SMED30030974

Overview
NameSMED30030974
Smed IDSMED30030974
Length (bp)558
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30030974 (SMED30030974) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30030974 (SMED30030974) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30030974 (SMED30030974) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30030974 (SMED30030974) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030974

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 50

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30030974h1SMcG0014354 Contig8406newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030974h1SMcG0014354 Contig8406uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30030974h1SMcG0014354 dd_Smed_v4_15537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030974h1SMcG0014354 dd_Smed_v4_15537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30030974h1SMcG0014354 dd_Smed_v4_15537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030974h1SMcG0014354 dd_Smed_v4_17069_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030974h1SMcG0014354 dd_Smed_v4_17069_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030974h1SMcG0014354 dd_Smed_v4_13910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030974h1SMcG0014354 dd_Smed_v4_13910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030974h1SMcG0014354 dd_Smed_v4_13910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030974h1SMcG0014354 dd_Smed_v4_13910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030974h1SMcG0014354 dd_Smed_v4_13910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030974h1SMcG0014354 dd_Smed_v4_14706_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030974h1SMcG0014354 dd_Smed_v4_14706_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30030974h1SMcG0014354 dd_Smed_v4_14706_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030974h1SMcG0014354 dd_Smed_v4_22711_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030974h1SMcG0014354 dd_Smed_v4_22711_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30030974h1SMcG0014354 dd_Smed_v4_22711_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030974h1SMcG0014354 dd_Smed_v4_33016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030974h1SMcG0014354 dd_Smed_v4_33016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030974h1SMcG0014354 dd_Smed_v4_2438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030974h1SMcG0014354 dd_Smed_v4_2438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030974h1SMcG0014354 dd_Smed_v4_2438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30030974h1SMcG0014354 dd_Smed_v4_2438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030974h1SMcG0014354 dd_Smed_v4_2438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30030974h1SMcG0014354 dd_Smed_v4_2438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030974h1SMcG0004202 Contig4817newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030974h1SMcG0004202 Contig4817uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030974h1SMcG0014354 Contig45442uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030974h1SMcG0014354 Contig45442newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030974h1SMcG0014354 Contig20172newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030974h1SMcG0014354 Contig20172uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030974h1SMcG0014354 Contig4817newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030974h1SMcG0014354 Contig4817uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30030974h1SMcG0014354 dd_Smed_v6_22711_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30030974h1SMcG0014354 dd_Smed_v4_15537_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30030974h1SMcG0014354 dd_Smed_v4_17069_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30030974h1SMcG0014354 dd_Smed_v4_13910_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30030974h1SMcG0014354 dd_Smed_v4_14706_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30030974h1SMcG0014354 dd_Smed_v4_2438_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30030974h1SMcG0014354 dd_Smed_v6_2438_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30030974h1SMcG0014354 dd_Smed_v6_2438_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30030974h1SMcG0014354 dd_Smed_v6_17069_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30030974h1SMcG0014354 dd_Smed_v6_17069_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30030974h1SMcG0014354 dd_Smed_v6_13910_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30030974h1SMcG0014354 dd_Smed_v6_13910_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030974h1SMcG0014354 dd_Smed_v6_15537_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30030974h1SMcG0014354 dd_Smed_v6_15537_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30030974h1SMcG0014354 dd_Smed_v6_15537_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30030974h1SMcG0014354 dd_Smed_v6_14706_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30030974 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000643:92850..93407 +2727
Homology
BLAST of SMED30030974 vs. Planmine SMEST
Match: SMESG000005752.1 (SMESG000005752.1)

