MFS domain-containing protein

Overview
NameMFS domain-containing protein
Smed IDSMED30030984
Length (bp)1401
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MFS domain-containing protein (SMED30030984) t-SNE clustered cells

Violin plots show distribution of expression levels for MFS domain-containing protein (SMED30030984) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MFS domain-containing protein (SMED30030984) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MFS domain-containing protein (SMED30030984) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030984

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30030984SMESG000069674.1 PL05001A1F08ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030984SMESG000069674.1 PL030001A20E03ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30030984SMESG000069674.1 dd_Smed_v4_4285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030984SMESG000069674.1 dd_Smed_v4_4285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693414:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 50.447 bits (119), Expect = 1.683e-6
Identity = 60/230 (26.09%), Postives = 106/230 (46.09%), Query Frame = 3
Query:  555 QDVIQNYEVKNNVESTFMYMTIFCTVMLFVGVILLGFXXXXXXXXSHSIYNSVKYDIFNSYRRVTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSSNFNQYKIDKFTLSVVFTIS---NSIGRIFWGFLVDIKPFKCXXXXXXXXXXXXXXXXPFV---TSALKIYIIIVLWYSVIGFQLGGFFAIFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMN 1226
            Q      ++   V   F+ M+IF TV   +G+I +G  +     E+ ++  +      NS  RV +     Q+     F +L+L +T  +    +    Y +   Q+    F LS++ +IS   N+  R+FWG + D   ++  M I+  + ++   S+P V   ++ +     + L +S IG    G F+IFP I    F   +F++ YG L  A S+ G I  L+S +
Sbjct:  183 QGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPEGDIHVETENLIGT------NSEIRVEQARVWPQL-RTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSIVCSLGAVLAFSMPLVKMVSNDVLFLATVCLMFSCIG----GTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTH 401          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693542:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 50.447 bits (119), Expect = 1.683e-6
Identity = 60/230 (26.09%), Postives = 106/230 (46.09%), Query Frame = 3
Query:  555 QDVIQNYEVKNNVESTFMYMTIFCTVMLFVGVILLGFXXXXXXXXSHSIYNSVKYDIFNSYRRVTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSSNFNQYKIDKFTLSVVFTIS---NSIGRIFWGFLVDIKPFKCXXXXXXXXXXXXXXXXPFV---TSALKIYIIIVLWYSVIGFQLGGFFAIFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMN 1226
            Q      ++   V   F+ M+IF TV   +G+I +G  +     E+ ++  +      NS  RV +     Q+     F +L+L +T  +    +    Y +   Q+    F LS++ +IS   N+  R+FWG + D   ++  M I+  + ++   S+P V   ++ +     + L +S IG    G F+IFP I    F   +F++ YG L  A S+ G I  L+S +
Sbjct:  183 QGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPEGDIHVETENLIGT------NSEIRVEQARVWPQL-RTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSIVCSLGAVLAFSMPLVKMVSNDVLFLATVCLMFSCIG----GTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTH 401          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693414:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 50.447 bits (119), Expect = 2.045e-6
