DNA replication licensing factor MCM7

Overview
NameDNA replication licensing factor MCM7
Smed IDSMED30030946
Length (bp)2284
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA replication licensing factor MCM7 (SMED30030946) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA replication licensing factor MCM7 (SMED30030946) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA replication licensing factor MCM7 (SMED30030946) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA replication licensing factor MCM7 (SMED30030946) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030946

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030946SMESG000057772.1 SmedASXL_007040SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30030946SMESG000057772.1 SmedASXL_007040SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30030946SMESG000057772.1 dd_Smed_v4_4712_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030946SMESG000057772.1 dd_Smed_v4_4712_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030946SMESG000057772.1 Contig49913newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030946SMESG000057772.1 Contig49913uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30030946SMESG000057772.1 dd_Smed_v6_4712_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30030946SMESG000057772.1 Contig49913newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30030946SMESG000057772.1 Contig49913uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30030946SMESG000057772.1 dd_Smed_v4_4712_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030946SMESG000057772.1 SmWIOct06_013186GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30030946SMESG000057772.1 SMED_34561_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30030946SMESG000057772.1 SMED_34561_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30030946SMESG000057772.1 SMED_02093_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30030946SMESG000057772.1 SMED_02093_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Human
Match: MCM7 (minichromosome maintenance complex component 7 [Source:HGNC Symbol;Acc:HGNC:6950])

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 379/737 (51.42%), Postives = 524/737 (71.10%), Query Frame = 1
Query:   28 MRNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEII-HGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            +++Y  +K+K K F++ FY++    KK F Y  Q++ ++ +EQ A+Y+ LDD+ E D EL + I +N  RY KL   A+ E++     R  VNK   D++I+H L +EQ  RD       P  +   + ++P+EL+RR+E YF    ++K   IR V +  +G ++ ++ +V R + VKP M +ATYTCD+CG+ET+Q I + T +PL+ C ++ C+   + GRL+LQT+GS+++K QE+++QE SDQVP+GNIPRS+ V   G NTR+ QPGDHV +TG+FLP+L TG R + +GL++E +L+AH I ++ K E D+ G     T  EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V+RD ++GE+TLE G+LVLAD G+CCIDEFDKM ++DRTAIHEVMEQQTISIAKAGI+TTLNAR SILAAANPAYGRYNPRR++EQNI LPAALLSRFDLLWLIQD+PDRD DLRLAQHI+YVH ++  PPS             PL M  +RRY+A+ R +  P VPE+L +Y+   Y+ MR+E+ A SK++ +TSAR+LLA++R+STAL+R++    V++ DV+EAIRL+E SK S+  D+ +        ++I+  +R L +   +VR ++  ++CVS GFTP Q    +D YEELN+WQVN  RTRI  V
Sbjct:    3 LKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRD-------PGMVRSPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAG-ELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFE----------PLDMKLMRRYIAMCREK-QPMVPESLADYITAAYVEMRREAWA-SKDATYTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV 719          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Human
Match: MCM7 (minichromosome maintenance complex component 7 [Source:HGNC Symbol;Acc:HGNC:6950])

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 317/556 (57.01%), Postives = 419/556 (75.36%), Query Frame = 1
Query:  565 MKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            M +ATYTCD+CG+ET+Q I + T +PL+ C ++ C+   + GRL+LQT+GS+++K QE+++QE SDQVP+GNIPRS+ V   G NTR+ QPGDHV +TG+FLP+L TG R + +GL++E +L+AH I ++ K E D+ G     T  EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V+RD ++GE+TLE G+LVLAD G+CCIDEFDKM ++DRTAIHEVMEQQTISIAKAGI+TTLNAR SILAAANPAYGRYNPRR++EQNI LPAALLSRFDLLWLIQD+PDRD DLRLAQHI+YVH ++  PPS             PL M  +RRY+A+ R +  P VPE+L +Y+   Y+ MR+E+ A SK++ +TSAR+LLA++R+STAL+R++    V++ DV+EAIRL+E SK S+  D+ +        ++I+  +R L +   +VR ++  ++CVS GFTP Q    +D YEELN+WQVN  RTRI  V
Sbjct:    1 MVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAG-ELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFE----------PLDMKLMRRYIAMCREK-QPMVPESLADYITAAYVEMRREAWA-SKDATYTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV 543          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Human
Match: MCM7 (minichromosome maintenance complex component 7 [Source:HGNC Symbol;Acc:HGNC:6950])

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 317/556 (57.01%), Postives = 419/556 (75.36%), Query Frame = 1
Query:  565 MKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            M +ATYTCD+CG+ET+Q I + T +PL+ C ++ C+   + GRL+LQT+GS+++K QE+++QE SDQVP+GNIPRS+ V   G NTR+ QPGDHV +TG+FLP+L TG R + +GL++E +L+AH I ++ K E D+ G     T  EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V+RD ++GE+TLE G+LVLAD G+CCIDEFDKM ++DRTAIHEVMEQQTISIAKAGI+TTLNAR SILAAANPAYGRYNPRR++EQNI LPAALLSRFDLLWLIQD+PDRD DLRLAQHI+YVH ++  PPS             PL M  +RRY+A+ R +  P VPE+L +Y+   Y+ MR+E+ A SK++ +TSAR+LLA++R+STAL+R++    V++ DV+EAIRL+E SK S+  D+ +        ++I+  +R L +   +VR ++  ++CVS GFTP Q    +D YEELN+WQVN  RTRI  V
Sbjct:    1 MVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAG-ELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFE----------PLDMKLMRRYIAMCREK-QPMVPESLADYITAAYVEMRREAWA-SKDATYTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV 543          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 308.145 bits (788), Expect = 2.243e-92
Identity = 227/682 (33.28%), Postives = 350/682 (51.32%), Query Frame = 1
Query:   34 NYESDKDKFKNFIENFYEETS--------DSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPL-LNTGMRTLNRGLVTELFLDA-HFINRITKDES--DDLGETIPATEAELEKLKD----PEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXT---KIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTS-ARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLL-EASKASVKSDR 2016
            N  + K+ F+ F++ F +  +        D  + +Y +++  I+   +  + ++ + I  FD  L          Y++LI Y   E+I     A VN+  FD + D  L+ +  +R                              F A KT    ++RN+  +++  +I +  +VIR + + P M+ A + C  C   T  E+    +     C     +  T   + L    S +   Q I++QE  + +P G  P ++ +         VQPGD V +TG++  + +    R  N   V +  +D  H+     K     D+  E    +E  +E LK+    P++Y  +A ++AP I+ HED+KKG+L+ + GG   D + T   K R  +NI L GDPG +KSQLL +V  L PR QYT+G+GSS  GLTA V++D  T ++ L+ G+LVL+D GICCIDEFDKM +S R+ +HEVMEQQT+SIAKAGI+  LNAR S+LAAANP   ++NP++T  +NI LP  LLSRFDL++L+ D  D   D RLA H+  ++  +E           + A    L MA L+ Y+A   S   P + E     L+  Y+ MR   K GS   + ++  R L +LIR++ A ++++   +V+ IDV+EA RL  EA K S    R
Sbjct:  108 NVAACKENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNL----------YRQLISYP-QEVIPTFDMA-VNEIFFDRYPDSILEHQIQVRP-----------------------------FNALKTK---NMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCG----RCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSE-----------EQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMR---KIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPR 727          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 308.145 bits (788), Expect = 4.973e-92
Identity = 227/682 (33.28%), Postives = 350/682 (51.32%), Query Frame = 1
Query:   34 NYESDKDKFKNFIENFYEETS--------DSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPL-LNTGMRTLNRGLVTELFLDA-HFINRITKDES--DDLGETIPATEAELEKLKD----PEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXT---KIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTS-ARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLL-EASKASVKSDR 2016
            N  + K+ F+ F++ F +  +        D  + +Y +++  I+   +  + ++ + I  FD  L          Y++LI Y   E+I     A VN+  FD + D  L+ +  +R                              F A KT    ++RN+  +++  +I +  +VIR + + P M+ A + C  C   T  E+    +     C     +  T   + L    S +   Q I++QE  + +P G  P ++ +         VQPGD V +TG++  + +    R  N   V +  +D  H+     K     D+  E    +E  +E LK+    P++Y  +A ++AP I+ HED+KKG+L+ + GG   D + T   K R  +NI L GDPG +KSQLL +V  L PR QYT+G+GSS  GLTA V++D  T ++ L+ G+LVL+D GICCIDEFDKM +S R+ +HEVMEQQT+SIAKAGI+  LNAR S+LAAANP   ++NP++T  +NI LP  LLSRFDL++L+ D  D   D RLA H+  ++  +E           + A    L MA L+ Y+A   S   P + E     L+  Y+ MR   K GS   + ++  R L +LIR++ A ++++   +V+ IDV+EA RL  EA K S    R
Sbjct:  158 NVAACKENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNL----------YRQLISYP-QEVIPTFDMA-VNEIFFDRYPDSILEHQIQVRP-----------------------------FNALKTK---NMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVC----GRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSE-----------EQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMR---KIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPR 777          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Celegans
Match: mcm-7 (DNA replication licensing factor MCM7 [Source:UniProtKB/TrEMBL;Acc:O16297])

