVGGFSPKSVEERASGPGWARQYEVQRMAAMPHLLHKEQWELKRLLKRKLAPGTYNIKDFLETSDERPRSIYGICATKEPRFRNTVTNATPGPGTYGIGGVPHAALEQKEM--ASTSTVGMLDAVSSMPRSLPLVGS-DLGPGSYNFESFTKQLERKVTSLRGPYDLFSGQRNKPITTGHLAVPTWHTLGPGQYDLKSFVDDWGTIHKKKHGKMGKVQQHPDKPSERILVSTLSQCPKEM-GAPGPGAYNAKEISKPQAHNSPGFLSSARRDDRMA-QKFFTRNFNPVGAGRYDVQKWEEAQHVNGHESVFKSKSGKISL-KREQFLKERLRAKDVP 388          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Cavefish
Match: ENSAMXT00000013749.2 (lymphocyte expansion molecule [Source:NCBI gene;Acc:103032211])

HSP 1 Score: 88.5817 bits (218), Expect = 9.815e-19
Identity = 101/387 (26.10%), Postives = 170/387 (43.93%), Query Frame = 1
Query:   97 SAFGSSVPKFTCYGIHPKLQSTNSFYSKS--------VPPNVGPGSYNVKHQEKSSKNRFSSEM---WKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATK-ILQSKGRRFSDDIKDCYPGPSTYGIPQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIES-PINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYN-FGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQ---SLYKIGKSKAGFGSSDIRMNKFALANFMGENNTLIGPGRYNCDSKGIGESGNSFESAFKSLVSKISD-PKTIDVLRSRVRPINL 1203
            + FGS   +F   G+HP  +   ++   S        +  N+GPG+YN    + S++      M   WK      +   IP+ + ++    +   K ++GPG Y++    ++L K   + + I +++  RF  D ++   GP  Y I   I    D+ +K  +   + +      R     S   GPG Y     P   +   +   RG    N++D S  +K     I+   NLGPG+Y  FG E+ R   K H   G F   +QYP  P +R++ +     P  +T    P  Y++S    S     ++ A F SS  R +K ++   + +N+ ++GPGRY    K    +G+S  SAF S   +  + P      + R+RP N+
Sbjct:   11 APFGSQSHRFDVSGVHPANKRVGTYTQISCCKRRTSDLERNLGPGTYNPDSGDFSARAVRERSMGPDWKRAQETARLAQIPHLLYRDAWANKQFLKTKVGPGTYKIPSFTEELKKKPSSLRGICETREERF-KDCQNTSVGPGIYKITSFI---EDLEKKPGSPKGICE--TREQRFKDFQSCTPGPGAYGKGGIPSASLEEKERRNRG----NSIDSSARLKRFPENIVKRTNLGPGEYTKFGEELQRPEKKKH---GVFSSLEQYPSVPTERIYLSTLPQCPRPMTFP-GPGWYDVSPVTPSRQSRSETPAPFLSSASRFSK-SMETLLNKNHNMVGPGRYEIADKNWNSTGHS--SAFISDTQRYPNCPARDKYNQERLRPQNV 380          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007365.1 (pep scaffold:Pmarinus_7.0:GL476565:113022:120666:1 gene:ENSPMAG00000006647.1 transcript:ENSPMAT00000007365.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 3.520e-14
Identity = 84/349 (24.07%), Postives = 149/349 (42.69%), Query Frame = 1
Query:  103 FGSSVPKFTCYGIHPKLQSTNSF----YSKSVPPN----VGPGSYNVKHQE----KSSKNRFSSEMWKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATK--ILQSKGRRFSDDIKDCYPGPSTYGIPQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYNF--GNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVF------WTDPGNTPVDITNQVSPASYNLSQSLYKI-GKSKAGFGSSDIRMNKFALANFMG-ENNTLIGPGRYN 1077