Identity = 60/230 (26.09%), Postives = 106/230 (46.09%), Query Frame = 3
Query:  555 QDVIQNYEVKNNVESTFMYMTIFCTVMLFVGVILLGFXXXXXXXXSHSIYNSVKYDIFNSYRRVTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSSNFNQYKIDKFTLSVVFTIS---NSIGRIFWGFLVDIKPFKCXXXXXXXXXXXXXXXXPFV---TSALKIYIIIVLWYSVIGFQLGGFFAIFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMN 1226
            Q      ++   V   F+ M+IF TV   +G+I +G  +     E+ ++  +      NS  RV +     Q+     F +L+L +T  +    +    Y +   Q+    F LS++ +IS   N+  R+FWG + D   ++  M I+  + ++   S+P V   ++ +     + L +S IG    G F+IFP I    F   +F++ YG L  A S+ G I  L+S +
Sbjct:  197 QGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPEGDIHVETENLIGT------NSEIRVEQARVWPQL-RTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSIVCSLGAVLAFSMPLVKMVSNDVLFLATVCLMFSCIG----GTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTH 415          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1W7RA76 (Major Facilitator-like protein 5 OS=Hadrurus spadix OX=141984 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 5.130e-17
Identity = 111/395 (28.10%), Postives = 183/395 (46.33%), Query Frame = 3
Query:  120 GAFVVQLTLGGFYTAGSFQSKIAHFISNRTNTSFNDTMKTSTWIXXXXXXXXXXXXXXXXXXXXKIGTIWTVLFGGGLICLNTGLMITMVKQNLWLIIXXXXXXXXXXXXXXXXXXXXXXAKIFTEKKGLIFGITLSGYGLSAL-FQDVIQNYEVKNNVEST----------------FMYMTIFCTVMLFVGVILL---------GFXXXXXXXXSHSIYNSVKYDIFN-------SYRRVTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSSNFNQYKIDKFTLSVVFTIS---NSIGRIFWGFLVDIKPFK-CXXXXXXXXXXXXXXXXPFVTSALKIYIIIVLWYSVIGFQLGGFFAIFPTICANLFGTKHFTINYGMLYTANSL 1193
            G F++ LTLG FYT G+  + I  ++  + ++  +     S W+  A  LG GS M  GG ++ +IG  WT L G  +   +  L    +K+    +I TYG +  +G+GI Y   L    K FT +KGL+ GI + GYGL AL F  V  ++    NV  T                F+ +      +  +G+ILL          +   ++ E+     +  + D F        +   V    KP +++ + +F+MLW            + + Y +   Q+  D   L+ V +I+   N++GRI WG+L D   +K C++I+   + S+ L  +        +++I   W   I F   G F + PT+ A++FG KH   NYGML+TA ++
Sbjct:   15 GGFLIHLTLGTFYTFGNMNTYITSYLRKKVDSDVD--YSKSIWVNAAAMLGQGSLMMIGGILEQRIGARWTCLLGCSIFSGSIALTTFAIKRGFVAVIFTYGLISSLGLGIAYVAPLAAGMKWFTTRKGLVNGIIVGGYGLGALVFNQVQTSFLNPENVVPTNGYFDSEDILARLPDLFLLLGGTYFAVQLIGIILLYSPEDKWGESYSNLLRSEKVADETDQEETDQFTLKETPDLTLPAVDHSLKPIEVLRKKEFYMLWFSFAFNVQAMQFINTMYKAYGQQFIHDDHFLATVGSIASVFNALGRIAWGYLQDRTSYKMCMLILCAALTSLMLSLIATPNGGKPMFLI---WIVSIFFAFSGIFVLLPTVTAHIFGPKHAGTNYGMLFTAPAI 404          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A0H3YF10 (Slc16a-10 OS=Schmidtea mediterranea OX=79327 GN=slc16a-10 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 7.620e-17
Identity = 109/392 (27.81%), Postives = 204/392 (52.04%), Query Frame = 3