HSP 1 Score: 338.191 bits (866), Expect = 1.302e-107
Identity = 179/185 (96.76%), Postives = 182/185 (98.38%), Query Frame = 3
Query:    3 ENDVLETRVIKEQSEFLEPLVTDNIPEEEMNSVELVTVKPEELTTVLISESVEKVDESEIIDIAEIKQTDSTTTVVENVLEIQIIDEKADKPEINILTETNIQSEIEMETALEHTENVNVEADFKTKDNEELQIVSETVEIVDEHETETCKEEFYEAPIENKMESVFETELIEEYPQSLEASNVE 557
            ENDVLETRVIKEQSEFLEPLVTDNIPEEEMNSVELVTVKPEELTTVLISESVEKVDESEIIDIAEIKQTDSTTTVVEN LEIQ+IDEKADKPEINILTETNIQSE+EMETALEHTENVNVEADFKTKDNEELQIVSE VEIVDEHETETCKEEFYEAP+ENKMESV ETELIEEYPQSLEASNVE
Sbjct: 7205 ENDVLETRVIKEQSEFLEPLVTDNIPEEEMNSVELVTVKPEELTTVLISESVEKVDESEIIDIAEIKQTDSTTTVVENFLEIQVIDEKADKPEINILTETNIQSEVEMETALEHTENVNVEADFKTKDNEELQIVSENVEIVDEHETETCKEEFYEAPLENKMESVIETELIEEYPQSLEASNVE 7389          

HSP 2 Score: 140.969 bits (354), Expect = 9.583e-39
Identity = 95/206 (46.12%), Postives = 133/206 (64.56%), Query Frame = 3
Query:   12 VLETRVIKEQSEFLEPLVTDNIPEEEMNSVELVTVKPEELTTVL--ISESVEKVDESEIID-IAEIKQTDSTTTVVENVLEIQIIDEKADKPEINILTET---------------------NIQSEIEMETALEHTENVNVEADFKTKDNEELQIVSETVEIVDEHETETCKEEFYEAPIENKMESVFETELIEEYPQSLEASNVE 557
            V+ET +I+E  + LE    ++I EEE+N++E   +KP+     L    E +E+V++ EI D   EIKQ ++ T V EN  E ++ + K++KPEIN+  E                      +I+   E+E  L   E+ NVEADFKTKDNEELQIVSE VEIVDEHE +TC+EE Y+ P+E+K+E+VFET++IE+YPQ+LEASNVE
Sbjct: 7370 VIETELIEEYPQSLEASNVEDIVEEEINTIEATIIKPKNELLALSEAVEQIERVEQDEIKDEDLEIKQEETFTAVFENNSEDKVFETKSEKPEINVFEEMKIEEEIVKIEEVFEETIEKEESIEDSFEIEIELSDVEHENVEADFKTKDNEELQIVSENVEIVDEHEAKTCEEELYKKPLESKVENVFETKVIEQYPQALEASNVE 7575          

HSP 3 Score: 116.316 bits (290), Expect = 4.525e-30
Identity = 89/188 (47.34%), Postives = 130/188 (69.15%), Query Frame = 3
Query:    3 ENDVLETRVIKEQSEFLEPLVTDNIPEEEMNSVELVTVKPEELTTVLISESVEKVDESE--IIDIAEIKQTDSTTTVVENVLEIQIIDEKADKPEINIL----TETNIQSEIEMETALEHTENVNVEADFKTKDNEELQIVSETVEIVDEHETETCKEEFYEAPIENKM-ESVFETELIEEYPQSLEA 545
            E +V +T +IKEQ EFLE LV +NI EEEM++VE   VK E+  TVL +E+VE++ E E    +++EIKQ   ++ V+E+VLE  I + +  + +I ++     E +I+   E+E  L   EN +VEA+FKTKDN+ELQI+SE VE  DEH+TET  +EF E  +E+K  E+VF+T++IEE+PQ +EA
Sbjct: 8614 EENVFKTEIIKEQPEFLEALVAENIVEEEMHNVEGTLVKTEKQQTVL-AEAVEQIKELEHDKDEVSEIKQALVSSAVMEDVLETNIHESEVKELDIKVIDSIEREESIEDSFEIEMELSDVENEDVEAEFKTKDNKELQILSENVENHDEHQTETF-QEFDEVNLESKAEENVFKTQVIEEHPQFVEA 8799          