            FGS+  +F   GIHP+L+   ++    Y      N    +GPG YN +       ++   R S   W  +  L +    P+F  +E  + E  +K +LGPG Y+ ++ +  L ++  +++  +  +   RF +  K   PGP +Y  P+     A      A+  P+ +   + NR        +GPG +   S  +++       RG YD     R+ P++TG   ++   +L PG       +  +    +  C  G        P++P +R+       W+ PG           P +Y+++    ++   S+  F SS  R N  +   FMG ++   +GPGRYN
Sbjct:   13 FGSATARFNVSGIHPQLKPLGTYTEAPYCSQTMSNQIRALGPGRYNPECSGGFGVRAVSRRASGPGWAREVELSRSARTPHFRHREAWEKERTQKSRLGPGIYDTKDFID-LERERPSSRRGVCDTLEERFLNIGKSSTPGPGSYVRPER--PGAAWAHHPASRGPM-ELSSSVNRSTPETGSGLGPGTHEHRSFTDELAARVVSARGPYDLFTGRRTDPLRTGW--LVAPESLWPGPRGCPQPSMAEALAARTRCRIGTV----GPPKEPAERLMEQWVKAWSWPG-----------PGTYDMNLEAREVRSASRPPFLSSSARFNSRSDRLFMGSQDQNPVGPGRYN 340          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007366.1 (pep scaffold:Pmarinus_7.0:GL476565:114349:120666:1 gene:ENSPMAG00000006647.1 transcript:ENSPMAT00000007366.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 2.362e-12
Identity = 81/343 (23.62%), Postives = 145/343 (42.27%), Query Frame = 1
Query:  121 KFTCYGIHPKLQSTNSF----YSKSVPPN----VGPGSYNVKHQE----KSSKNRFSSEMWKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATK--ILQSKGRRFSDDIKDCYPGPSTYGIPQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYNF--GNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVF------WTDPGNTPVDITNQVSPASYNLSQSLYKI-GKSKAGFGSSDIRMNKFALANFMG-ENNTLIGPGRYN 1077
            +F   GIHP+L+   ++    Y      N    +GPG YN +       ++   R S   W  +  L +    P+F  +E  + E  +K +LGPG Y+ ++ +  L ++  +++  +  +   RF +  K   PGP +Y  P+     A      A+  P+ +   + NR        +GPG +   S  +++       RG YD     R+ P++TG   ++   +L PG       +  +    +  C  G        P++P +R+       W+ PG           P +Y+++    ++   S+  F SS  R N  +   FMG ++   +GPGRYN
Sbjct:   29 RFNVSGIHPQLKPLGTYTEAPYCSQTMSNQIRALGPGRYNPECSGGFGVRAVSRRASGPGWAREVELSRSARTPHFRHREAWEKERTQKSRLGPGIYDTKDFID-LERERPSSRRGVCDTLEERFLNIGKSSTPGPGSYVRPER--PGAAWAHHPASRGPM-ELSSSVNRSTPETGSGLGPGTHEHRSFTDELAARVVSARGPYDLFTGRRTDPLRTGW--LVAPESLWPGPRGCPQPSMAEALAARTRCRIGTV----GPPKEPAERLMEQWVKAWSWPG-----------PGTYDMNLEAREVRSASRPPFLSSSARFNSRSDRLFMGSQDQNPVGPGRYN 350          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Nematostella
Match: EDO34936 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMX3])

HSP 1 Score: 154.836 bits (390), Expect = 1.173e-42
Identity = 121/394 (30.71%), Postives = 201/394 (51.02%), Query Frame = 1
Query:   91 SKSAFGSSVPKFTCYGIHPKLQSTNSF----YSK----SVPPNVGPGSYNVKH---QEKSSKNRFSSEMWKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATK-ILQSKGRRFSDDIKDCYPGPSTYG---IPQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYN---FGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYKIGKSKAG----FGSSDIRMNKFALANFMGENNTLIGPGRYNCDSKGIGESGNSFESAFKSLVSK---ISDPKTIDVLRSR-VRP 1194