Query:  105 YIVLLGAFVVQLTLGGFYTAGSFQSKIAHFIS-NRTNTSFNDTMKTSTWIXXXXXXXXXXXXXXXXXXXXKIGTIWTVLFGGGLICLNTGLMITMVKQNLWLIIXXXXXXXXXXXXXXXXXXXXXXAKIFTEKKGLIFGITLSGYGLSALFQDVIQNYEVKNNV-ESTFMYMTIFCTVMLFVGVI--LLGFXXXXXXXXSHSIYNSVKYDIFNSYRRVTK-EFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSSNFNQY-KIDKFTLSVVFTISNSI----GRIFWGFLVDIKPFKCXXXXXXXXXXXXXXXXPFVTSALKI--------YIIIVLWYSVIGFQLGGFFAIFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMN 1226
            Y+ + G F+V ++LGG +T GS    I  +++ N+TN           WI G  + G G+SMS GGF++ ++G  +T++ GG ++     L    +  ++  + ++YG + G+G GI YGV +    + F +  GL+ GI LSG+G+ ++  D+I +Y + +++  ST +  +      + +G I  ++       I+   ++  SV  +  N +   TK E KPHQ+I   +FW++W I  A+++  +++       + +Y +I    L ++ T +  I    GRI WG+L D   +K ++    ++ +I   +    +   K+        + + ++W  ++ F + G F+IFP ICA +FG +HFT N+G+LYT  S    I  ++ + 
Sbjct:   13 YVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVG-WIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPGLLSGIILSGFGIGSVGFDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIW-ITYALNSAFSLLFILLQKMWGKYLEISDLRL-LIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLR 401          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A443SUB7 (Major Facilitator-like protein 5 OS=Leptotrombidium deliense OX=299467 GN=B4U80_02706 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.141e-16
Identity = 111/402 (27.61%), Postives = 184/402 (45.77%), Query Frame = 3
Query:  120 GAFVVQLTLGGFYTAGSFQSKIAHFISNRTNTSFNDTMKTSTWIXXXXXXXXXXXXXXXXXXXXKIGTIWTVLFGGGLICLNTGLMITMVKQNLWLIIXXXXXXXXXXXXXXXXXXXXXXAKIFTEKKGLIFGITLSGYGLSALFQDVIQ------------------NYEVKNNVESTFMYMTIFCTVMLFVGVILL----------------GFXXXXXXXXSHSIYNSVKYD---IFNSYRRVTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSSNFNQY-KIDKFTLSVVFTIS--NSIGRIFWGFLVDIKPFKCXXXXXXXXXXXXXXXXPFVTSALKIYIIIVLWYSVIGFQLGGFFAIFPTICANLFGTKHFTINYGMLYTANSLPGCI 1205
            G F+V +TLG FYT G+  + +  ++    ++  N    TS WI  A  LG G+ M  GG+++++IG  WTVL G  +   +  L    +K+  W ++++YGF+  +GVGI Y   L    K F  +KGL+ G+T+ G+GL AL  + +Q                  +  + + V S F+ +      +  +G +L+                    K      H  Y+S +        + R   ++    + +   +F  +WL+   V+     V + Y +   Q+ + D F   V  T S  N++GRI WG L+D   F+    ++  + S  +++L F+T      ++  +W S I F   G F IFPT  A +FG  H    YGML+TA +L   I
Sbjct:   16 GGFLVHITLGTFYTLGNVNTYLTSYLRKYVDSEAN--YATSIWINAAFMLGQGTLMILGGYLETRIGARWTVLIGSSIFSGSVALTYYTIKKGFWYVVVSYGFMASLGVGIAYVAPLAAGMKWFPRRKGLVNGLTVGGFGLGALIFNQVQTAYLNPMNSPPSSDGYFEDEAILSRVPSMFILLGGVYFAIQLIGSMLIFRPPTQPDEIIFSDGRLLLIKSPQTPEHEDYSSCEDSSTGTETAERLQRQDLTAMEALRTNEFAKMWLMFALVTQGVQFVNTMYKAYGQQFIRSDHFLAFVGSTASVFNALGRILWGQLLDATSFRKTFFLMCSLFSFLMITL-FITETTGSKLLYFIWISAIFFTFSGMFVIFPTATALVFGKSHAGTIYGMLFTAPALTSLI 414          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1S2LR32 (MFS transporter OS=Anaerobacillus alkalilacustris OX=393763 GN=BKP37_07810 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 8.052e-15
Identity = 108/398 (27.14%), Postives = 189/398 (47.49%), Query Frame = 3