HSP 4 Score: 109.383 bits (272), Expect = 9.389e-28
Identity = 80/206 (38.83%), Postives = 124/206 (60.19%), Query Frame = 3
Query:    3 ENDVLETRVIKEQSEFLEPLVTDNIPEEEMNSVELVTVKPEELTTVLISESVE---KVDESEIID-IAEIKQTDSTTTVVENVLEIQIIDEKADKPEINILTET---------------------NIQSEIEMETALEHTENVNVEADFKTKDNEELQIVSETVEIVDEHETETCKEEFYEAPIENKM-ESVFETELIEEYPQSLE 542
            E +V +T+VI+E  +F+E L+TDNI +E +N V             ++SE VE   K+DE+E+ + I EIK   + T++++N+LE ++ + K++ PE+N+L E                      +I+   E+E  L   E   V+ADF+TKDN+ELQ++SE  EI +EHETE CKEE YE  +E+KM E+   +++IEE+PQ LE
Sbjct: 8781 EENVFKTQVIEEHPQFVEALITDNIEDEVVNDV------------AVLSEGVEQTQKLDENEVKEEIPEIKPITALTSLIKNILEDKVCEHKSEMPEVNVLEEVKTEMEVVETEDVIKEIIEKQESIEGSFEIEMELSDIEREIVKADFETKDNKELQVLSENAEIQEEHETEKCKEELYEVNLESKMEENASMSKVIEEHPQILE 8974          

HSP 5 Score: 107.071 bits (266), Expect = 7.537e-27
Identity = 78/188 (41.49%), Postives = 110/188 (58.51%), Query Frame = 3
Query:    9 DVLETRVIKEQSEFLEPLVTDNIPEEEMNSVELVTVKPEELTTVL--ISESVEKVDESEIID-IAEIKQTDSTTTVVENVLEIQIIDEKADKPEINIL---------------------TETNIQSEIEMETALEHTENVNVEADFKTKDNEELQIVSETVEIVDEHETETCKEEFYEAPIENKMESV 500
            +V ET+VI++  + LE    ++I EEE+N++E   +KP+     L    E +E+V++ EI D   EIKQ ++ T V EN  E +  + K++KPEIN+                       E +I+   E+E  L   E+ NVEADFKTKDNEELQIVSE +EIVDEHE +TC EE YE  + +K+E V
Sbjct: 7555 NVFETKVIEQYPQALEASNVEDIVEEEINTIEATIIKPKNELLALSEAVEQIERVEQDEIKDEDLEIKQEETFTAVFENNSEDKFFETKSEKPEINVFEEMKIEEEIVKIEEVFEETIEKEDSIEDSFEIEIELSDVEHENVEADFKTKDNEELQIVSENIEIVDEHEAKTCGEELYEKSLTSKVEDV 7742          

HSP 6 Score: 98.9821 bits (245), Expect = 4.156e-24
Identity = 79/204 (38.73%), Postives = 119/204 (58.33%), Query Frame = 3
Query:    3 ENDVLETRVIKEQSEFLEPLVTDNIPEEEMNSVELVTVKPEELTTVLISESVEK---VDESEIIDIAEIKQTDSTTTVVENVLEIQIIDEKADKPEINILTETNIQSEI--------------------EMETALEHTENVNVEADFKTKDNEELQIVSETVEIVDEHETETCKEEFYEAPIENKM-ESVFETELIEEYPQSLE 542
            E ++ ET+VI+E  +FLE  +  +I EEE  SVE   VKPE +   ++SE++E+   + +SEI +I+EIK   ++  V++N  E  ++  K +  ++ IL E+N Q E+                    EME  L   E+ NVEA+FKTKD+E+ +IVS  +E VDEHE E  KE   E  +ENK+ E+VF+ + IE+ P  LE
Sbjct: 8071 EQNLFETQVIEEIPQFLETTIISDIVEEETKSVEGTIVKPE-VKMEILSEAIEQTQNLKQSEINEISEIKPNAASVLVIDNSPEENVLGLKPETFDVPILEESNKQDEVTEMEVKGNIVVNAESLEDSFEMEMELLDVESANVEAEFKTKDSEDFKIVSGCIETVDEHEAEAFKEVLNEVSLENKIEENVFQIKAIEKQPHFLE 8273          