            S + FG    +F    IHPK ++  +F    Y K     V   +GPGSYN++     +KS   R S   W+  Y   +   IP+ + KE+ + +  +KR LGPG Y +++ M+ +++   +T+   +++  RF    +   PGP TYG   IP  ++++ +  RK  ++V +LD G +  R       H+ PG Y +ES  +++ +H   +RG YD    +R++PI  G+ A+ +  NLGPG+Y+   F +E    H + H   GKFL+  ++P+ P +R++       P D  ++  P SY    S   +GK +A     FGSS  RM++ A   F+G  N  +GPGRY+ D     +  +    AF S   +   I D   ++ +R++ VRP
Sbjct:    7 SGAPFGVQTSRFDVSSIHPKSKTPGTFTQVPYDKKCMTEVNRRLGPGSYNIEAGGFNKKSVLERASGPGWERAYETSRLAKIPHLLYKEQWEKKQYQKRMLGPGTYNIKDFMELMAEKPRSTRGECETRAARFESSTQSGVPGPGTYGKGGIPNAVLEEKE--RKSVSNVGMLDSGKSYRRQLPEVGSHLCPGQYEMESFTDEMASHVVSKRGPYDLFTGERNKPITVGYFAMPLRQNLGPGEYDLKSFLSENTGEHKQRH---GKFLKVTRFPDYPTERIYCCSLSQCPRD-PSEPGPGSY----SAKDLGKPEAAKRPPFGSSAGRMDRHARRFFLGSTNP-VGPGRYSVDRYENAQHIDGHTGAFNSKTRRYDLIRDKYMMERIRAKDVRP 389          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Planmine SMEST
Match: SMESG000051172.1 (SMESG000051172.1)

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 399/405 (98.52%), Postives = 400/405 (98.77%), Query Frame = 1
Query:   88 MSKSAFGSSVPKFTCYGIHPKLQSTNSFYSKSVPPNVGPGSYNVKHQEKSSKNRFSSEMWKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATKILQSKGRRFSDDIKDCYPGPSTYGIPQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYNFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYKIGKSKAGFGSSDIRMNKFALANFMGENNTLIGPGRYNCDSKGIGESGNSFESAFKSLVSKISDPKTIDVLRSRVRPINLPEMKKKKETHLATENSLREYHNSYENLKSLVIS 1302
            MSKSAFGSSVPKFTCYGIHPKLQSTNSFYSKSVPPNVGPGSYNVKHQEKSSKNRFSSEMWKVQY LEKQKTIPYF+IKEKKQ EAEKKRQLGPGYYEVEESMKKLSKDNHAT ILQSK RRFSDDIKDCYPGPSTYGIPQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYNFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVD TNQVSPASYNLSQSLYKIGKSKAGFGSSDIRMNKFALANFMGENNTLIGPGRYNCDSKGIGESGNSFESAFKSLVSKISDPKTIDVLRSRVRPINLPEMKKKKETHLATENSLREYHNSYENLKSLVIS
Sbjct:    1 MSKSAFGSSVPKFTCYGIHPKLQSTNSFYSKSVPPNVGPGSYNVKHQEKSSKNRFSSEMWKVQYKLEKQKTIPYFLIKEKKQTEAEKKRQLGPGYYEVEESMKKLSKDNHATTILQSKARRFSDDIKDCYPGPSTYGIPQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYNFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDKTNQVSPASYNLSQSLYKIGKSKAGFGSSDIRMNKFALANFMGENNTLIGPGRYNCDSKGIGESGNSFESAFKSLVSKISDPKTIDVLRSRVRPINLPEMKKKKETHLATENSLREYHNSYENLKSLVIS 405          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Planmine SMEST
Match: SMESG000035257.1 (SMESG000035257.1)

HSP 1 Score: 279.641 bits (714), Expect = 1.053e-89