HSP 1 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 325/729 (44.58%), Postives = 478/729 (65.57%), Query Frame = 1
Query:   25 FMRNYESDKDKFKNFIENFYEETSDS--KKFIYREQVLNISKQEQQAIYISLDDINEFDS----ELAEVIEKNGFRYQKLICYAIDEIIH---GMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTA-GRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLK-DPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGL-AADSSTVRMADISKKCVSMGFTPDQINEVIDSY 2175
            +  ++ ++K K ++F + +Y +  D   K F YR+QV  I+++++QAI +++D I E D     EL+E I  N  RY+ L    I ++I    G  +A V   A D ++   L +++N   +AN   + ++++D R K+P +LL+R+E YF     +    +RN+ + E+G ++ +K VVIRAT VKP +++ TYTCD C +E +Q +      P + C N+ C    A GRLH+Q +GSK+VK QE++IQE+S+QVP+G+IPR+M VH  G  TR    G+ V ++GVFLP++ +G R    GLV + +L+AH+IN +     DD         AELE L+   + Y  +A SIAPEIFGH DVKK LL+ + GG    + G KIRG +N+ +MGDPGVAKSQLLG+V+RL PRSQYT GRGSSG GLTA+V++D +TGEM+LE G+LVLADGGICCIDEFDKM D DRTAIHEVMEQQTISIAKAGIMTTLNAR +I+AAANPAYGRYNP R+IEQN+DLPAALLSRFDL+ L+QDK DR+ D  LA+HI+YVH +   P         +   L  +S+  LR Y+++ ++   P V   L   +V  Y+ MR++++  S +  F S R +L ++R++TA ++++  T VD  DV+EA+RL++ +K S++ ++ +   R+   +  +  +R L  AD++ + +++  ++C   G +   + + +D Y
Sbjct:    6 YNTDWAAEKTKIRSFFDEYYVDNEDGSGKAFPYRDQVFEIARRDKQAIVVNVDHIKESDIPDALELSEAITSNTKRYEVLFKDTISDMIQDYLGDKQAPV-IDALDAYMFQRLHMDRN-EGAAN---EEVSLQDKRKKYPPQLLQRFEVYFTTDDAAHETCVRNIKATEIGHLVSMKGVVIRATEVKPCVEVMTYTCDTCAAEVYQPVKGMQFTPPVNCPNKECVEAKANGRLHMQLRGSKFVKFQELKIQELSEQVPVGSIPRTMTVHVYGEMTRKCNTGNVVHVSGVFLPIMQSGFRPTG-GLVADTYLEAHYINNL-----DDNPTFNGVQSAELEVLRRKGDNYETLAASIAPEIFGHVDVKKCLLMALVGGNDNSSNGMKIRGCINVLMMGDPGVAKSQLLGYVNRLAPRSQYTTGRGSSGVGLTAAVMKDPVTGEMSLEGGALVLADGGICCIDEFDKMMDHDRTAIHEVMEQQTISIAKAGIMTTLNARTAIIAAANPAYGRYNPNRSIEQNVDLPAALLSRFDLILLMQDKADRENDKILAEHITYVHQHGCHPNR-------EKKDL--ISLETLREYISLCKTYT-PTVDPALRERIVEAYVEMRRDARYSS-DPTFVSPRMILGIVRMATARAKLRLSTIVDESDVEEALRLMQFAKDSLRPEQNKIEKRMAPVDAAFAVLRELYHADNAPIAISNAIQRCARKGISEVALKKCLDQY 712          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Celegans
Match: mcm-4 (DNA replication licensing factor mcm-4 [Source:UniProtKB/Swiss-Prot;Acc:Q95XQ8])

HSP 1 Score: 322.783 bits (826), Expect = 3.231e-98
Identity = 227/643 (35.30%), Postives = 329/643 (51.17%), Query Frame = 1
Query:  115 YREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRT--LNRGL--VTELFLDA-HFINRITKDESDDLGETIPATEAELEKL----KDPEMYSLMARSIAPEIFGHEDVKKGLL---XXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTS-ARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLL-EASKAS 2001
            Y E++L  +  E   I ++L  +N F   L          Y+K+I Y  D I +            DI ++       N                 RT   S  LR + A        K  ++R +   ++  +I +  +V R + + P M+   + C  C      E+    +   + CTN            L    S ++  Q +++QE  D +P G  P +++V+  G+    VQPGD + +TG+F     TGM+     R L  V    +DA HF    T     D GETI  TE  ++++    K P++   +A+SIAP I+ H+DVK+GLL                TK+R  +NI L GDPG +KSQ+L +V RL PRSQYT+G+GSS  GLTASV RD  T ++ L+ G+LVLAD G+CCIDEFDKM +S R+ +HEVMEQQT+SIAKAGI+  LNARAS+LAAANP   ++N  +TI +NI LP  LLSRFDL++LI D  D   D RL  H+  ++  N+          G+      + M  LR Y+A  ++   P + E    +++  Y+ MR   KAG++    T+  R L +LIR+S A ++I+   EV   DV++A  L  EA K S
Sbjct:  157 YMERLLECNDAEVTHINLNLKHLNAFSEAL----------YRKVIAYPADVIPY-----------LDIVVNEVFAERFN-----------------RTLAQSIELRPFNA-------QKTRNMRGLNPNDVDQLITISGMVTRTSSLIPEMRSGYFQCAVCAFGIESEVDKGRIEEPVVCTN----CSNTHCFQLVHNRSVFLDKQVVKLQESPDDMPSGETPHTVSVYAHGSLVESVQPGDRITVTGIFRA---TGMKVNPKQRALASVYRTSIDALHFRKMDTSRLHQDNGETI--TEERIQQIIELSKRPDIMDALAQSIAPSIYEHDDVKRGLLCLLFGGTRKDDETTNKTKLRSEINILLCGDPGTSKSQMLQYVYRLLPRSQYTSGKGSSAVGLTASVSRDADTKQLVLQTGALVLADNGVCCIDEFDKMNESARSVLHEVMEQQTLSIAKAGIICQLNARASVLAAANPVDSKWNRNKTIVENITLPHTLLSRFDLIFLIVDAQDEMQDRRLGNHLVSLYFEND----------GNQEKTEHVDMNLLRDYIAYAKANIHPKLSEEASQFIIEKYLFMR---KAGAQHGQITAYPRQLESLIRLSEAHAKIRLSQEVSVDDVEKAFTLWREALKQS 732          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Celegans
Match: mcm-4 (DNA replication licensing factor mcm-4 [Source:UniProtKB/Swiss-Prot;Acc:Q95XQ8])

HSP 1 Score: 322.783 bits (826), Expect = 3.231e-98
Identity = 227/643 (35.30%), Postives = 329/643 (51.17%), Query Frame = 1
Query:  115 YREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRT--LNRGL--VTELFLDA-HFINRITKDESDDLGETIPATEAELEKL----KDPEMYSLMARSIAPEIFGHEDVKKGLL---XXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTS-ARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLL-EASKAS 2001
            Y E++L  +  E   I ++L  +N F   L          Y+K+I Y  D I +            DI ++       N                 RT   S  LR + A        K  ++R +   ++  +I +  +V R + + P M+   + C  C      E+    +   + CTN            L    S ++  Q +++QE  D +P G  P +++V+  G+    VQPGD + +TG+F     TGM+     R L  V    +DA HF    T     D GETI  TE  ++++    K P++   +A+SIAP I+ H+DVK+GLL                TK+R  +NI L GDPG +KSQ+L +V RL PRSQYT+G+GSS  GLTASV RD  T ++ L+ G+LVLAD G+CCIDEFDKM +S R+ +HEVMEQQT+SIAKAGI+  LNARAS+LAAANP   ++N  +TI +NI LP  LLSRFDL++LI D  D   D RL  H+  ++  N+          G+      + M  LR Y+A  ++   P + E    +++  Y+ MR   KAG++    T+  R L +LIR+S A ++I+   EV   DV++A  L  EA K S
Sbjct:  157 YMERLLECNDAEVTHINLNLKHLNAFSEAL----------YRKVIAYPADVIPY-----------LDIVVNEVFAERFN-----------------RTLAQSIELRPFNA-------QKTRNMRGLNPNDVDQLITISGMVTRTSSLIPEMRSGYFQCAVCAFGIESEVDKGRIEEPVVCTN----CSNTHCFQLVHNRSVFLDKQVVKLQESPDDMPSGETPHTVSVYAHGSLVESVQPGDRITVTGIFRA---TGMKVNPKQRALASVYRTSIDALHFRKMDTSRLHQDNGETI--TEERIQQIIELSKRPDIMDALAQSIAPSIYEHDDVKRGLLCLLFGGTRKDDETTNKTKLRSEINILLCGDPGTSKSQMLQYVYRLLPRSQYTSGKGSSAVGLTASVSRDADTKQLVLQTGALVLADNGVCCIDEFDKMNESARSVLHEVMEQQTLSIAKAGIICQLNARASVLAAANPVDSKWNRNKTIVENITLPHTLLSRFDLIFLIVDAQDEMQDRRLGNHLVSLYFEND----------GNQEKTEHVDMNLLRDYIAYAKANIHPKLSEEASQFIIEKYLFMR---KAGAQHGQITAYPRQLESLIRLSEAHAKIRLSQEVSVDDVEKAFTLWREALKQS 732          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Celegans
Match: mcm-3 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q9XVR7])

HSP 1 Score: 288.886 bits (738), Expect = 9.493e-86
Identity = 221/679 (32.55%), Postives = 345/679 (50.81%), Query Frame = 1
Query:   76 NFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLL-PLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRL---VQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAE-------LEKLKDPEMYSLMARSIAPEIFGHEDVKKGLL-XXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVH---TNNEAPPSVLTTAAG-----------------------DSAGLLP---LSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKE--SKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLL 1983
            NF +  +D+  F YR++++ +    +  + ++LD+I E   E AE           L+  ++ E+                   +CLQ         + +   +   D++    +     +E  F  R     ++ R + S  +G+++  + +V + + V+  +  + + C        ++  + T+L   +T  N   +      L  +   S Y   Q   IQE+ +  P G +PR+  V CV A+  L   V+PGD V I GVF  L N        G+ +  F     IN I         E IP  E +       + K ++P  + L+ARS+AP I GHE+ KK LL +++ G   I   G+++RG +N+ L+GDP VAKSQLL +V R+ PR+  T GRGSSG GLTA+V  D  +GE  LEAG++VLAD G+ CIDEFDKM+D DRTAIHEVMEQ  ++I+KAGI   LNAR S+LAAANP YGRYNP ++  +NI +  +LLSRFDL++++ D+ D D D  +A+H+  +H   T  EA  +VL    G                         AG+     L+M  +R+Y+ + RS   P + +    Y+   Y  +R    +K   + ++  +AR L  LIR+STA+++ +   +V+R D ++A  LL
Sbjct:   27 NFLDNQADT--FHYRQKIVKMMNDGESRLVMNLDEIREILPERAE----------GLLTQSVLEM-------------------NCLQ---------SALQMAINRSDVQAVVKTGFHVGFEGTFGERH----VNPRTLKSSYLGNLVCCEGIVTKCSTVRQKLLTSVHYCPATNKVLEKKFADFTMLDTAVTNNNYPTEDENKNPLETEFGHSVYKDHQTFTIQELPESAPAGQLPRA--VDCV-ADLDLADRVKPGDRVRIIGVFRVLPNK-----QNGVSSGSFRSIIIINHIQMLSK----EVIPNFEPQDVKDVRKISKSRNP--FELLARSLAPSICGHEETKKALLCLLLGGMEKILNNGSRLRGDINVLLIGDPSVAKSQLLRYVLRMAPRAITTTGRGSSGVGLTAAVTTDPDSGERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHAKLNARCSVLAAANPVYGRYNPFKSPMENIGMQDSLLSRFDLIFVLLDEHDADKDANVAEHVLKLHTYRTQGEADGTVLPMGGGVETISTINMETKKASSSIYEENTQWAGIQDTKILTMDFMRKYIHLARSV-QPKLTDEATEYISEVYADIRSFDITKTDQERTMPVTARQLETLIRLSTAIAKARFSKKVEREDTEKAYNLL 646          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Celegans
Match: mcm-2 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6])