HSP 7 Score: 96.2857 bits (238), Expect = 4.073e-23
Identity = 81/206 (39.32%), Postives = 122/206 (59.22%), Query Frame = 3
Query:    3 ENDVLETRVIKEQSEFLEPLVTDNIPEEEMNSVELVTVKPEELTTVLISESVE---KVDESEII-DIAEIKQTDSTTTVVENVLEIQIIDEKADKPEINIL--------------------TETNIQSEIEMETALEHTENVNVEADFKTKDNEELQIVSETVEIVDEHETETCKEEFYEAPIENKM-ESVFETELIEEYPQSLEA 545
            E++V +T  I E  + LE + T+NI E+E+N++E   VK E+  + L SE+VE   K+++  +  DI EI +T ++T ++EN LE      K++K ++N+L                     E +I+   E+E  L   EN +VEADFKTKDN+ELQ VSE +EI DEHE     E   E  I++K+ E+VF+TE+I+E P+ LEA
Sbjct: 8433 EDNVYDTIAIVEHPQTLEAMATENIIEQEINTIEATIVKTEKKLSTL-SEAVEQNVKIEQGGVNEDILEIIETRASTALIENSLE-----NKSEKLDVNVLENSKVEETMKDEAVFEDIFVQEESIEDSFEIEMELSDLENEDVEADFKTKDNKELQNVSENLEITDEHEANIHDEALEEVSIQHKLEENVFKTEIIKEQPEFLEA 8632          

HSP 8 Score: 94.7449 bits (234), Expect = 1.370e-22
Identity = 74/197 (37.56%), Postives = 123/197 (62.44%), Query Frame = 3
Query:    3 ENDVLETRVIKEQSEFLEPLVTDNIPEEEMNSVELVTVKPEELTTVLISESVE---KVDESEI-IDIAEIKQTDSTTTVVENVLEIQIIDEKADKPEINILTET-----------NIQSEIEMETALEHTENVNVEADFKTKDNEELQIVSETVEIVDEHETETCKEEFYEAPIENKME-SVFETELIEEYPQSLEA 545
            E +V + + I++Q  FLE LVT+NI EEE+ +++ + V  + +  VL SE+VE   K ++ EI  D+AEI+Q  ++ +VV  V+E + I+ +++KP++N+L E+           +I+   E+E  L   EN  +EADFK K++  LQ VSE VE + ++     +EE  E  +EN++E +V++T  I E+PQ+LEA
Sbjct: 8256 EENVFQIKAIEKQPHFLEELVTENIAEEEIKTIDAIVVPSDAMVPVL-SEAVEQTQKYEQGEINADVAEIEQVIASKSVVGKVIESRAIELESEKPKLNLLEESKIETEITEKEESIEDSFEIEIELSDAENQELEADFKAKESLALQNVSENVENICDYAGHLSEEELNEVYLENEVEDNVYDTIAIVEHPQTLEA 8451          

HSP 9 Score: 75.8702 bits (185), Expect = 4.453e-16
Identity = 71/206 (34.47%), Postives = 113/206 (54.85%), Query Frame = 3
Query:    9 DVLETRVIKEQSEFLEPLVTDNIPEEEMNSVELVTVKPEELTTVLISESVEKVD---ESEIID-IAEIKQTDSTTTVVENVLEIQIIDEKADKPEINILTETNIQSE---------------------IEMETALEHTENVNVEADFKTKDNEELQIVSETVEIVDEHETETCKEEFYEAPIENKME-SVFETELIEEYPQSLEAS 548
            +V +T +I+E  +FLE L  D +  EEM  +E + V P+E+  VL SE+VE+++   +SEI D +A I+Q      V+ NV+E Q+++ K ++ +  I  ET I+ E                      E+E  L   +N +V+ +FK KD  E    SE +EIV E + ET  E   E  + +++E ++FET++IEE PQ LE +
Sbjct: 7890 NVFKTEIIQEHPQFLESLTNDTMAGEEMRILEAIIVAPKEVIKVL-SEAVEQIETIEQSEIQDDLANIEQD----IVLANVIEAQVLETKLEQADEYISMETKIEIETPNPEATTEETIEKEESIDDSFEIEMELSEVKNEDVKEEFKMKDKVEHHGASENIEIVHEQKAETSGETMDEVCLASRVEQNLFETQVIEEIPQFLETT 8090          