Identity = 170/403 (42.18%), Postives = 227/403 (56.33%), Query Frame = 1
Query:   82 FIMSKSAFGSSVPKFTCYGIHPKLQSTNSFYSKSVPPNVGPGSYNVKH-----QEKSSKNRFSSEMWKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATKILQSKGRRFSDDIKDCYPGPSTYG---IPQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYNFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYKIGKSKAG----FGSSDIRMNKFALANFMGENNTLIGPGRYNCDSKGIGESGNSFESAFKSLVSKISDPKTIDVLRSRVRPINLPEMKKKKETHLATENSL 1254
            FI  +   GS+VP+F  YGIHP           SV   +GPG Y++ +     ++K  K+ F S+ W+    LE+Q  IP+FM K   + + E+KR++GPG YE + S+   S D   T  L+SK RRF +  KD +PGP TYG   IP     +AD RRK+ N+V LL RGG S R       +IGPGIY ++S I++ L H TG R +YDCN+ ++  P+K GH AIL  H++GPGQY     I   +D+FH FKGKFL+E QYP KPH+RVF+ DP NTP D  NQVS  SY      Y+   S  G    F  S +RM+K AL NF G      GPGRYN D        ++  ++F +   + S    + V+R R R  NL   K+ K  HLAT  S+
Sbjct:    4 FIDRRGFNGSTVPRFIQYGIHPNAMEKGKMGITSVDGELGPGKYDLSYTSCFDEKKLDKSSFKSD-WRRALFLEQQGKIPHFMSKYLYKEKEEQKRRMGPGKYEYK-SIFDYSNDKKYTTSLKSKSRRFVEAKKDSFPGPGTYGKFGIPDQKKYEADQRRKHCNTVGLLKRGGKSGRNFFNNINNIGPGIYQVKSVIDESLKHHTGLRNFYDCNSDEKLLPLKFGHRAILKPHDIGPGQYQHKEFITELNDRFHIFKGKFLQELQYPPKPHERVFYIDPANTPPDPRNQVSTHSYYPRNPNYRKCVSFGGKTYPFNFSSLRMDKIALENFTGNRTPFTGPGRYNIDKADASRHISAATASFNAKTPQTSSEFQLKVIRERNRGRNLIRNKEDKLDHLATTKSV 404          
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Planmine SMEST
Match: SMESG000008990.1 (SMESG000008990.1)

HSP 1 Score: 215.698 bits (548), Expect = 4.904e-65
Identity = 138/399 (34.59%), Postives = 215/399 (53.88%), Query Frame = 1
Query:   88 MSKSAFGSSVPKFTCYGIHPKLQSTNSF--YSKSVPPNVGPGSYNVKHQEKS-SKNRFSSEM----WKVQYNLEKQKTIPYFMIXXXXXXXXXXXRQLGPGYYEVEESMKKLSKDNHATKILQSKGRRFSDDIKDCYPGPSTYG---IPQDIIDQADIRRKYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGYYDCNNLDRSQPIKTGHHAILVSHNLGPGQYNFGNEIDRFHDKFHCFKGKFLREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYKIGKSKA-GFGSSDIRMNKFALANFMGENNTLIGPGRYNCDSKGIGESGNSFESAFKSLVSKISDPKTIDVLRSRVRPINLPEMKKKKETHLATENS 1251
             S + FG    +F   G+HPK +   +      S   N+GPG Y  + +  S S+++   +     WK  Y  E+  ++PY + K+   A+ E+KR+LGPGYY V+ S   L+K+     ++  +  RF ++ K+  PGP  YG   IP  + ++ D +RK A+++ +L  GGN  R        + P  YN+ S IN+V+NHQ+G+RG YD  +L+R++PIKTGH A+L +H L PG Y+  + +D  +   +   GKFL+  QYP+KPH R +W +P   P DI NQ++P SY++      I    A  F SS  R +K +   F  +N   +GPGRY+       +  NS E+ FKS        +   +L  R++P N+P  K+    H+ TE+S