HSP 1 Score: 290.426 bits (742), Expect = 9.700e-86
Identity = 210/661 (31.77%), Postives = 332/661 (50.23%), Query Frame = 1
Query:   55 KFKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRAT--VNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGS------ETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGL-LXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDS---------AGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLL 1983
            +FKNF+ +F+E  +   K+I  + + +++   ++++ +S  D+++ + E           Y   +  A +E++  M RA   V    +  +   C +I+         I Q    ED+R      +LR+                       +  +I+   VV  A+ + P + +  Y C  CG       +   E +  T+ P  +C  +       G   L  + + Y   Q I +QE  ++V  G +PRS +V  +G      +PGD + +TGV+    +  +       V    + A+ I    K  SD L  T    +A  E  +DP +   +  SIAP I+GH+DVK+ + L +  G A    A  ++RG +N+ L GDPG AKSQ L +   + PRS  T G+G+S  GLTA V R  +T E TLEAG++VLAD G+C IDEFDKM+D DRT+IHE MEQQ+ISI+KAGI+T+L+AR +++AA+NP  GRYNP RT  +N+DL   +LSRFD+L +I+D  D   D RLA+ +   H  +  P +      GD           G+  +    LR+Y+   R +  P +PE         +  MRKES A    S+  + R + ++IR+S A +++  ++ V+  D   AIR++
Sbjct:  171 RFKNFLRSFHEPGNKQTKYI--QMIKSMAADNRESLEVSFTDLSDDNGE-------QNISY--FLPEAPNEMLAIMDRAATEVVMNMYPFYSRVCNEIKVR-------ISQLPVEEDIR------MLRQVH---------------------LNMLIRTAGVVTIASGILPQLAVVKYDCVACGYLLGPFVQQNDEEVRPTICP--SCQGK-------GPFELNVENTVYHNYQRITMQESPNKVAAGRLPRSKDVILLGDLCDSCKPGDEIEVTGVYTNNFDGSLNYKQGFPVFNTLIHANHITNKDKMASDQL--TDEDIKAIRELSQDPNISQRVFSSIAPSIYGHDDVKRAIALALFRGEAKNPGAKHRLRGDINVLLCGDPGTAKSQFLRYAAHIAPRSVLTTGQGASAVGLTAYVQRHPVTREWTLEAGAMVLADKGVCLIDEFDKMSDQDRTSIHEAMEQQSISISKAGIVTSLHARCTVIAASNPIGGRYNPTRTFAENVDLTEPILSRFDVLCVIRDSVDSVEDERLAKFVVGNHRTHH-PDAKKIVKEGDELEEDQMDERTGVRLIPQDLLRKYIIYAREKCHPTLPEQHSEKFSNIFAQMRKESMATG--SVAITVRHVESMIRLSEAHAKLHLRSYVNDEDCAAAIRVM 772          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Fly
Match: Mcm7 (gene:FBgn0020633 transcript:FBtr0076585)

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 372/737 (50.47%), Postives = 511/737 (69.34%), Query Frame = 1
Query:   31 RNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVN-KTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAG-RLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRL-GYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            R+Y  D++  K F+  F +   D KK F+Y  Q++ ++ +EQ  I I LDD+ EF+  LAE +  N  RY  +    I E++    +  V+ K A D++I+H L +E   R+       P+   D R  FPSEL++R+E  F    T KA SIR V ++ +G ++ ++ +V R T VKP+M +ATYTCDRCGSET+Q + + +  P+  C ++ C++  AG RL+LQT+GSK+VK QE+++QE SDQVP+G+IPRSM + C G  TR+ QPGDH+ ++GVFLPL+ TG   + +GL++E FL AH I  I K++     +     E   E  +D + Y  +A S+APEI+GH DVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLLG++ RL  RSQYT GRGSSG GLTA+V++D LTGEMTLE G+LVLAD G+CCIDEFDKM D DRTAIHEVMEQQTISIAKAGIMTTLNAR SILAAANPA+GRYNPRRT+EQNI LPAALLSRFDLLWLIQDKPDRD DLRLA+HI+YVH++++ PP+ +            L M  +RRY+ + + + +P +P+ L +Y+VG Y+ +R+E++   K+  FTSAR+LL ++R+STAL+R++    V++ DV EA+RLLE SK S+      Q+  +    + I+  +R LA     V+++DI  +C + GF PDQ+++ ID YEELN+WQVN+GRT+I  +
Sbjct:    4 RDYAQDRESIKTFLSEFCKCDDDGKKEFVYGSQLVKLAHREQVLITIDLDDLAEFNESLAEAVVDNCRRYTSIFSDVIAELLPSYKQQEVHAKDALDVYIEHRLMMESRTRN-------PMEQRDERNSFPSELMKRFEVGFKPLSTEKAHSIREVKAQHIGKLVTVRGIVTRCTEVKPMMVVATYTCDRCGSETYQPVNSLSFTPVHDCPSDDCRVNKAGGRLYLQTRGSKFVKFQEVKMQEHSDQVPVGHIPRSMTIMCRGEVTRMAQPGDHIVVSGVFLPLMRTGFAQMIQGLLSETFLQAHRIICINKNDEISDKDAELTPEELEELAQD-DFYERLATSLAPEIYGHLDVKKALLLLLVGGVDKRPDGMKIRGNINICLMGDPGVAKSQLLGYISRLAVRSQYTTGRGSSGVGLTAAVMKDPLTGEMTLEGGALVLADQGVCCIDEFDKMADQDRTAIHEVMEQQTISIAKAGIMTTLNARVSILAAANPAFGRYNPRRTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAKHITYVHSHSKQPPTRVKA----------LDMNLMRRYINLCKRK-NPTIPDELTDYIVGAYVELRREAR-NQKDMTFTSARNLLGILRLSTALARLRLSDSVEKDDVAEALRLLEMSKDSLNQIHEHQKGHVPNTSDRIFAIVRELAGSGKAVKISDIMDRCTTKGFKPDQVDKCIDDYEELNVWQVNMGRTKITFM 720          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Fly
Match: dpa (gene:FBgn0015929 transcript:FBtr0345797)

HSP 1 Score: 321.242 bits (822), Expect = 4.301e-97
Identity = 220/666 (33.03%), Postives = 341/666 (51.20%), Query Frame = 1
Query:   49 KDKFKNFIENFYE---------ETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVF--LPLLNTGMRTLNRGLVTELFLDAHF----INRITKDESDDLGETIPATEAELEKL--KDPEMYSLMARSIAPEIFGHEDVKKGLLXXX---XXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHIS--YVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRL 1980
            K KFK+FI  F +         E  D  + +Y +++  I   E+  + ++   +  FD +L          Y++LICY   E+I G   A +N+  F+                               ++P+ LL  ++         K  ++R++  ++M  +I +  +VIR++ V P M+ A ++C+ C   T  E+    +     CTN  C      RL +  + S++   Q +++QE  D +  G  P ++ ++        VQPGD V +TG++   PL   G+ +  + +        HF      R+ +DE +      P    EL +L  K P++Y  +AR+IAP I+ ++D+KKG+L+ +                R  +++ L GDPG +KSQ+L +V  L PRSQYT+GRGSS  GLTA V +D  T ++ L+ G+LVLAD G+CCIDEFDKM DS R+ +HEVMEQQT+SIAKAGI+  LNAR SILAAANPA  ++N R+ I  N+ LP  LLSRFDL++L+ D  D   D RLA H+   Y  T +E   ++               M+ LR Y+A  R    P + +     L+  Y+ MRK      + S +   R L +LIR+S A ++++   +V+ +DV+EA RL
Sbjct:  165 KSKFKSFIMRFIDPSAEQDEISENIDVNQPLYLQKLEEIHTLEEPYLNLNCAHLKTFDQDL----------YRQLICYP-QEVIPGFDMA-INEMFFE-------------------------------RYPAALLE-HQIQVRPFNADKTRNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICSFSTTVEVDRGRINQPTLCTN--CNTNHCFRL-IHNR-SEFTDKQLVKLQESPDDMAAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATPLKTGGLSSSVKSVYKTHVDVVHFRKVDNKRLYEDE-EGKDHIFPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGRQNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLYYVTRHEEEDTM-------------FDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGRGQISAY--PRQLESLIRLSEAHAKVRLSNQVELLDVEEAWRL 766          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Fly
Match: dpa (gene:FBgn0015929 transcript:FBtr0088982)

HSP 1 Score: 321.242 bits (822), Expect = 4.301e-97
Identity = 220/666 (33.03%), Postives = 341/666 (51.20%), Query Frame = 1
Query:   49 KDKFKNFIENFYE---------ETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVF--LPLLNTGMRTLNRGLVTELFLDAHF----INRITKDESDDLGETIPATEAELEKL--KDPEMYSLMARSIAPEIFGHEDVKKGLLXXX---XXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHIS--YVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRL 1980
            K KFK+FI  F +         E  D  + +Y +++  I   E+  + ++   +  FD +L          Y++LICY   E+I G   A +N+  F+                               ++P+ LL  ++         K  ++R++  ++M  +I +  +VIR++ V P M+ A ++C+ C   T  E+    +     CTN  C      RL +  + S++   Q +++QE  D +  G  P ++ ++        VQPGD V +TG++   PL   G+ +  + +        HF      R+ +DE +      P    EL +L  K P++Y  +AR+IAP I+ ++D+KKG+L+ +                R  +++ L GDPG +KSQ+L +V  L PRSQYT+GRGSS  GLTA V +D  T ++ L+ G+LVLAD G+CCIDEFDKM DS R+ +HEVMEQQT+SIAKAGI+  LNAR SILAAANPA  ++N R+ I  N+ LP  LLSRFDL++L+ D  D   D RLA H+   Y  T +E   ++               M+ LR Y+A  R    P + +     L+  Y+ MRK      + S +   R L +LIR+S A ++++   +V+ +DV+EA RL
Sbjct:  165 KSKFKSFIMRFIDPSAEQDEISENIDVNQPLYLQKLEEIHTLEEPYLNLNCAHLKTFDQDL----------YRQLICYP-QEVIPGFDMA-INEMFFE-------------------------------RYPAALLE-HQIQVRPFNADKTRNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICSFSTTVEVDRGRINQPTLCTN--CNTNHCFRL-IHNR-SEFTDKQLVKLQESPDDMAAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATPLKTGGLSSSVKSVYKTHVDVVHFRKVDNKRLYEDE-EGKDHIFPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGRQNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLYYVTRHEEEDTM-------------FDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGRGQISAY--PRQLESLIRLSEAHAKVRLSNQVELLDVEEAWRL 766          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Fly
Match: Mcm6 (gene:FBgn0025815 transcript:FBtr0070952)