Query:   99 QKYIVLLGAFVVQLTLGGFYTAGSF-QSKIAHFISNRTN--TSFNDTMKTSTWIXXXXXXXXXXXXXXXXXXXXKIGTIWTVLFGGGLICLNTGLMITMVKQNLWLIIXXXXXXXXXXXXXXXXXXXXXXAKIFTEKKGLIFGITLSGYGLSALFQDVIQNYEVKN-NVESTFMYMTIFCTVMLFVGVILLGFXXXXXXXXSHSIYNSVKYDIFNSYRR-------VTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSS-NFNQYKIDKFTLS---VVFTISNSIGRIFWGFLVDIKPFKCXXXXXXXXXXXXXXXXPFVTSALKIYIIIVLWYSVIGFQLGGFFAIFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMNFDFSSNF 1247
            ++++V++GA ++Q+ LG  Y    F Q  I  F  +R +   +F+ T+             + +     G +  KIG  W    GG  I L  G+M+      ++ + + YG +GG G+GI Y   L    K F +K+GLI G+ ++G+GL  L    I  + + N  V S F+Y+ I   V++ +G  LL               N    D  NS++        V++++ P +++  Y F++LW +    +    +V+SF         K+D  T S   +V  + N+ GRI  G + D       +I++    ++ ++ + F T     ++I V   S+IGF  GGF A+FP++ A+ +GTK+   NYG++Y A  +   +  ++     FSS F
Sbjct:    2 KRWLVVIGAILIQINLGAVYAWSLFNQPLIEKFGWDREDIVVTFSITI-----------FMLAACAFIAGRIQDKIGPRWVATIGG--ILLGLGVMLASQATTIYQLYLFYGIVGGAGIGITYVCPLSACVKWFPDKRGLISGVAVAGFGLGGLIYKPIILFLIDNFGVSSAFLYLGIIYFVLVVLGAQLLS--------------NPEAGDELNSHQSDGEALTVVSEQYSPKEMLGTYQFYLLWFMYLFGTMAGLLVISFAVDIGLELVKLDVVTASNAVMVIALFNAGGRIILGKISDNIGRINTLILMYGTTTLIMLYMSFGTMNYLTFLISV---SLIGFCFGGFLALFPSVTADFYGTKNIGANYGIMYLAYGISAFVGPIIIKYISFSSAF 369          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1S2MAB3 (MFS transporter OS=Anaerobacillus alkalidiazotrophicus OX=472963 GN=BKP45_01320 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.051e-14
Identity = 111/399 (27.82%), Postives = 191/399 (47.87%), Query Frame = 3
Query:   99 QKYIVLLGAFVVQLTLGGFYTAGSF-QSKIAHFISNRTN--TSFNDTMKTSTWIXXXXXXXXXXXXXXXXXXXXKIGTIWTVLFGGGLICLNTGLMITMVKQNLWLIIXXXXXXXXXXXXXXXXXXXXXXAKIFTEKKGLIFGITLSGYGLSALFQDVIQNYEVKN-NVESTFMYMTIFCTVMLFVGVILLGFXXXXXXXXSHSIYNSVKYDIFNSYRR-------VTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSS-NFNQYKIDKFTLS---VVFTISNSIGRIFWGFLVDIKPFKCXXXXXXXXXXXXXXXXPFVTSALKIYIIIVLWYSVIGFQLGGFFAIFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMNFDFSSNFL 1250
            ++++V++GA ++Q+ LG  Y    F Q  I  +  +R +   +F+ T+             + +     G +  KIG  W    GG  I L  G+M+      ++ + + YG +GG G+GI Y   L    K F +K+GLI G+ ++G+GL  L    I  + + N  V S F+Y+ I   V++ +G  LL               N    D  NS++        V+++F P +++  Y F++LW +    +    +V+SF         K+D  T S   +V  + N+ GRI  G + D       +I++  I ++ ++ + F T     ++I V   S+IGF  GGF A+FP+I A+ +GTK+   NYG++Y A  +   +  ++     FSS FL
Sbjct:    2 KRWLVVIGAILIQINLGAVYAWSLFNQPLIETYGWDREDIVVTFSITI-----------FMLAACAFIAGKIQDKIGPRWVATIGG--ILLGLGVMLASQATTIYQLYLFYGIIGGAGIGITYVCPLSACVKWFPDKRGLISGVAVAGFGLGGLVYKPIILFLIDNFGVSSAFLYLGIIYFVLVVLGAQLLS--------------NPEAGDELNSHQSDGEALTVVSEQFSPKEMLGTYQFYLLWFMYLFGTMAGLLVISFAVDIGLELVKLDVVTASNAVMVIALFNAGGRIILGKISDNIGRINTLILMYGITTLIMLYMSFGTMNNLTFLISV---SLIGFCFGGFLALFPSITADFYGTKNIGANYGIMYLAYGISAFVGPIIIKYISFSSAFL 370          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000069674.1 (SMESG000069674.1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 407/421 (96.67%), Postives = 414/421 (98.34%), Query Frame = 3