HSP 10 Score: 73.9442 bits (180), Expect = 1.928e-15
Identity = 64/165 (38.79%), Postives = 100/165 (60.61%), Query Frame = 3
Query:   96 SVELVTVKPEELTTVLISESVE---KVDESEIID-IAEIKQTDSTTTVVENVLEIQIIDEKADKPEINILTETNIQSEIE-----METALEHTENVNVEAD-----FKTKDNEELQIVSETVEIVDEHETETCKEEFYEAPIENKME-SVFETELIEEYPQSLEA 545
            S E + +KP+++  +L SESVE   KV++ EI D  AE+ Q  +   V+ENVL+++  + K  KPE +IL   N+Q EI      ME ++E  E++ V  +      KT+ N +LQ VSE +E +++H T   +E   E  +EN  E +VF+TE+I+E+PQ LE+
Sbjct: 7743 STEAIIIKPDDMKNIL-SESVEQIEKVEQCEIKDEFAEVMQDKAFEAVLENVLDVKATEPKTTKPERSILEIANVQVEIMKDESFMEESIEKEESLQVSFESENEYAKTESNVDLQNVSEDIENLEQHATNIYEERLDEVQLENVTELNVFKTEIIQEHPQFLES 7906          
The following BLAST results are available for this feature:
BLAST of SMED30030974 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030974 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030974 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030974 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030974 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030974 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030974 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030974 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030974 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030974 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030974 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030974 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030974 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030974 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000005752.11.302e-10796.76SMESG000005752.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030974 ID=SMED30030974|Name=SMED30030974|organism=Schmidtea mediterranea sexual|type=transcript|length=558bp
TAGAAAATGATGTACTTGAAACTAGAGTAATCAAAGAACAGTCAGAGTTT
TTGGAACCTCTGGTTACCGATAATATTCCGGAGGAAGAAATGAATTCTGT
TGAGTTAGTCACTGTAAAACCAGAAGAACTTACGACTGTTTTAATAAGCG
AAAGTGTAGAAAAGGTTGATGAAAGCGAAATTATTGACATTGCAGAAATA
AAGCAAACAGATTCAACGACAACTGTTGTTGAAAATGTTCTTGAAATTCA
AATCATTGATGAGAAAGCAGACAAACCTGAAATAAATATCTTGACAGAAA
CAAACATACAGTCTGAAATTGAAATGGAAACGGCTTTAGAACATACTGAA
AATGTAAATGTTGAAGCAGATTTTAAAACAAAAGACAATGAAGAGCTTCA
AATTGTTTCTGAAACTGTTGAAATTGTTGATGAGCATGAAACTGAAACGT
GCAAAGAAGAGTTTTACGAAGCACCTATAGAAAATAAAATGGAAAGTGTC
TTCGAAACTGAATTAATTGAAGAATATCCGCAATCTCTAGAAGCATCAAA
TGTGGAAG
back to top

protein sequence of SMED30030974-orf-1

>SMED30030974-orf-1 ID=SMED30030974-orf-1|Name=SMED30030974-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=185bp
ENDVLETRVIKEQSEFLEPLVTDNIPEEEMNSVELVTVKPEELTTVLISE
SVEKVDESEIIDIAEIKQTDSTTTVVENVLEIQIIDEKADKPEINILTET
NIQSEIEMETALEHTENVNVEADFKTKDNEELQIVSETVEIVDEHETETC
KEEFYEAPIENKMESVFETELIEEYPQSLEASNVE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000478pharynx musculature
PLANA:0003104enteric muscle cell
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003677DNA binding
GO:0005524ATP binding
Vocabulary: biological process
TermDefinition
GO:0051301cell division