HSP 1 Score: 282.337 bits (721), Expect = 3.366e-83
Identity = 208/687 (30.28%), Postives = 325/687 (47.31%), Query Frame = 1
Query:   58 FKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITG--VFLP----LLNTGMRTLNR-------------GL----VTELFLDAHFINRITKDESDDLGET-IPATE------------AELEKL----KDPEMYSLMARSIAPEIFGHEDVKKG-LLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIF-TSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEAS 1992
            F++F+E F E+     +  Y     ++   ++  + +S +D+ ++D  LA  I +  +     +C ++   +         K  +  F                            T+ P+    R++             +R++ + ++G++I++   V+R   V P +    + C  C +E               C N VC      R  L  + S ++  Q+IRIQE   ++P G IPR++ +         VQ GD    TG  + +P    L   G R  N              GL    + EL     F+    +  +   G T +P +E            AE  K+    KD  +Y  +  S+ P I+G+++VK+G LL    G A      T +RG +N+C++GDP  AKSQ L  V    PR+ YT+G+ SS AGLTA+VVRD+ + +  +EAG+L+LAD GICCIDEFDKM   D+ AIHE MEQQTISIA+AG+  TLNAR SILAAANP  GRY+  ++++QNI L A ++SRFDL +++ D+ +   D  +A+ I  +H+N E       T              E+ RY+   R Q  P + +   + LV  Y  +R+     S  S +  + R L ++IR+S A+++++C   V    V EA RLL  S
Sbjct:   25 FQDFLEEFKED----GEIKYTRPAASLESPDRCTLEVSFEDVEKYDQNLATAIIEEYYHIYPFLCQSVSNYVKDRIGLKTQKDCYVAF----------------------------TEVPT----RHK-------------VRDLTTSKIGTLIRISGQVVRTHPVHPELVSGVFMCLDCQTEIRNVEQQFKFTNPTICRNPVC--SNRKRFMLDVEKSLFLDFQKIRIQETQAELPRGCIPRAVEIILRSELVETVQAGDRYDFTGTLIVVPDVSVLAGVGTRAENSSRHKPGEGMDGVTGLKALGMRELNYRMAFLACSVQATTARFGGTDLPMSEVTAEDMKKQMTDAEWHKIYEMSKDRNLYQNLISSLFPSIYGNDEVKRGILLQQFGGVAKTTTEKTSLRGDINVCIVGDPSTAKSQFLKQVSDFSPRAIYTSGKASSAAGLTAAVVRDEESFDFVIEAGALMLADNGICCIDEFDKMDQRDQVAIHEAMEQQTISIARAGVRATLNARTSILAAANPINGRYDRSKSLQQNIQLSAPIMSRFDLFFILVDECNEVVDYAIARKIVDLHSNIEESVERAYT------------REEVLRYVTFAR-QFKPVISQEAGHMLVENYGHLRQRDTGTSGRSTWRITVRQLESMIRLSEAMAKLECSNRVLERHVKEAFRLLNKS 647          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Fly
Match: Mcm5 (gene:FBgn0017577 transcript:FBtr0082279)

HSP 1 Score: 276.174 bits (705), Expect = 1.621e-81
Identity = 192/539 (35.62%), Postives = 291/539 (53.99%), Query Frame = 1
Query:  478 SIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLT--CTNEVCKIGTAGR-------LHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVF------LPLLNTGMRTLNRGL------VTELFLD---AHFINRITKDESDDLGETIPATEAELEKLK-DPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIR-GSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVH-TNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKE-------SIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEAS 1992
            +IR + S  +  ++K+  +++ A+ +       +  C  C +     I N  + P L        C    AGR         +     K V  Q +++QE+ D VP G IPR + + C  +    V PG+ V I G++       P    G      G+      V  + +D   A  I+R +   SD+        E    ++    ++Y  +++S+AP IFG  D+KK +  M+ GG+         R G +N+ L+GDPG AKSQLL FV+++ P + YT+G+GSS AGLTASV++D  T    +E G++VLADGG+ CIDEFDKM + DR AIHE MEQQTISIAKAGI TTLN+R S+LAAAN  +GR++  +  E+NID    +LSRFD++++++D  D   D+ LA+HI  VH ++N++ PS    A G+      +S++  ++Y+   R+   P + E     L   Y+ MR  S AG +E       SI  + R L A+IRIS +L++I+ Q       V+EA+RL + S
Sbjct:  131 NIRQLKSDCVSKLVKIAGIIVAASGISAKATRMSIQCLSCSTV----IPNLKVNPGLEGYALPRKCNTEQAGRPKCPLDPFFIMPDKCKCVDFQTLKLQELPDFVPQGEIPRHLQLFCDRSLCERVVPGNRVLIQGIYSIRKVGKPSRRDGREKAVVGVRAPYMRVVGITVDSEGAGAISRYSNITSDE--------EEHFRRMAASGDIYERLSQSLAPSIFGSRDIKKAITCMLFGGSRKRLPDGLCRRGDINVLLLGDPGTAKSQLLKFVEKVAPIAVYTSGKGSSAAGLTASVMKDPQTRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSIFGRWDDTKG-EENIDFMPTILSRFDMIFIVKDIHDESRDITLAKHIINVHLSSNKSAPS--EPAEGE------ISLSTFKKYIHYCRTHCGPRLSEAAGEKLKSRYVLMR--SGAGQQEKASDKRLSIPITVRQLEAVIRISESLAKIRLQPFATDEHVNEALRLFQVS 646          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Zebrafish
Match: mcm7 (minichromosome maintenance complex component 7 [Source:ZFIN;Acc:ZDB-GENE-020419-27])

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 297/652 (45.55%), Postives = 420/652 (64.42%), Query Frame = 1
Query:  295 VNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQ----NIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSS--TVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            V K A D++I+H L +E   RD A+         D R ++P EL+RR+E YF    T K   +R+V +  +G ++ ++ +V RAT VKP+M +ATYTCD+CG+ET+Q I + +  PL+ C ++ C    + GRL+LQT+GSK++K QE+RIQE SDQVP+GNIPRSM ++  G NTR+ QPGDHV ++GVFLPLL +G R   +GL++E +L+ H I  + K E D+LG T   ++ EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V+RD +TGEMTLE G+LVLAD G+CCIDEFDKM D+DRTAIHEVMEQQTISIAK      ++   S      P+Y   + R  + Q     ++L +++    D                     S  H  N     V   A              +RRY++  + Q  P VPE+L +Y+   Y+ MRKE++  SK++ FTSAR+LL+++R+STAL+R++  + V++ DV+EA+RL+E SK S+++DR+         ++I+  +R L  +S+  +VR++   ++CVS GFTP Q    +  YEELN+WQ+N  RTRI  V
Sbjct:    3 VVKDALDVYIEHRLMMEVRGRDPAD-------TRDHRKQYPPELMRRFEVYFRPPATLKPRVVRDVKADSIGQLVTVRGIVTRATEVKPMMAVATYTCDQCGAETYQPIASPSFTPLIMCPSQECVTNKSGGRLYLQTRGSKFIKFQELRIQEHSDQVPVGNIPRSMTIYARGENTRVAQPGDHVAVSGVFLPLLRSGFRQAVQGLLSETYLECHSITLMNKTEDDELG-TEELSDEELRQITEEDFYEKLAGSIAPEIYGHEDVKKALLLLLVGGVEQAPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMRDPVTGEMTLEGGALVLADLGVCCIDEFDKMADADRTAIHEVMEQQTISIAK------VSPACSCPHPHCPSYMPGSSRVCVFQAGIMTVELSSSMHQEID---------------------SQNHLKNCMYLCVRACAC---------VCVRVRRYISKCK-QKQPVVPESLSDYITAAYVEMRKEARV-SKDTTFTSARTLLSILRLSTALARLRMVSVVEKEDVNEAMRLMEMSKDSLQADRSSSSRSQRPADVIFSLLRELCGESAGRSVRVSAAEQRCVSRGFTPAQFQAALQEYEELNVWQINQARTRITFV 608          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Zebrafish
Match: mcm7 (minichromosome maintenance complex component 7 [Source:ZFIN;Acc:ZDB-GENE-020419-27])

HSP 1 Score: 467.233 bits (1201), Expect = 7.876e-159
Identity = 231/404 (57.18%), Postives = 301/404 (74.50%), Query Frame = 1
Query:  295 VNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAAN 1503
            V K A D++I+H L +E   RD A+         D R ++P EL+RR+E YF    T K   +R+V +  +G ++ ++ +V RAT VKP+M +ATYTCD+CG+ET+Q I + +  PL+ C ++ C    + GRL+LQT+GSK++K QE+RIQE SDQVP+GNIPRSM ++  G NTR+ QPGDHV ++GVFLPLL +G R   +GL++E +L+ H I  + K E D+LG T   ++ EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V+RD +TGEMTLE G+LVLAD G+CCIDEFDKM D+DRTAIHEVMEQQTISIAKAGIMT+LNAR SILAAAN
Sbjct:    2 VVKDALDVYIEHRLMMEVRGRDPAD-------TRDHRKQYPPELMRRFEVYFRPPATLKPRVVRDVKADSIGQLVTVRGIVTRATEVKPMMAVATYTCDQCGAETYQPIASPSFTPLIMCPSQECVTNKSGGRLYLQTRGSKFIKFQELRIQEHSDQVPVGNIPRSMTIYARGENTRVAQPGDHVAVSGVFLPLLRSGFRQAVQGLLSETYLECHSITLMNKTEDDELG-TEELSDEELRQITEEDFYEKLAGSIAPEIYGHEDVKKALLLLLVGGVEQAPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMRDPVTGEMTLEGGALVLADLGVCCIDEFDKMADADRTAIHEVMEQQTISIAKAGIMTSLNARCSILAAAN 397          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Zebrafish
Match: mcm4 (minichromosome maintenance complex component 4 [Source:ZFIN;Acc:ZDB-GENE-030131-9544])

