hypothetical protein

Overview
Namehypothetical protein (AFJ24802.1)
Smed IDSMED30030996
Length (bp)700
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of hypothetical protein (SMED30030996) t-SNE clustered cells

Violin plots show distribution of expression levels for hypothetical protein (SMED30030996) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of hypothetical protein (SMED30030996) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for hypothetical protein (SMED30030996) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030996

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30030996SMESG000029612.1 SMESG000029602.1 SmedASXL_009684SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Category 3 cellSMED30030996SMESG000029612.1 SMESG000029602.1 SmedASXL_009684SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30030996SMESG000029612.1 SMESG000029602.1 SmedASXL_009684SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30030996SMESG000070393.1 SMESG000040193.1 SMESG000029612.1 SMESG000029602.1 SMESG000019334.1 Contig13195newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000070393.1 SMESG000040193.1 SMESG000029612.1 SMESG000029602.1 SMESG000019334.1 Contig13195uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000037212.1 SMESG000029612.1 SMESG000029602.1 SMESG000028539.1 Contig12392newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000037212.1 SMESG000029612.1 SMESG000029602.1 SMESG000028539.1 Contig12392uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000029602.1 SMESG000029612.1 Contig11353newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000029602.1 SMESG000029612.1 Contig11353uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000029612.1 SMESG000029602.1 Contig12391newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000029612.1 SMESG000029602.1 Contig12391uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000056221.1 SMESG000046858.1 SMESG000029613.1 SMESG000029612.1 SMESG000029602.1 SMESG000025472.1 SMESG000023703.1 SMESG000011090.1 Contig36311newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000056221.1 SMESG000046858.1 SMESG000029613.1 SMESG000029612.1 SMESG000029602.1 SMESG000025472.1 SMESG000023703.1 SMESG000011090.1 Contig36311uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000081747.1 SMESG000063286.1 SMESG000053779.1 SMESG000029612.1 SMESG000029602.1 SMESG000029600.1 SMESG000018997.1 SMESG000009617.1 SMESG000005074.1 Contig43035newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000081747.1 SMESG000063286.1 SMESG000053779.1 SMESG000029612.1 SMESG000029602.1 SMESG000029600.1 SMESG000018997.1 SMESG000009617.1 SMESG000005074.1 Contig43035uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000040193.1 SMESG000029612.1 SMESG000029602.1 Contig13216newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000040193.1 SMESG000029612.1 SMESG000029602.1 Contig13216uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000016663.1 Contig833GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030996SMESG000029612.1 SMESG000029602.1 Contig833GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30030996SMESG000029612.1 SMESG000029602.1 SMED30026394smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30030996SMESG000029612.1 SMESG000029602.1 SMED30026394smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of hypothetical protein vs. TrEMBL
Match: I1ZIE8 (Uncharacterized protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 1.584e-43
Identity = 180/180 (100.00%), Postives = 180/180 (100.00%), Query Frame = -2
Query:  112 QGKPIEKKWFVDDALHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNDKKWFVDDALHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNDKKWFVDDALHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNYKKSVISKAA 651
            QGKPIEKKWFVDDALHHAGGIVGGAANLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNDKKWFVDDALHLAGGIVGGAANLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNDKKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKSVISKAA
Sbjct:   20 QGKPIEKKWFVDDALHHAGGIVGGAANLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNDKKWFVDDALHLAGGIVGGAANLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNDKKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKSVISKAA 199          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000029602.1 (SMESG000029602.1)

HSP 1 Score: 101.293 bits (251), Expect = 5.132e-27
Identity = 133/140 (95.00%), Postives = 135/140 (96.43%), Query Frame = -2
Query:  280 MNXXXXXXXXXXXXXLQGKPIEKKWFVDDALHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNDKKWFVDDALHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNDKKWFVDDA 699
            MNVLSLFLVVLSVSVLQGKPIEKKWFVDDALHHAGGIVGGAANLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNDKKWFVDDALHLAGGIVGGAA+LAGGVVDGAANLAGAAIDVVAGGPERDRHRSRN KK  +  A
Sbjct:    1 MNVLSLFLVVLSVSVLQGKPIEKKWFVDDALHHAGGIVGGAANLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNDKKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKSVISKA 140          