Query:   84 MSIMQQKYIVLLGAFVVQLTLGGFYTAGSFQSKIAHFISNRTNTSFNDTMKTSTWIXXXXXXXXXXXXXXXXXXXXKIGTIWTVLFGGGLICLNTGLMITMVKQNLWLIIXXXXXXXXXXXXXXXXXXXXXXAKIFTEKKGLIFGITLSGYGLSALFQDVIQNYEVKNNVESTFMYMTIFCTVMLFVGVILLGFXXXXXXXXSHSIYNSVKYDIFNSYRRVTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSSNFNQYKIDKFTLSVVFTISNSIGRIFWGFLVDIKPFKCXXXXXXXXXXXXXXXXPFVTSALKIYIIIVLWYSVIGFQLGGFFAIFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMNFDFSSNFLQNXXXXXXXXXXXXXXXXXXXRGKSLITHNTF 1346
            MSIMQQKYIVLLGAFVVQLTLGGFY AGSFQS+IAHFISNRTNTSFNDTMKTSTWIFGAMSLGMGSSMSFGGFMDSKIGTIWTVLFGGGLICLNTGLMITMVKQNLWLIIITYGFLGGVGVGIVYGVTLGTIAKIFTEKKGLIFG+TLSGYGLSA FQDVIQNYE K NVESTF+Y+TIFCTVMLFVGVILLGFKKKIKIEESHSIYNSVKYDIFNSYRRVTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSS FNQYKIDKFTLSVVFTISNSIGRIFWGFLVDIKPFKCIMIILLIINSIFLVSLPFVTSALK++ II+LWYSVIGFQLGGFF IFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMNFDFSSNFLQNAFIIAGAISLLGAILSGLFRGKSLITHNTF
Sbjct:    1 MSIMQQKYIVLLGAFVVQLTLGGFYNAGSFQSEIAHFISNRTNTSFNDTMKTSTWIFGAMSLGMGSSMSFGGFMDSKIGTIWTVLFGGGLICLNTGLMITMVKQNLWLIIITYGFLGGVGVGIVYGVTLGTIAKIFTEKKGLIFGLTLSGYGLSAFFQDVIQNYEGKKNVESTFIYITIFCTVMLFVGVILLGFKKKIKIEESHSIYNSVKYDIFNSYRRVTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSSYFNQYKIDKFTLSVVFTISNSIGRIFWGFLVDIKPFKCIMIILLIINSIFLVSLPFVTSALKLHSIIILWYSVIGFQLGGFFGIFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMNFDFSSNFLQNAFIIAGAISLLGAILSGLFRGKSLITHNTF 421          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000069674.1 (SMESG000069674.1)

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 404/418 (96.65%), Postives = 411/418 (98.33%), Query Frame = 3
Query:   93 MQQKYIVLLGAFVVQLTLGGFYTAGSFQSKIAHFISNRTNTSFNDTMKTSTWIXXXXXXXXXXXXXXXXXXXXKIGTIWTVLFGGGLICLNTGLMITMVKQNLWLIIXXXXXXXXXXXXXXXXXXXXXXAKIFTEKKGLIFGITLSGYGLSALFQDVIQNYEVKNNVESTFMYMTIFCTVMLFVGVILLGFXXXXXXXXSHSIYNSVKYDIFNSYRRVTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSSNFNQYKIDKFTLSVVFTISNSIGRIFWGFLVDIKPFKCXXXXXXXXXXXXXXXXPFVTSALKIYIIIVLWYSVIGFQLGGFFAIFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMNFDFSSNFLQNXXXXXXXXXXXXXXXXXXXRGKSLITHNTF 1346
            MQQKYIVLLGAFVVQLTLGGFY AGSFQS+IAHFISNRTNTSFNDTMKTSTWIFGAMSLGMGSSMSFGGFMDSKIGTIWTVLFGGGLICLNTGLMITMVKQNLWLIIITYGFLGGVGVGIVYGVTLGTIAKIFTEKKGLIFG+TLSGYGLSA FQDVIQNYE K NVESTF+Y+TIFCTVMLFVGVILLGFKKKIKIEESHSIYNSVKYDIFNSYRRVTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSS FNQYKIDKFTLSVVFTISNSIGRIFWGFLVDIKPFKCIMIILLIINSIFLVSLPFVTSALK++ II+LWYSVIGFQLGGFF IFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMNFDFSSNFLQNAFIIAGAISLLGAILSGLFRGKSLITHNTF
Sbjct:    1 MQQKYIVLLGAFVVQLTLGGFYNAGSFQSEIAHFISNRTNTSFNDTMKTSTWIFGAMSLGMGSSMSFGGFMDSKIGTIWTVLFGGGLICLNTGLMITMVKQNLWLIIITYGFLGGVGVGIVYGVTLGTIAKIFTEKKGLIFGLTLSGYGLSAFFQDVIQNYEGKKNVESTFIYITIFCTVMLFVGVILLGFKKKIKIEESHSIYNSVKYDIFNSYRRVTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSSYFNQYKIDKFTLSVVFTISNSIGRIFWGFLVDIKPFKCIMIILLIINSIFLVSLPFVTSALKLHSIIILWYSVIGFQLGGFFGIFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMNFDFSSNFLQNAFIIAGAISLLGAILSGLFRGKSLITHNTF 418          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000069668.1 (SMESG000069668.1)

HSP 1 Score: 163.696 bits (413), Expect = 4.495e-45