HSP 1 Score: 320.472 bits (820), Expect = 6.090e-97
Identity = 236/681 (34.65%), Postives = 355/681 (52.13%), Query Frame = 1
Query:   49 KDKFKNFIENFYEETS--------DSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVF--LPL-LNTGMRTLNRGLVTELFLDA-HFINRITKDES----DDLGETIPATEAELEKLKD----PEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXT---KIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTS-ARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLL-EASKASVKSDR 2016
            K+KF+ F++ F +  S        D  + +Y +++  IS   +  + ++   I  FD++L          Y++LICY   E+I      +VN+  FD F D  L+ +  +R                          Y A        K  ++RN+  +++  +I +  +VIR + + P M+ A + C  C   T  E+    +     C N  C   T   + L    S +   Q I++QE  + +P G  P +  V+        VQPGD V ITG++   P+ LN   R      V +  +DA HF  R T ++     D+ GE    T+  +  LK+    P++Y  ++ ++AP I+ HED+KKG+L+ + GG   D   T     R  +NI L GDPG +KSQLL +V  L PR QYT+G+GSS  GLTA V++D  T ++ L+ G+LVL+D GICCIDEFDKM+D+ R+ +HEVMEQQT+SIAKAGI+  LNAR SILAAANP   ++NP++T  +NI LP  LLSRFDL++L+ D  D   D RLA H+  ++  +E           +      L MA L+ Y+A  R+   P + E     L+  Y+ MR   K GS   + ++  R L +LIR++ A ++++   +V+ IDV+EA RL  EA K S    R
Sbjct:  145 KEKFQRFLQQFTDPDSREEENAGLDLNEPLYMQKLDEISVVGEPVLNVNCTHIQTFDADL----------YRQLICYP-QEVIPTFD-MSVNELFFDRFPDSVLEHQIQVRP-------------------------YSAI-------KTRNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFRCQVCAFNTRVEVDRGRIAEPAVCRN--C--NTTHSMALVHNRSVFSDKQMIKLQESPEDMPAGQTPHTTVVYAHNDLVDKVQPGDRVNITGIYRAAPMRLNP--RQSQVKSVYKTHIDAIHF--RKTDEKRLHGLDEDGEQKLFTKERVALLKELAAKPDVYERLSSALAPSIYEHEDIKKGILLQLFGGTRKDFTQTGRGNFRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSE-----------EQIEEEHLDMAVLKDYIAFARTTVHPRLSEEASQALIEAYVDMR---KIGSGRGMVSAYPRQLESLIRLAEAHAKVRFSGKVETIDVEEAKRLHREALKQSATDPR 759          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Zebrafish
Match: mcm6 (minichromosome maintenance complex component 6 [Source:ZFIN;Acc:ZDB-GENE-030909-6])

HSP 1 Score: 310.071 bits (793), Expect = 3.475e-93
Identity = 222/696 (31.90%), Postives = 339/696 (48.71%), Query Frame = 1
Query:   58 FKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRC-GSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITG--VFLPLL-----------------------NTGMRTLNRGLVTEL-----FLDAH-------FINRITKDE---SDDLGETIPATEAE--LEKLKDPEMYSLMARSIAPEIFGHEDVKKG-LLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIF-TSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKS 2010
            F+ F+E F     + K     E+++   + E+  + +S  D+  F+ ELA  I++  +R    +C A+       G    +K  +  F                        +DL T+                       IR + + ++GS++++   V+R   V P +   T+ C  C G     E   K   P + C N VC      R  L T  SK++  Q++RIQE   ++P G+IPRSM V          Q GD     G  + +P +                       N G+R L    V EL     FL  H       F  +  +DE   ++ + + +   E E   E  +D  +Y  +  S+ P I G+++VK+G LL++  G       GT +RG +N+C++GDP  AKSQ L  V+  CPR+ YT+G+ SS AGLTA+VVRD+ + E  +EAG+L+LAD G+CCIDEFDKM   D+ AIHE MEQQTISI KAG+  TLNAR SILAAANP  GRY+  ++++QN++L A ++SRFDL +++ D  +   D  +A+ I  +H+  E     +             S+ E+RRYL   R Q  P + +    ++V  Y  +R+   +G  +S +  + R L +LIR+S +++R+ C  EV    V EA RLL  S   V++
Sbjct:   28 FQAFLEEFQNSDGEVKYLRDAEELI---RPERNTLAVSFTDLEGFNQELATAIQEEFYRLYPYLCRAVRNFARDHGEVPTSKEFYVAF------------------------QDLPTRH---------------------KIRELTTVKVGSLVRISGQVVRTHPVHPELVSGTFLCLDCQGVIKDVEQQFKYTQPSI-CRNPVC--NNRRRFLLDTNKSKFIDFQKVRIQETQAELPRGSIPRSMEVILRAEAVESAQAGDKCDFIGSLIVVPDISQLATPGVRAETSSRTAGVQGYENEGLRGLKALGVRELSYKLAFLACHVAPTNPRFGGKEIRDEEQTAESIKKQMSVQEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDINVCVVGDPSTAKSQFLKHVEEFCPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMETRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVSGRYDRSKSLKQNVNLTAPIMSRFDLFFILVDDCNEVTDYAIARRIVDLHSRIENSVDRV------------YSLDEIRRYLLFAR-QFKPKISKESEEFIVEQYKRLRQRDGSGVTKSAWRITVRQLESLIRLSESMARMHCCDEVQPKHVKEAFRLLNKSIIRVET 659          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Zebrafish
Match: mcm5 (minichromosome maintenance complex component 5 [Source:ZFIN;Acc:ZDB-GENE-021209-1])

HSP 1 Score: 295.819 bits (756), Expect = 1.223e-88
Identity = 218/675 (32.30%), Postives = 336/675 (49.78%), Query Frame = 1
Query:   49 KDKFKNFIENFYEETSDSK-KFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRC-GSETFQEILNKTLLPLLT--CTNEVCKIGTAGRLHLQTKGSKY---------VKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDD------LGETIPATEAELEKLK-DPEMYSLMARSIAPEIFGHEDVKKGL--LXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKE-----SIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEAS 1992
            K KF+ F+  F   T  +   + YR+++       +  I + ++D+  FD +L++ + K       L+  A  E+   + R                            +G+  T++D++    S+              +   SIR++ S+++  ++K+  ++I +T V+     AT  C +C G      I N  L P L        C    AGR+        Y         V  Q  R+QE  D VP G +PR M ++C       V PG+ V + G++        +   R   T + + + ++  +  D   +       G   P  E EL  L   P +Y  +ARS+AP I+G +D+KK +  L+       +    T+ RG +N+ ++GDPG AKSQLL FV+R  P   YT+G+GSS AGLTASV+RD  T    +E G++VLADGG+ CIDEFDKM + DR AIHE MEQQTISIAKAGI TTLN+R S+LAAAN  +GR++  +  E NID    +LSRFD++++I+D  D+  D+ LA+H+  VH + +       T      G +PL  A L++Y+A  R +  P +       L   Y+ MR  +K   +E     SI  + R L A++RI+ +L+++K Q      +VDEA+RL + S
Sbjct:   33 KKKFREFLRQFRVGTDRTGFTYKYRDELKRHYTLGEYWIEVEMEDLASFDEDLSDCLYKLPAENLPLLEEAAQEVADEVTRP-------------------------RPVGEE-TVQDIQVMLKSD--------------AHPASIRSLKSEQVSRLVKIPGIIISSTAVRAK---ATRVCLQCRGCRAV--ISNIPLPPGLQGYALPRKCNTEQAGRVKCPV--DPYFIIPDRCVCVDFQTQRLQEAPDAVPHGEMPRHMQLYCDRYLCDRVVPGNRVTVMGIYSIKKVAQTKAKGRDKGTGVGIRSAYLRVVGIDVDTEGAGRGATGSVSPQEEEELRSLAASPSVYDSLARSLAPSIYGSDDLKKAIACLLFGGSRKRLPDGLTR-RGDINLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVLRDPTTRGFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDDTKG-EDNIDFMPTILSRFDMIFIIKDHHDQQRDMTLARHVMNVHLSAQ-------TQTEGVEGEIPL--ATLKKYIAYSRVKCGPRLSAAAAEKLKNRYVLMRSGAKEHERETDRRVSIPITVRQLEAVVRIAESLAKMKLQPIAGEEEVDEALRLFQVS 649          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Xenopus
Match: trib1 (tribbles pseudokinase 1 [Source:Xenbase;Acc:XB-GENE-956608])

HSP 1 Score: 760.755 bits (1963), Expect = 0.000e+0
Identity = 386/738 (52.30%), Postives = 529/738 (71.68%), Query Frame = 1
Query:   31 RNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMG-RATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAAD--SSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            R+Y+++K+K K F++ FY++    KK F Y  Q+ NI+ +EQ A+YI LDD+ E D EL + I +N  RY  L   A+ E++     R  V+K A D++I+H L +EQ  RD       P    D   ++P EL+RR+E YF A  +SKA  +R+V +  +G ++ ++ +V R T VKP+M +ATYTCD+CG+ET+Q I + T +PL+ C +  C+   + GRL+LQT+GSK++K QE++IQE SDQVP+GNIPR M+V+  G NTRL QPGDHV ITGVFLP+L TG R + +GL++E +L++H + ++ K E D+LG T   +E EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V++D +TGEMTLE G+LVLAD G+CCIDEFDKM D+DRTAIHEVMEQQTISIAKAGIMTTLNAR SILAAANPAYGRYNP++T+EQNI LPAALLSRFDLLWLIQDKPDRD DLRLAQHI+YVH +++ PPS             PL M  +RRY+ + + +  PA+PE+L +YL   Y+ MRKE++  +K+  FTSAR+LL+++R+STAL+R++ +  V++ DV+EA+RL E SK S+  D+ +        ++I+  IR +  +  + +V+ ++  ++ VS GFTP Q    ++ YEELN+W VN  RT+I  V
Sbjct:    3 RDYQAEKEKCKTFLQEFYKDDELGKKNFKYGVQLANIAHREQVALYIDLDDLAEEDPELVDAICENTRRYTNLFADAVQELLPQYKEREVVHKDALDVYIEHRLMMEQRGRD-------PSETRDPHNQYPPELMRRFELYFKAPSSSKARVVRDVKADSIGKLVTVRGIVTRVTEVKPMMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSRECQTNRSGGRLYLQTRGSKFIKFQELKIQEHSDQVPVGNIPRCMSVYVRGENTRLAQPGDHVSITGVFLPMLRTGFRQVVQGLLSETYLESHRLVKMNKTEDDELG-TEELSEEELRQITEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDNSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMKDPVTGEMTLEGGALVLADQGVCCIDEFDKMMDTDRTAIHEVMEQQTISIAKAGIMTTLNARCSILAAANPAYGRYNPKKTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAQHITYVHQHSKQPPSQFQ----------PLDMKLMRRYITMCKRK-QPAIPESLADYLTAAYVEMRKEART-NKDMTFTSARTLLSILRLSTALARLRLEDVVEKEDVNEAMRLTEMSKDSLLGDKGQTSRTQRPADVIFSTIREMVPEKGARSVKYSEAEQRAVSKGFTPAQFEAALEEYEELNVWLVNQARTKITFV 720          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Xenopus
Match: trib1 (tribbles pseudokinase 1 [Source:Xenbase;Acc:XB-GENE-956608])