Sbjct:    6 FSGAPFGYQSHRFDLAGVHPKRKMPGTLIGMQTSSNNNIGPGYYITEDRSSSFSQSKLDLDAKKPGWKRSYATEQFSSMPYILNKDLYLAKQEQKRKLGPGYYSVDYSTLNLNKN--VKGVMSEREPRFMEEYKEITPGPGIYGKCGIPHLLKEEGDNQRKSASTIGMLHNGGNGERTLPATGCRLAPNTYNLPSFINEVINHQSGKRGPYDIFSLNRTKPIKTGHLAVLPAHELAPGHYDSKSSVDILNSSNYKHHGKFLKMDQYPDKPHDRAYWNNPACVPPDINNQLAPGSYDVKFPQNIISHDSAPPFNSSSNRHDKLSNM-FFYQNFNQVGPGRYDLQRLQDSKYVNSHENIFKSKTGAQLTKEKFSMLSERLKPKNIPINKRHFIDHIPTESS 401          
The following BLAST results are available for this feature:
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
LEXM2.261e-1524.40lymphocyte expansion molecule [Source:HGNC Symbol;... [more]
LEXM3.113e-1524.40lymphocyte expansion molecule [Source:HGNC Symbol;... [more]
back to top
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000045218.15.284e-3229.12lymphocyte expansion molecule [Source:NCBI gene;Ac... [more]
back to top
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Lexm5.036e-1826.22lymphocyte expansion molecule [Source:MGI Symbol;A... [more]
Lexm5.036e-1826.22lymphocyte expansion molecule [Source:MGI Symbol;A... [more]
Lexm5.036e-1826.22lymphocyte expansion molecule [Source:MGI Symbol;A... [more]
back to top
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|B1H283|LEXM_RAT2.573e-1726.96Lymphocyte expansion molecule OS=Rattus norvegicus... [more]
sp|A2AVQ5|LEXM_MOUSE3.522e-1726.22Lymphocyte expansion molecule OS=Mus musculus OX=1... [more]
sp|Q3ZCV2|LEXM_HUMAN1.495e-1424.40Lymphocyte expansion molecule OS=Homo sapiens OX=9... [more]
back to top
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HJX03.064e-5334.40Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A7SMX38.479e-3930.71Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A210Q0941.315e-3431.38Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
N1PB981.517e-3229.75Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1S3JSZ92.807e-3229.53lymphocyte expansion molecule OS=Lingula unguis OX... [more]
back to top
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000013749.29.815e-1926.10lymphocyte expansion molecule [Source:NCBI gene;Ac... [more]
back to top
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007365.13.520e-1424.07pep scaffold:Pmarinus_7.0:GL476565:113022:120666:1... [more]
ENSPMAT00000007366.12.362e-1223.62pep scaffold:Pmarinus_7.0:GL476565:114349:120666:1... [more]
back to top
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO349361.173e-4230.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of A disintegrin and metalloproteinase with thrombospondin motifs 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000051172.10.000e+098.52SMESG000051172.1[more]
SMESG000035257.11.053e-8942.18SMESG000035257.1[more]