Identity = 175/442 (39.59%), Postives = 258/442 (58.37%), Query Frame = 3
Query:   96 QQKYIVLLGAFVVQLTLGGFYTAGSFQSKIAHFISNRTNTSFNDTMKTSTWIXXXXXXXXXXXXXXXXXXXXKIGTIWTVLFGGGLICLNTGLMITMVKQNLWLIIXXXXXXXXXXXXXXXXXXXXXXAKIFTEKKGLIFGITLSGYGLSALFQDVIQN---YEVK----NNVESTFMYMTIFCTVMLFVGVILLGFXXXXXXXXSHSIYNSVKYDIFNSYRRVTK--------EFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSSNFNQYKI-----DKFTLSVVFTIS---NSIGRIFWGFLVDIKPFKCXXXXXXXXXXXXXXXXPFVTSALKI---YIIIVLWYSVIGFQLGGFFAIFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMNF--DFSSNFL--QNXXXXXXXXXXXXXXXXXXXRGKSLI 1331
             Q Y+++LGAF +QLTLGGFYT+G+ Q  I +F+ N +++  + TM+ S WIFG + LGMG+++S GGF++ +IG   TVL GG ++  N  LM   +K  L ++II+YG +GG G+G+ YGV+LGT  K F + KGLIFGI +SG   S++  D +Q+   Y+ K    N +  +F+ +    +V+  VG IL+  + K K EE  S   S +    +      K        E + H ++   DFW+LW+IM     +++  +S  +S FN+Y         F L V+ TI+   N  GRIFWGF +D + FK +M+I+ +  S  +  LP V S LK+        +W+ VI F L G F+IFP +C  LFG K+F  NYG+L+T+ S+ G II LV M    +FSS  L  +N  II   +S L A+L+ L+RGKS I
Sbjct:    6 NQNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLIFGIVVSGISFSSIIFDAVQDSIIYKGKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDGDQKLDFPKLKILNNPPELQTHHLLFVLDFWILWMIM----FLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILP-VISTLKVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLVIMLVFPEFSSTPLVFRNMVIIGVILSFLAALLTLLYRGKSAI 442          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000069673.1 (SMESG000069673.1)

HSP 1 Score: 155.992 bits (393), Expect = 2.144e-42
Identity = 156/424 (36.79%), Postives = 241/424 (56.84%), Query Frame = 3
Query:  102 KYIVLLGAFVVQLTLGGFYTAGSFQSKIAHFISNRTNTSFNDTMKTSTWIXXXXXXXXXXXXXXXXXXXXKIGTIWTVLFGGGLICLNTGLMITMVKQNLWLIIXXXXXXXXXXXXXXXXXXXXXXAKIFTEKKGLIFGITLSGYGLSALFQDVIQNYEVKN--NVESTFMYMTIFCTVMLFVGVILLGFXXXXXXXXSHSIYNSVKY-DIF-NSYRRVTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSSNFNQYKIDKFTLSVVFTIS------NSIGRIFWGFLVDIKPFKCXXXXXXXXXXXXXXXXPFVT----SALKIYIIIVLWYSVIGFQLGGFFAIFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMNFDFSSNFLQNXXXXXXXXXXXXXXXXXXXRGKSLI 1331
            KY+ + G F++ +++G FY+AG     I  ++ N          KTSTWIFG+  LGMG++MS GG+++ KIG+  TVL GG ++  N  LM   +   L ++I+TYG   G G G+VYGV LG   KI  ++ GL  G+ +SG+G+SA   D +QN    +  N+  +F+ M     V+  +G ILL  K         S   S  Y +IF NS  ++  EFKPH+I+LE DFW+LW+       ++ I ++F ++ +N+Y  + F    + TIS      N +GRIFWGF++D KPFK  M+I+ +  SI +     ++    +     I+  + +  I F   G F IFP +CA L+G K+F  NYGML+TA S+   I+ ++SMN     + L+  F+   A+S+L  +++ ++RGKSLI
Sbjct:   10 KYLPIFGGFLLHISVGYFYSAGHIMPHINKYMKNEN--------KTSTWIFGSTLLGMGAAMSLGGYVEMKIGSSLTVLIGGWIMSANICLMCVTMTCGLTVVILTYGLFAGFGTGLVYGVALGVPLKIVKKRVGLFLGVVVSGFGVSATIFDYLQNVLSSDYTNLPLSFLIMGCIYAVIQLIGAILLKKKANENDLTIQSNETSFNYFEIFLNSKSKM--EFKPHEILLELDFWILWITF----FLNAIGVNFLTTLYNEYYHELFGAQHLVTISISGAAFNCLGRIFWGFIIDKKPFKITMVIMTVGTSILMALFSTISLMNLTGKMNEIVFGIIFCAINFFQSGNFCIFPFMCAQLYGVKYFVCNYGMLFTACSVACTIVNIISMNISREKDNLKFVFVAGAALSILSTLMTLVYRGKSLI 419          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000069670.1 (SMESG000069670.1)