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 385/738 (52.17%), Postives = 524/738 (71.00%), Query Frame = 1
Query:   31 RNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMG-RATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAAD--SSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            R Y   + K K F++ FY++    KK F Y  Q+ NI+ +EQ A+YI LDD+ E D EL + I +N  RY  L   A+ E++     R  V+K A D++I+H L +EQ  RD       P    D   ++P EL+RR+E YF A  +SKA  +R+V +  +G ++ ++ +V R T VKP+M +ATYTCD+CG+ET+Q I + T +PL+ C +  C+   + GRL+LQT+GSK++K QE++IQE SDQVP+GNIPR M+V+  G NTRL QPGDHV ITGVFLP+L TG R + +GL++E +L++H + ++ K E D+LG T   +E EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V++D +TGEMTLE G+LVLAD G+CCIDEFDKM D+DRTAIHEVMEQQTISIAKAGIMTTLNAR SILAAANPAYGRYNP++T+EQNI LPAALLSRFDLLWLIQDKPDRD DLRLAQHI+YVH +++ PPS             PL M  +RRY+ + + +  PA+PE+L +YL   Y+ MRKE++  +K+  FTSAR+LL+++R+STAL+R++ +  V++ DV+EA+RL E SK S+  D+ +        ++I+  IR +  +  + +V+ ++  ++ VS GFTP Q    ++ YEELN+W VN  RT+I  V
Sbjct:    4 RAYTLQEKKCKTFLQEFYKDDELGKKNFKYGVQLANIAHREQVALYIDLDDLAEEDPELVDAICENTRRYTNLFADAVQELLPQYKEREVVHKDALDVYIEHRLMMEQRGRD-------PSETRDPHNQYPPELMRRFELYFKAPSSSKARVVRDVKADSIGKLVTVRGIVTRVTEVKPMMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSRECQTNRSGGRLYLQTRGSKFIKFQELKIQEHSDQVPVGNIPRCMSVYVRGENTRLAQPGDHVSITGVFLPMLRTGFRQVVQGLLSETYLESHRLVKMNKTEDDELG-TEELSEEELRQITEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDNSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMKDPVTGEMTLEGGALVLADQGVCCIDEFDKMMDTDRTAIHEVMEQQTISIAKAGIMTTLNARCSILAAANPAYGRYNPKKTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAQHITYVHQHSKQPPSQFQ----------PLDMKLMRRYITMCKRK-QPAIPESLADYLTAAYVEMRKEART-NKDMTFTSARTLLSILRLSTALARLRLEDVVEKEDVNEAMRLTEMSKDSLLGDKGQTSRTQRPADVIFSTIREMVPEKGARSVKYSEAEQRAVSKGFTPAQFEAALEEYEELNVWLVNQARTKITFV 721          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Xenopus
Match: trib1 (tribbles pseudokinase 1 [Source:Xenbase;Acc:XB-GENE-956608])

HSP 1 Score: 752.666 bits (1942), Expect = 0.000e+0
Identity = 384/738 (52.03%), Postives = 525/738 (71.14%), Query Frame = 1
Query:   31 RNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMG-RATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAAD--SSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            ++  S + K K F++ FY++    KK F Y  Q+ NI+ +EQ A+YI LDD+ E D EL + I +N  RY  L   A+ E++     R  V+K A D++I+H L +EQ  RD       P    D   ++P EL+RR+E YF A  +SKA  +R+V +  +G ++ ++ +V R T VKP+M +ATYTCD+CG+ET+Q I + T +PL+ C +  C+   + GRL+LQT+GSK++K QE++IQE SDQVP+GNIPR M+V+  G NTRL QPGDHV ITGVFLP+L TG R + +GL++E +L++H + ++ K E D+LG T   +E EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V++D +TGEMTLE G+LVLAD G+CCIDEFDKM D+DRTAIHEVMEQQTISIAKAGIMTTLNAR SILAAANPAYGRYNP++T+EQNI LPAALLSRFDLLWLIQDKPDRD DLRLAQHI+YVH +++ PPS             PL M  +RRY+ + + +  PA+PE+L +YL   Y+ MRKE++  +K+  FTSAR+LL+++R+STAL+R++ +  V++ DV+EA+RL E SK S+  D+ +        ++I+  IR +  +  + +V+ ++  ++ VS GFTP Q    ++ YEELN+W VN  RT+I  V
Sbjct:    4 KSLHSTRKKCKTFLQEFYKDDELGKKNFKYGVQLANIAHREQVALYIDLDDLAEEDPELVDAICENTRRYTNLFADAVQELLPQYKEREVVHKDALDVYIEHRLMMEQRGRD-------PSETRDPHNQYPPELMRRFELYFKAPSSSKARVVRDVKADSIGKLVTVRGIVTRVTEVKPMMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSRECQTNRSGGRLYLQTRGSKFIKFQELKIQEHSDQVPVGNIPRCMSVYVRGENTRLAQPGDHVSITGVFLPMLRTGFRQVVQGLLSETYLESHRLVKMNKTEDDELG-TEELSEEELRQITEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDNSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMKDPVTGEMTLEGGALVLADQGVCCIDEFDKMMDTDRTAIHEVMEQQTISIAKAGIMTTLNARCSILAAANPAYGRYNPKKTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAQHITYVHQHSKQPPSQFQ----------PLDMKLMRRYITMCKRK-QPAIPESLADYLTAAYVEMRKEART-NKDMTFTSARTLLSILRLSTALARLRLEDVVEKEDVNEAMRLTEMSKDSLLGDKGQTSRTQRPADVIFSTIREMVPEKGARSVKYSEAEQRAVSKGFTPAQFEAALEEYEELNVWLVNQARTKITFV 721          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Xenopus
Match: trib1 (tribbles pseudokinase 1 [Source:Xenbase;Acc:XB-GENE-956608])

HSP 1 Score: 750.74 bits (1937), Expect = 0.000e+0
Identity = 383/730 (52.47%), Postives = 521/730 (71.37%), Query Frame = 1
Query:   55 KFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMG-RATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAAD--SSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            K K F++ FY++    KK F Y  Q+ NI+ +EQ A+YI LDD+ E D EL + I +N  RY  L   A+ E++     R  V+K A D++I+H L +EQ  RD       P    D   ++P EL+RR+E YF A  +SKA  +R+V +  +G ++ ++ +V R T VKP+M +ATYTCD+CG+ET+Q I + T +PL+ C +  C+   + GRL+LQT+GSK++K QE++IQE SDQVP+GNIPR M+V+  G NTRL QPGDHV ITGVFLP+L TG R + +GL++E +L++H + ++ K E D+LG T   +E EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V++D +TGEMTLE G+LVLAD G+CCIDEFDKM D+DRTAIHEVMEQQTISIAKAGIMTTLNAR SILAAANPAYGRYNP++T+EQNI LPAALLSRFDLLWLIQDKPDRD DLRLAQHI+YVH +++ PPS             PL M  +RRY+ + + +  PA+PE+L +YL   Y+ MRKE++  +K+  FTSAR+LL+++R+STAL+R++ +  V++ DV+EA+RL E SK S+  D+ +        ++I+  IR +  +  + +V+ ++  ++ VS GFTP Q    ++ YEELN+W VN  RT+I  V
Sbjct:   10 KCKTFLQEFYKDDELGKKNFKYGVQLANIAHREQVALYIDLDDLAEEDPELVDAICENTRRYTNLFADAVQELLPQYKEREVVHKDALDVYIEHRLMMEQRGRD-------PSETRDPHNQYPPELMRRFELYFKAPSSSKARVVRDVKADSIGKLVTVRGIVTRVTEVKPMMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSRECQTNRSGGRLYLQTRGSKFIKFQELKIQEHSDQVPVGNIPRCMSVYVRGENTRLAQPGDHVSITGVFLPMLRTGFRQVVQGLLSETYLESHRLVKMNKTEDDELG-TEELSEEELRQITEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDNSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMKDPVTGEMTLEGGALVLADQGVCCIDEFDKMMDTDRTAIHEVMEQQTISIAKAGIMTTLNARCSILAAANPAYGRYNPKKTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAQHITYVHQHSKQPPSQFQ----------PLDMKLMRRYITMCKRK-QPAIPESLADYLTAAYVEMRKEART-NKDMTFTSARTLLSILRLSTALARLRLEDVVEKEDVNEAMRLTEMSKDSLLGDKGQTSRTQRPADVIFSTIREMVPEKGARSVKYSEAEQRAVSKGFTPAQFEAALEEYEELNVWLVNQARTKITFV 719          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Xenopus
Match: trib1 (tribbles pseudokinase 1 [Source:Xenbase;Acc:XB-GENE-956608])

HSP 1 Score: 749.969 bits (1935), Expect = 0.000e+0
Identity = 383/730 (52.47%), Postives = 521/730 (71.37%), Query Frame = 1
Query:   55 KFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMG-RATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAAD--SSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            K K F++ FY++    KK F Y  Q+ NI+ +EQ A+YI LDD+ E D EL + I +N  RY  L   A+ E++     R  V+K A D++I+H L +EQ  RD       P    D   ++P EL+RR+E YF A  +SKA  +R+V +  +G ++ ++ +V R T VKP+M +ATYTCD+CG+ET+Q I + T +PL+ C +  C+   + GRL+LQT+GSK++K QE++IQE SDQVP+GNIPR M+V+  G NTRL QPGDHV ITGVFLP+L TG R + +GL++E +L++H + ++ K E D+LG T   +E EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V++D +TGEMTLE G+LVLAD G+CCIDEFDKM D+DRTAIHEVMEQQTISIAKAGIMTTLNAR SILAAANPAYGRYNP++T+EQNI LPAALLSRFDLLWLIQDKPDRD DLRLAQHI+YVH +++ PPS             PL M  +RRY+ + + +  PA+PE+L +YL   Y+ MRKE++  +K+  FTSAR+LL+++R+STAL+R++ +  V++ DV+EA+RL E SK S+  D+ +        ++I+  IR +  +  + +V+ ++  ++ VS GFTP Q    ++ YEELN+W VN  RT+I  V
Sbjct:   14 KCKTFLQEFYKDDELGKKNFKYGVQLANIAHREQVALYIDLDDLAEEDPELVDAICENTRRYTNLFADAVQELLPQYKEREVVHKDALDVYIEHRLMMEQRGRD-------PSETRDPHNQYPPELMRRFELYFKAPSSSKARVVRDVKADSIGKLVTVRGIVTRVTEVKPMMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSRECQTNRSGGRLYLQTRGSKFIKFQELKIQEHSDQVPVGNIPRCMSVYVRGENTRLAQPGDHVSITGVFLPMLRTGFRQVVQGLLSETYLESHRLVKMNKTEDDELG-TEELSEEELRQITEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDNSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMKDPVTGEMTLEGGALVLADQGVCCIDEFDKMMDTDRTAIHEVMEQQTISIAKAGIMTTLNARCSILAAANPAYGRYNPKKTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAQHITYVHQHSKQPPSQFQ----------PLDMKLMRRYITMCKRK-QPAIPESLADYLTAAYVEMRKEART-NKDMTFTSARTLLSILRLSTALARLRLEDVVEKEDVNEAMRLTEMSKDSLLGDKGQTSRTQRPADVIFSTIREMVPEKGARSVKYSEAEQRAVSKGFTPAQFEAALEEYEELNVWLVNQARTKITFV 723          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Mouse
Match: Mcm7 (minichromosome maintenance complex component 7 [Source:MGI Symbol;Acc:MGI:1298398])