HSP 2 Score: 95.5153 bits (236), Expect = 9.495e-25
Identity = 118/120 (98.33%), Postives = 119/120 (99.17%), Query Frame = -2
Query:  112 DKKWFVDDALHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNDKKWFVDDALHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNYKKSVISKAA 471
            +KKWFVDDALH AGGIVGGAANLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNDKKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKSVISKAA
Sbjct:   22 EKKWFVDDALHHAGGIVGGAANLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNDKKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKSVISKAA 141          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000029612.1 (SMESG000029612.1)

HSP 1 Score: 58.5362 bits (140), Expect = 5.645e-11
Identity = 64/65 (98.46%), Postives = 65/65 (100.00%), Query Frame = -2
Query:  112 DKKWFVDDALHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNYKKSVISKAA 306
            +KKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKSVISKAA
Sbjct:   62 EKKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKSVISKAA 126          

HSP 2 Score: 58.151 bits (139), Expect = 7.356e-11
Identity = 73/85 (85.88%), Postives = 76/85 (89.41%), Query Frame = -2
Query:  445 MNXXXXXXXXXXXXXLQGKPIEKKWFVDDALHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNDKKWFVDDA 699
            MNVL LFLV L VSV+QGKPIEKKWFVDDALH AGGIVGGAA+LAGGVVDGAANLAGAAIDVVAGGPERDRHRSRN KK  +  A
Sbjct:   41 MNVLCLFLVALCVSVIQGKPIEKKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKSVISKA 125          

HSP 3 Score: 46.9802 bits (110), Expect = 8.704e-7
Identity = 56/64 (87.50%), Postives = 59/64 (92.19%), Query Frame = -2
Query:  280 DKKWFVDDALHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNDKKWFVDDA 471
            +KKWFVDDALHLAGGIVGGAA+LAGGVVDGAANLAGAAIDVVAGGPERDRHRSRN KK  +  A
Sbjct:   62 EKKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKSVISKA 125          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000029612.1 (SMESG000029612.1)

HSP 1 Score: 58.5362 bits (140), Expect = 7.484e-11
Identity = 64/65 (98.46%), Postives = 65/65 (100.00%), Query Frame = -2
Query:  112 DKKWFVDDALHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNYKKSVISKAA 306
            +KKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKSVISKAA
Sbjct:   72 EKKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKSVISKAA 136          

HSP 2 Score: 57.7658 bits (138), Expect = 1.348e-10
Identity = 73/85 (85.88%), Postives = 76/85 (89.41%), Query Frame = -2
Query:  445 MNXXXXXXXXXXXXXLQGKPIEKKWFVDDALHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNDKKWFVDDA 699
            MNVL LFLV L VSV+QGKPIEKKWFVDDALH AGGIVGGAA+LAGGVVDGAANLAGAAIDVVAGGPERDRHRSRN KK  +  A
Sbjct:   51 MNVLCLFLVALCVSVIQGKPIEKKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKSVISKA 135          

HSP 3 Score: 46.9802 bits (110), Expect = 1.276e-6
Identity = 56/64 (87.50%), Postives = 59/64 (92.19%), Query Frame = -2
Query:  280 DKKWFVDDALHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNDKKWFVDDA 471
            +KKWFVDDALHLAGGIVGGAA+LAGGVVDGAANLAGAAIDVVAGGPERDRHRSRN KK  +  A
Sbjct:   72 EKKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKSVISKA 135          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000029612.1 (SMESG000029612.1)