HSP 1 Score: 150.599 bits (379), Expect = 1.654e-40
Identity = 150/429 (34.97%), Postives = 231/429 (53.85%), Query Frame = 3
Query:  102 KYIVLLGAFVVQLTLGGFYTAGSFQSKIAHFISNRTNTSFNDTMKTSTWIXXXXXXXXXXXXXXXXXXXXKIGTIWTVLFGGGLICLNTGLMITMVKQNLWLIIXXXXXXXXXXXXXXXXXXXXXXAKIFTEKKGLIFGITLSGYGLSALFQDVIQNY---EVKNNVESTFMYMTIFCTVMLFVGVILLGFXXXXXXXXSHSIYNSVKYDIFNSYRRVTKEFKPHQIILEYDFWMLWLIMTAVSAVDNIVMSFYSSNFNQYKIDKFTLSVVFTIS------NSIGRIFWGFLVDIKPFKCXXXXXXXXXXXXXXXXPFV-----TSALKIYIIIVLWYSVIGFQLGGFFAIFPTICANLFGTKHFTINYGMLYTANSLPGCIICLVSMNFDFSSNFLQNXXXXXXXXXXXXXXXXXXXRGKSLITHNTF 1346
            KY+ +LG+F++ L++G F++ G  + +I  ++ N          KTSTWI G+  LGMG++MS GG+++ KIG+  TVL GG ++  N  LM   +   L ++I+TYG   G G G+VYGV LG   +I   + GLI G+  SG+G+SAL    +QN         +  +F+ +     V+  +G IL+  K         SI  S  Y   N       EFKPH+I+LE DFW+LW+I+   +   N++   Y    N+Y  + F    + TIS      N +GRIFWGF++D KPFK  M+I+ +  SI +     +     T  +  Y+  +++ ++  FQ G F  IFP +CA L+G K+F  NYGML+TA S  G  + ++          ++  F    A+S L A+++ ++RGKSLI    F
Sbjct:   10 KYLPILGSFLLHLSVGCFFSIGQIKPQIDEYMGNNN--------KTSTWIVGSTLLGMGAAMSLGGYVEMKIGSSLTVLIGGWIMSANICLMCVTMTCGLTVVILTYGLFAGFGTGLVYGVALGVPIRIMKNRIGLIIGVVASGFGVSALIFYFLQNLFTGSCCKYLPQSFLILGCIYAVIQLIGGILIKEKANKNELAIESIERSFNYFGNNLVSYDNLEFKPHEILLELDFWILWIILFLNAICINLITCLY----NEYYHELFGAQHLVTISISGAAFNCLGRIFWGFIIDKKPFKITMVIMTVGTSILMALFATISLMNLTGKMNGYVFGIIFCAINFFQSGNF-CIFPFMCARLYGVKYFVCNYGMLFTACSAAGTTVNIILTTTSVDKEIIKTLFFTGTALSSLSAMVTIVYRGKSLIVRTNF 425          
The following BLAST results are available for this feature:
BLAST of MFS domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
F10G7.51.683e-626.09pep chromosome:WBcel235:II:4693414:4696408:1 gene:... [more]
F10G7.51.683e-626.09pep chromosome:WBcel235:II:4693542:4696408:1 gene:... [more]
F10G7.52.045e-626.09pep chromosome:WBcel235:II:4693414:4696408:1 gene:... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W7RA765.130e-1728.10Major Facilitator-like protein 5 OS=Hadrurus spadi... [more]
A0A0H3YF107.620e-1727.81Slc16a-10 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A443SUB74.141e-1627.61Major Facilitator-like protein 5 OS=Leptotrombidiu... [more]
A0A1S2LR328.052e-1527.14MFS transporter OS=Anaerobacillus alkalilacustris ... [more]
A0A1S2MAB31.051e-1427.82MFS transporter OS=Anaerobacillus alkalidiazotroph... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069674.10.000e+096.67SMESG000069674.1[more]
SMESG000069674.10.000e+096.65SMESG000069674.1[more]
SMESG000069668.14.495e-4539.59SMESG000069668.1[more]
SMESG000069673.12.144e-4236.79SMESG000069673.1[more]
SMESG000069670.11.654e-4034.97SMESG000069670.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030984 ID=SMED30030984|Name=MFS domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1401bp
CAATTTTTCATTAAATTTTTCATCTTTGTTATAAAATAAAAGTTTACCTA
ATTTCAAAGTTAAATCTTTTTTTCTTATAACTCATGTCGATTATGCAACA
GAAATACATTGTCCTTCTTGGTGCATTTGTTGTCCAACTGACTCTTGGCG
GTTTTTATACTGCTGGAAGTTTTCAGTCTAAAATAGCTCATTTTATATCA