HSP 1 Score: 764.222 bits (1972), Expect = 0.000e+0
Identity = 377/737 (51.15%), Postives = 527/737 (71.51%), Query Frame = 1
Query:   28 MRNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMG-RATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            +++Y  +K+K K F++ FY E    KK F Y  Q+++++ +EQ A+Y+ LDDI E D EL + I +N  RY +L    + E++     +  VNK   D++I+H L +EQ  RD       P  + + + ++PSEL+RR+E YF    +SK   IR V +  +G ++ ++ +V R + VKP M +ATYTCD+CG+ET+Q I + T +PL+ C ++ C+   + GRL+LQT+GSK+VK QE++IQE SDQVP+GNIPRS+ V   G NTR+ QPGDHV +TG+FLP+L TG + + +GL++E +L+AH+I ++TK + D  G    ++E EL+++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG+++ICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V+RD ++GE+TLE G+LVLAD G+CCIDEFDKM ++DRTAIHEVMEQQTISIAKAGI+TTLNAR SILAAANPAYGRYNPRR++EQN+ LPAALLSRFDLLWLIQD+PDRD DLRLAQHI+YVH ++  PP          A   PL M  +RRY+A+   +  P VPE+L +Y+   Y+ MR+E++A SK++ +TSAR+LLA++R+STAL+R++    V++ DV+EAIRL+E SK S+  ++ +        ++I+  IR L +   +V  ++  ++C+S GFTP Q    +D YEELN+WQVN  RTRI  V
Sbjct:    3 LKDYAIEKEKVKKFLQEFYYENELGKKQFKYGTQLVHLAHREQVALYVDLDDIAEDDPELVDSICENAKRYSRLFGDVVQELLPEYKEKEVVNKDVLDVYIEHRLMMEQRSRD-------PGAVRNPQNQYPSELMRRFELYFRGPSSSKPRVIREVRADSVGKLLTVRGIVTRVSEVKPRMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFVKFQEMKIQEHSDQVPVGNIPRSITVVLEGENTRIAQPGDHVSVTGIFLPVLRTGFQQMAQGLLSETYLEAHWIVKMTKSDDDVSGAGELSSE-ELKQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPQGMKIRGNIHICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNVQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPP----------AQFEPLDMKLMRRYIAMCHER-QPTVPESLADYITAAYVEMRREARA-SKDATYTSARTLLAILRLSTALARLRMVDIVEKEDVNEAIRLMEMSKDSLLGEKGQTARTQRPADVIFATIRELVSRGRSVHFSEAEQRCISRGFTPAQFQAALDEYEELNVWQVNTSRTRITFV 719          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Mouse
Match: Mcm4 (minichromosome maintenance complex component 4 [Source:MGI Symbol;Acc:MGI:103199])

HSP 1 Score: 308.145 bits (788), Expect = 3.491e-92
Identity = 228/682 (33.43%), Postives = 351/682 (51.47%), Query Frame = 1
Query:   34 NYESDKDKFKNFIENFYEETS--------DSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPL-LNTGMRTLNRGLVTELFLDA-HFINRITK--DESDDLGETIPATEAELEKLKD----PEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXT---KIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTS-ARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLL-EASKASVKSDR 2016
            N  + K+ F+ F++ F +  +        D  + +Y +Q+  I+   +  + ++ + I  F   L          Y++LI Y   E+I     A VN+  FD + D  L+ +  +R                              F A KT    S+RN+  +++  +I +  +VIR + + P M+ A + C  C   T  EI    +    +C +  C   T   + L    S +   Q I++QE  + +P G  P ++ +         VQPGD V +TG++  + +    R  N   V +  +D  H+     K     D+  E    +E  ++ LK+    P++Y  +A ++AP I+ HED+KKG+L+ + GG   D + T   K R  +NI L GDPG +KSQLL +V  L PR QYT+G+GSS  GLTA V++D  T ++ L+ G+LVL+D GICCIDEFDKM +S R+ +HEVMEQQT+SIAKAGI+  LNAR S+LAAANP   ++NP++T  +NI LP  LLSRFDL++L+ D  D   D RLA H+  ++  +E           +      L MA L+ Y+A   S   P + E     L+  Y++MR   K GS   + ++  R L +LIR++ A ++++   +V+ IDV+EA RL  EA K S    R
Sbjct:  157 NVATCKENFQRFLQCFTDPLAKEEENVGIDITQPLYMQQLGEINITGEPFLNVNCEHIKSFSKNL----------YRQLISYP-QEVIPTFDMA-VNEIFFDRYPDSILEHQIQVRP-----------------------------FNALKTK---SMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEIDRGRIAEPCSCVH--CH--TTHSMALIHNRSFFSDKQMIKLQESPEDMPAGQTPHTIVLFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVKLLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSE-----------EQVEEEFLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVNMR---KIGSSRGMVSAYPRQLESLIRLAEAHAKVRFSNKVEAIDVEEAKRLHREALKQSATDPR 776          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Mouse
Match: Mcm7 (minichromosome maintenance complex component 7 [Source:MGI Symbol;Acc:MGI:1298398])

HSP 1 Score: 285.804 bits (730), Expect = 8.878e-89
Identity = 142/335 (42.39%), Postives = 222/335 (66.27%), Query Frame = 1
Query:   28 MRNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMG-RATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKD 1023
            +++Y  +K+K K F++ FY E    KK F Y  Q+++++ +EQ A+Y+ LDDI E D EL + I +N  RY +L    + E++     +  VNK   D++I+H L +EQ  RD       P  + + + ++PSEL+RR+E YF    +SK   IR V +  +G ++ ++ +V R + VKP M +ATYTCD+CG+ET+Q I + T +PL+ C ++ C+   + GRL+LQT+GSK+VK QE++IQE SDQVP+GNIPRS+ V   G NTR+ QPGDHV +TG+FLP+L TG + + +GL++E +L+AH+I ++TK + D  G    ++E EL+++ D
Sbjct:    3 LKDYAIEKEKVKKFLQEFYYENELGKKQFKYGTQLVHLAHREQVALYVDLDDIAEDDPELVDSICENAKRYSRLFGDVVQELLPEYKEKEVVNKDVLDVYIEHRLMMEQRSRD-------PGAVRNPQNQYPSELMRRFELYFRGPSSSKPRVIREVRADSVGKLLTVRGIVTRVSEVKPRMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFVKFQEMKIQEHSDQVPVGNIPRSITVVLEGENTRIAQPGDHVSVTGIFLPVLRTGFQQMAQGLLSETYLEAHWIVKMTKSDDDVSGAGELSSE-ELKQIAD 329          

HSP 2 Score: 68.1662 bits (165), Expect = 1.520e-11
Identity = 27/61 (44.26%), Postives = 39/61 (63.93%), Query Frame = 1
Query: 2047 ELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            ++I+  IR L +   +V  ++  ++C+S GFTP Q    +D YEELN+WQVN  RTRI  V
Sbjct:  329 DVIFATIRELVSRGRSVHFSEAEQRCISRGFTPAQFQAALDEYEELNVWQVNTSRTRITFV 389          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Mouse
Match: Mcm6 (minichromosome maintenance complex component 6 [Source:MGI Symbol;Acc:MGI:1298227])

HSP 1 Score: 296.59 bits (758), Expect = 1.830e-88
Identity = 219/693 (31.60%), Postives = 338/693 (48.77%), Query Frame = 1
Query:   58 FKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGS---ETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPL-----LNT-----------------------GMRTLN-RGLVTEL-FLDAH-------FINRITKDESDDLGETIP--ATEAELEKL----KDPEMYSLMARSIAPEIFGHEDVKKG-LLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAG-SKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEAS 1992
            F +F+E F     + K   + E+++   + E+  + +S  D+ +F+ +L+  I++  +R    +C A+   +         K  +  F                        +DL T+                       IR + S  +G + ++   V+R   V P +   T+ C  C +   +  Q+   K   P + C N VC      R  L T  S++V  Q++RIQE   ++P G+IPRS+ V          Q GD    TG  + +     L+T                       G+R L  R L   L FL  H       F  +  +DE +   E+I    T  E EK+    +D  +Y  +  S+ P I G+++VK+G LL++  G       GT +RG +N+C++GDP  AKSQ L  VD   PR+ YT+G+ SS AGLTA+VVRD+ + E  +EAG+L+LAD G+CCIDEFDKM   D+ AIHE MEQQTISI KAG+  TLNAR SILAAANP  G Y+  ++++QNI+L A ++SRFDL +++ D+ +   D  +A+ I  +H+  E     +             S+ ++RRYL   R Q  P + +   +++V  Y  +R+   +G +K S   + R L ++IR+S +++R+ C  EV    V EA RLL  S
Sbjct:   30 FLDFLEEFQGSDGEIKYLQFAEELI---RPERNTLVVSFADLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPFAKDFYVAF------------------------QDLPTRH---------------------KIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIKDVEQQF--KYTQPNI-CRNPVC--ANRKRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDRCDFTGALIVVPDVSKLSTPGARAETNSRVSGADGYETEGIRGLRALGVRDLSYRLVFLACHVAPTNPRFGGKELRDE-EQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVDEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDMRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVSGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRIEESIDRV------------YSLDDIRRYLLFAR-QFKPKISKESEDFIVEQYKRLRQRDGSGVTKSSWRITVRQLESMIRLSESMARMHCCDEVQPKHVKEAFRLLNKS 655          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Mouse
Match: Mcm6 (minichromosome maintenance complex component 6 [Source:MGI Symbol;Acc:MGI:1298227])