SMESG000008990.14.904e-6534.59SMESG000008990.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031005 ID=SMED30031005|Name=A disintegrin and metalloproteinase with thrombospondin motifs 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1366bp
AATTGTTTAAAATATTGGTTTCCAAGCAACGTTCAATAAAATTAAATTTC
AGAAAATAAAAATTTTAACTTCATATTATATTTTATCATGTCTAAATCAG
CATTTGGATCATCCGTTCCTAAATTTACATGCTACGGAATTCATCCAAAA
CTTCAGTCAACCAATAGTTTTTATTCAAAATCAGTTCCACCAAATGTTGG
ACCCGGATCTTATAATGTAAAACATCAAGAAAAATCGTCTAAAAATCGAT
TTAGTTCAGAAATGTGGAAAGTGCAATATAATCTAGAAAAACAAAAAACA
ATTCCTTACTTTATGATAAAAGAAAAAAAACAAGCAGAGGCTGAAAAGAA
AAGACAATTGGGACCGGGATATTATGAGGTAGAAGAATCTATGAAAAAGC
TCTCAAAAGATAATCACGCAACGAAAATATTACAATCAAAAGGACGAAGA
TTTTCTGATGACATAAAAGATTGCTATCCAGGTCCTTCAACCTATGGCAT
TCCACAAGACATTATAGATCAAGCGGATATTCGAAGAAAATATGCAAACT
CGGTTCCTCTCTTAGATCGTGGTGGAAATTCAAATCGTTTACCAACACCT
CCATCCTTCCATATTGGTCCTGGAATTTACAATATTGAATCTCCAATTAA
TCAAGTTTTAAATCATCAAACTGGTCAACGAGGCTATTATGACTGTAATA
ACTTAGATAGATCCCAACCTATTAAAACCGGACACCATGCAATCTTAGTT
TCACATAACCTGGGACCGGGTCAATACAATTTTGGAAATGAAATCGATAG
ATTTCATGATAAATTTCATTGTTTTAAAGGAAAGTTTCTGAGAGAAAAAC
AATATCCGGAGAAGCCACATCAAAGAGTATTTTGGACGGATCCCGGAAAT
ACACCAGTTGATATAACTAATCAAGTTAGTCCGGCTTCGTACAACTTGAG
TCAATCACTTTACAAAATTGGAAAGTCAAAAGCCGGATTTGGGTCATCAG
ATATCAGAATGAATAAATTTGCCCTTGCTAACTTCATGGGAGAAAATAAC
ACTCTGATAGGACCTGGACGATATAATTGTGATTCTAAAGGAATCGGGGA
ATCGGGAAATTCCTTTGAATCCGCCTTTAAATCTCTGGTTTCGAAAATAT
CTGATCCAAAAACTATTGATGTTCTAAGGTCTCGAGTCCGACCAATAAAT
CTTCCAGAGATGAAAAAGAAGAAAGAAACTCACTTGGCAACGGAGAATTC
ACTTAGAGAATATCACAACAGTTATGAAAATCTTAAAAGCTTGGTGATTT
CCTGAAGATGAAGATCTGTGAAATGATTTATTTATGACTTATATTTAATT
ATTTTTGAATAAAAAC
back to top

protein sequence of SMED30031005-orf-1

>SMED30031005-orf-1 ID=SMED30031005-orf-1|Name=SMED30031005-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=406bp
MSKSAFGSSVPKFTCYGIHPKLQSTNSFYSKSVPPNVGPGSYNVKHQEKS
SKNRFSSEMWKVQYNLEKQKTIPYFMIKEKKQAEAEKKRQLGPGYYEVEE
SMKKLSKDNHATKILQSKGRRFSDDIKDCYPGPSTYGIPQDIIDQADIRR
KYANSVPLLDRGGNSNRLPTPPSFHIGPGIYNIESPINQVLNHQTGQRGY
YDCNNLDRSQPIKTGHHAILVSHNLGPGQYNFGNEIDRFHDKFHCFKGKF
LREKQYPEKPHQRVFWTDPGNTPVDITNQVSPASYNLSQSLYKIGKSKAG
FGSSDIRMNKFALANFMGENNTLIGPGRYNCDSKGIGESGNSFESAFKSL
VSKISDPKTIDVLRSRVRPINLPEMKKKKETHLATENSLREYHNSYENLK
SLVIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007229integrin-mediated signaling pathway
GO:0008284positive regulation of cell proliferation
GO:0035740CD8-positive, alpha-beta T cell proliferation
GO:1903862positive regulation of oxidative phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR033557LEXM
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR033557Lymphocyte expansion moleculePANTHERPTHR34914FAMILY NOT NAMEDcoord: 4..375