AATCGTACTAATACAAGTTTTAATGACACTATGAAAACTTCAACTTGGAT
TTTTGGGGCCATGTCATTGGGAATGGGGTCTTCCATGTCTTTCGGTGGAT
TTATGGACAGTAAAATCGGCACAATCTGGACTGTCTTGTTTGGCGGTGGT
TTGATATGCTTAAATACTGGTCTTATGATTACAATGGTGAAACAAAACTT
GTGGCTTATCATCATCACTTATGGGTTTTTAGGTGGAGTTGGCGTTGGTA
TTGTATATGGAGTCACCCTGGGCACTATAGCTAAAATTTTTACAGAAAAA
AAAGGTTTAATATTTGGAATAACCTTATCAGGTTACGGATTATCAGCTTT
GTTTCAAGATGTCATACAAAATTATGAGGTGAAAAATAATGTGGAAAGCA
CTTTTATGTATATGACTATCTTTTGTACGGTCATGCTATTCGTTGGAGTC
ATCTTGTTAGGATTTAAAAAAAAAATAAAAATTGAAGAAAGTCATTCAAT
ATATAACAGTGTAAAATATGACATATTCAACAGCTATAGACGAGTTACAA
AGGAATTTAAACCTCACCAAATCATACTTGAATACGATTTTTGGATGTTA
TGGCTAATCATGACTGCCGTAAGCGCGGTAGATAATATTGTAATGTCTTT
TTATTCAAGTAATTTTAACCAATATAAGATAGATAAATTTACGTTATCTG
TGGTCTTCACCATCAGCAATTCCATTGGGAGAATATTCTGGGGTTTCCTC
GTGGACATAAAGCCGTTTAAATGCATAATGATAATTTTGCTTATCATTAA
TTCCATATTTCTCGTCTCTTTGCCATTTGTCACAAGTGCATTAAAAATAT
ATATCATCATTGTTTTATGGTATTCTGTCATTGGTTTTCAACTGGGAGGG
TTCTTTGCAATTTTCCCAACAATTTGTGCAAATTTATTTGGTACCAAACA
TTTTACTATAAATTATGGAATGCTTTATACCGCAAATTCGTTGCCCGGGT
GCATAATATGCTTGGTTTCAATGAATTTTGATTTTTCTTCAAACTTTTTG
CAGAATGCATTCATCATTGCAGGAGCAATTTCTCTACTTGGAGCAATATT
GAGTGGTTTATTCAGAGGAAAGTCGTTAATCACTCATAATACATTCTAAA
TGAAACTAATTGATATATTTTTTAATAAAAATTTGATTTATTTAAAAAAA
A
back to top

protein sequence of SMED30030984-orf-1

>SMED30030984-orf-1 ID=SMED30030984-orf-1|Name=SMED30030984-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=422bp
MSIMQQKYIVLLGAFVVQLTLGGFYTAGSFQSKIAHFISNRTNTSFNDTM
KTSTWIFGAMSLGMGSSMSFGGFMDSKIGTIWTVLFGGGLICLNTGLMIT
MVKQNLWLIIITYGFLGGVGVGIVYGVTLGTIAKIFTEKKGLIFGITLSG
YGLSALFQDVIQNYEVKNNVESTFMYMTIFCTVMLFVGVILLGFKKKIKI
EESHSIYNSVKYDIFNSYRRVTKEFKPHQIILEYDFWMLWLIMTAVSAVD
NIVMSFYSSNFNQYKIDKFTLSVVFTISNSIGRIFWGFLVDIKPFKCIMI
ILLIINSIFLVSLPFVTSALKIYIIIVLWYSVIGFQLGGFFAIFPTICAN
LFGTKHFTINYGMLYTANSLPGCIICLVSMNFDFSSNFLQNAFIIAGAIS
LLGAILSGLFRGKSLITHNTF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 43..374
e-value: 6.4E-21
score: 74.7
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 7..203
e-value: 2.5E-8
score: 35.4
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 223..414
e-value: 4.1E-15
score: 57.6
NoneNo IPR availablePANTHERPTHR11360:SF3OXALATE/FORMATE ANTIPORTERcoord: 6..405
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 6..405
NoneNo IPR availableCDDcd17353MFS_OFA_likecoord: 7..407
e-value: 1.43363E-41
score: 149.298
NoneNo IPR availableTMHMMTMhelixcoord: 142..162
NoneNo IPR availableTMHMMTMhelixcoord: 80..102
NoneNo IPR availableTMHMMTMhelixcoord: 326..348
NoneNo IPR availableTMHMMTMhelixcoord: 297..316
NoneNo IPR availableTMHMMTMhelixcoord: 107..129
NoneNo IPR availableTMHMMTMhelixcoord: 54..73
NoneNo IPR availableTMHMMTMhelixcoord: 268..290
NoneNo IPR availableTMHMMTMhelixcoord: 236..258
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 361..383
NoneNo IPR availableTMHMMTMhelixcoord: 172..194
NoneNo IPR availableTMHMMTMhelixcoord: 388..410
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 6..415
score: 12.569
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 6..411