HSP 1 Score: 53.9138 bits (128), Expect = 1.275e-8
Identity = 72/79 (91.14%), Postives = 74/79 (93.67%), Query Frame = -2
Query:  463 MNXXXXXXXXXXXXXLQGKPIEKKWFVDDALHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNDKK 699
            MNVL LFLV L VSV+QGKPIEKKWFVDDALH AGGIVGGAA+LAGGVVDGAANLAGAAIDVVAGGPERDRHRSRN KK
Sbjct:   41 MNVLCLFLVALCVSVIQGKPIEKKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKK 119          

HSP 2 Score: 46.595 bits (109), Expect = 3.843e-6
Identity = 58/59 (98.31%), Postives = 59/59 (100.00%), Query Frame = -2
Query:  130 DKKWFVDDALHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGPERDRHRSRNYKKS 306
            +KKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKS
Sbjct:   62 EKKWFVDDALHLAGGIVGGAADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKS 120          
The following BLAST results are available for this feature:
BLAST of hypothetical protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
I1ZIE81.584e-43100.00Uncharacterized protein (Fragment) OS=Schmidtea me... [more]
back to top
BLAST of hypothetical protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000029602.15.132e-2795.00SMESG000029602.1[more]
SMESG000029612.15.645e-1198.46SMESG000029612.1[more]
SMESG000029612.17.484e-1198.46SMESG000029612.1[more]
SMESG000029612.11.275e-891.14SMESG000029612.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30030996
GenBankAFJ24802.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030996 ID=SMED30030996|Name=hypothetical protein|organism=Schmidtea mediterranea sexual|type=transcript|length=700bp
TCGCATTTTTTTTTTTTTTTTTTAAAGTTGTAAAATATTTATTTTATAAA
AAAGTATTCATGATTGATTCATTCGAGTTTAGGAAATGTTTGTATTTTTA
CCTTGATATTATGCAGCTTTGCTTATTACTGATTTCTTGTAATTTCGTGA
TCTGTGACGATCTCTTTCTGGACCACCTGCTACTACATCTATAGCTGCAC
CAGCAAGATTTGCAGCTCCATCAACGACTCCACCTGCAAGATCTGCAGCT
CCACCAACGATTCCACCTGCAAGGTGTAAGGCATCATCTACAAACCATTT
CTTGTCATTTCGTGATCTATGACGATCTCTTTCTGGACCACCTGCTACTA
CATCAATAGCTGCACCAGCAAGATTCGCAGCTCCATCAACGACTCCTCCT
GCAAGGTTGGCAGCTCCACCAACGATTCCACCTGCAAGGTGTAAGGCATC
ATCTACAAACCATTTCTTGTCATTTCGTGATCTATGACGATCTCTTTCTG
GACCACCTGCTACTACATCAATAGCTGCACCAGCAAGATTCGCAGCTCCA
TCAACGACTCCTCCTGCAAGGTTGGCAGCTCCACCAACGATTCCACCTGC
ATGGTGTAACGCATCATCTACAAACCATTTCTTCTCTATGGGCTTTCCTT
GGAGGACCGAAACACTAAGTACAACGAGGAATAAACTTAAAACATTCATG
back to top

protein sequence of SMED30030996-orf-1

>SMED30030996-orf-1 ID=SMED30030996-orf-1|Name=SMED30030996-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=197bp
MNVLSLFLVVLSVSVLQGKPIEKKWFVDDALHHAGGIVGGAANLAGGVVD
GAANLAGAAIDVVAGGPERDRHRSRNDKKWFVDDALHLAGGIVGGAANLA
GGVVDGAANLAGAAIDVVAGGPERDRHRSRNDKKWFVDDALHLAGGIVGG
AADLAGGVVDGAANLAGAAIDVVAGGPERDRHRSRNYKKSVISKAA*
back to top
Aliases
The feature 'hypothetical protein' has the following synonyms
Synonym
pmp-11
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0000421tail
PLANA:0002142parenchyma
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 21..43