HSP 1 Score: 296.59 bits (758), Expect = 3.203e-88
Identity = 218/699 (31.19%), Postives = 339/699 (48.50%), Query Frame = 1
Query:   58 FKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGS---ETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNT----------------------------GMRTLN-RGLVTEL-FLDAH-------FINRITKDESDDLGETIP--ATEAELEKL----KDPEMYSLMARSIAPEIFGHEDVKKG-LLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAG-SKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKS 2010
            F +F+E F     + K   + E+++   + E+  + +S  D+ +F+ +L+  I++  +R    +C A+   +         K  +  F                        +DL T+                       IR + S  +G + ++   V+R   V P +   T+ C  C +   +  Q+   K   P + C N VC      R  L T  S++V  Q++RIQE   ++P G+IPRS+ V          Q GD    TG  + + +                             G+R L  R L   L FL  H       F  +  +DE +   E+I    T  E EK+    +D  +Y  +  S+ P I G+++VK+G LL++  G       GT +RG +N+C++GDP  AKSQ L  VD   PR+ YT+G+ SS AGLTA+VVRD+ + E  +EAG+L+LAD G+CCIDEFDKM   D+ AIHE MEQQTISI KAG+  TLNAR SILAAANP  G Y+  ++++QNI+L A ++SRFDL +++ D+ +   D  +A+ I  +H+  E     +             S+ ++RRYL   R Q  P + +   +++V  Y  +R+   +G +K S   + R L ++IR+S +++R+ C  EV    V EA RLL  S   V++
Sbjct:   30 FLDFLEEFQGSDGEIKYLQFAEELI---RPERNTLVVSFADLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPFAKDFYVAF------------------------QDLPTRH---------------------KIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIKDVEQQF--KYTQPNI-CRNPVC--ANRKRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDRCDFTGALIVVPDVSKLSTPGARAETNSRVSGADGYETEGIRGLRALGVRDLSYRLVFLACHVAPTNPRFGGKELRDE-EQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVDEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDMRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVSGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRIEESIDRV------------YSLDDIRRYLLFAR-QFKPKISKESEDFIVEQYKRLRQRDGSGVTKSSWRITVRQLESMIRLSESMARMHCCDEVQPKHVKEAFRLLNKSIIRVET 661          
BLAST of DNA replication licensing factor MCM7 vs. UniProt/SwissProt
Match: sp|Q3ZBH9|MCM7_BOVIN (DNA replication licensing factor MCM7 OS=Bos taurus OX=9913 GN=MCM7 PE=2 SV=1)

HSP 1 Score: 774.622 bits (1999), Expect = 0.000e+0
Identity = 381/737 (51.70%), Postives = 526/737 (71.37%), Query Frame = 1
Query:   28 MRNYESDKDKFKNFIENFYEE-TSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMG-RATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            +++Y  +KDK K F++ FY++  S  K+F Y  Q++ ++ +EQ A+Y+ LDDI E D EL + I +N  RY +L   A+ E++     R  VNK   D++I+H L +EQ  RD       P      + ++P EL+RR+E YF    ++K   IR V +  +G ++ ++ +V R + VKP M +ATYTCD+CG+ET+Q I + T +PL+ C ++ C+   + GRL+LQT+GSK++K QE+++QE SDQVP+GNIPRS+ V   G NTR+ QPGDHV +TG+FLP+L TG R + +GL++E +L+AH I +++K E D+ G     T  EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V+RD ++GE+TLE G+LVLAD G+CCIDEFDKM ++DRTAIHEVMEQQTISIAKAGI+TTLNAR SILAAANPAYGRYNPRR++EQNI LPAALLSRFDLLWLIQD+PDRD DLRLAQHI+YVH ++  PP          A   PL M  +RRY+A+ R +  PAVPE+L +Y+   Y+ MR+E+ A SK++ +TSAR+LLA++R+STAL+R++    V++ DV+EAIRL+E SK S+  D+ +        ++I+  +R L ++  +VR ++  ++C+S GFTP Q    +D YEELN+WQVN  RTRI  V
Sbjct:    3 LKDYVLEKDKVKKFLQEFYQDDESGKKQFKYGNQLVQLAHREQVAMYVDLDDIAEDDPELVDSICENTKRYARLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRD-------PGAARSPQNQYPPELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPRMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQMVQGLLSETYLEAHRIVKMSKSEEDESGAG-ELTREELRQITEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPP----------AQFEPLDMKLMRRYIAMCREK-QPAVPESLADYITAAYVEMRREAWA-SKDATYTSARTLLAILRLSTALARLRMVDTVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSEGQSVRFSEAEQRCISRGFTPAQFQAALDEYEELNVWQVNTARTRITFV 719          
BLAST of DNA replication licensing factor MCM7 vs. UniProt/SwissProt
Match: sp|P33993|MCM7_HUMAN (DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4)

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 379/737 (51.42%), Postives = 524/737 (71.10%), Query Frame = 1
Query:   28 MRNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEII-HGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            +++Y  +K+K K F++ FY++    KK F Y  Q++ ++ +EQ A+Y+ LDD+ E D EL + I +N  RY KL   A+ E++     R  VNK   D++I+H L +EQ  RD       P  +   + ++P+EL+RR+E YF    ++K   IR V +  +G ++ ++ +V R + VKP M +ATYTCD+CG+ET+Q I + T +PL+ C ++ C+   + GRL+LQT+GS+++K QE+++QE SDQVP+GNIPRS+ V   G NTR+ QPGDHV +TG+FLP+L TG R + +GL++E +L+AH I ++ K E D+ G     T  EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V+RD ++GE+TLE G+LVLAD G+CCIDEFDKM ++DRTAIHEVMEQQTISIAKAGI+TTLNAR SILAAANPAYGRYNPRR++EQNI LPAALLSRFDLLWLIQD+PDRD DLRLAQHI+YVH ++  PPS             PL M  +RRY+A+ R +  P VPE+L +Y+   Y+ MR+E+ A SK++ +TSAR+LLA++R+STAL+R++    V++ DV+EAIRL+E SK S+  D+ +        ++I+  +R L +   +VR ++  ++CVS GFTP Q    +D YEELN+WQVN  RTRI  V
Sbjct:    3 LKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRD-------PGMVRSPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAG-ELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFE----------PLDMKLMRRYIAMCREK-QPMVPESLADYITAAYVEMRREAWA-SKDATYTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV 719          
BLAST of DNA replication licensing factor MCM7 vs. UniProt/SwissProt
Match: sp|Q61881|MCM7_MOUSE (DNA replication licensing factor MCM7 OS=Mus musculus OX=10090 GN=Mcm7 PE=1 SV=1)

HSP 1 Score: 764.222 bits (1972), Expect = 0.000e+0
Identity = 377/737 (51.15%), Postives = 527/737 (71.51%), Query Frame = 1
Query:   28 MRNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMG-RATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            +++Y  +K+K K F++ FY E    KK F Y  Q+++++ +EQ A+Y+ LDDI E D EL + I +N  RY +L    + E++     +  VNK   D++I+H L +EQ  RD       P  + + + ++PSEL+RR+E YF    +SK   IR V +  +G ++ ++ +V R + VKP M +ATYTCD+CG+ET+Q I + T +PL+ C ++ C+   + GRL+LQT+GSK+VK QE++IQE SDQVP+GNIPRS+ V   G NTR+ QPGDHV +TG+FLP+L TG + + +GL++E +L+AH+I ++TK + D  G    ++E EL+++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG+++ICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V+RD ++GE+TLE G+LVLAD G+CCIDEFDKM ++DRTAIHEVMEQQTISIAKAGI+TTLNAR SILAAANPAYGRYNPRR++EQN+ LPAALLSRFDLLWLIQD+PDRD DLRLAQHI+YVH ++  PP          A   PL M  +RRY+A+   +  P VPE+L +Y+   Y+ MR+E++A SK++ +TSAR+LLA++R+STAL+R++    V++ DV+EAIRL+E SK S+  ++ +        ++I+  IR L +   +V  ++  ++C+S GFTP Q    +D YEELN+WQVN  RTRI  V
Sbjct:    3 LKDYAIEKEKVKKFLQEFYYENELGKKQFKYGTQLVHLAHREQVALYVDLDDIAEDDPELVDSICENAKRYSRLFGDVVQELLPEYKEKEVVNKDVLDVYIEHRLMMEQRSRD-------PGAVRNPQNQYPSELMRRFELYFRGPSSSKPRVIREVRADSVGKLLTVRGIVTRVSEVKPRMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFVKFQEMKIQEHSDQVPVGNIPRSITVVLEGENTRIAQPGDHVSVTGIFLPVLRTGFQQMAQGLLSETYLEAHWIVKMTKSDDDVSGAGELSSE-ELKQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPQGMKIRGNIHICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNVQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPP----------AQFEPLDMKLMRRYIAMCHER-QPTVPESLADYITAAYVEMRREARA-SKDATYTSARTLLAILRLSTALARLRMVDIVEKEDVNEAIRLMEMSKDSLLGEKGQTARTQRPADVIFATIRELVSRGRSVHFSEAEQRCISRGFTPAQFQAALDEYEELNVWQVNTSRTRITFV 719          
BLAST of DNA replication licensing factor MCM7 vs. UniProt/SwissProt
Match: sp|Q7ZXB1|MCM7B_XENLA (DNA replication licensing factor mcm7-B OS=Xenopus laevis OX=8355 GN=mcm7-b PE=2 SV=1)

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 386/738 (52.30%), Postives = 531/738 (71.95%), Query Frame = 1
Query:   31 RNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMG-RATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAAD--SSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            R+Y+++K+K K F++ FY++    KK F Y  Q+ NI+ +EQ A+ I LDD+ E D EL + I +N  RY  L   A+ E++     R  V+K A D++I+H L +EQ  RD       P  + D   ++P EL+RR+E YF A  +SKA  +R+V +  +G ++ ++ +V R T VKP+M +ATYTCD+CG+ET+Q I + T +PL+ C +  C+   + GRL+LQT+GSK++K QE++IQE SDQVP+GNIPR M+V+  G NTRL QPGDHV ITGVFLP+L TG R + +GL++E +L++H + ++ K E D+LG T   +E EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++N+CLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V++D +TGEMTLE G+LVLAD G+CCIDEFDKM DSDRTAIHEVMEQQTISIAKAGIMTTLNAR SILAAANPAYGRYNP++T+EQNI LPAALLSRFDLLWLIQDKPDRD DLRLAQHI+YVH +++ PPS             P+ M  +RRY+ + +S+  PA+PE+L +YL   Y+ MRKE++  +K+  FTSAR+LL+++R+STAL+R++ +  V++ DV+EA+RL E SK S++ D+          ++I+  IR +  +  + +V+ ++  ++CVS GFTP Q    ++ YEELN+W VN  RT+I  V
Sbjct:    3 RDYQAEKEKCKTFLQEFYKDDEFGKKNFKYGVQLANIAHREQVALCIDLDDLAEEDPELVDAICENTRRYTNLFADAVQELLPQYKEREVVHKDALDVYIEHRLMMEQRGRD-------PNEMRDPHNQYPPELMRRFELYFKAPSSSKARVVRDVKADSIGKLVTVRGIVTRVTEVKPMMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSRECQTNRSGGRLYLQTRGSKFIKFQELKIQEHSDQVPVGNIPRCMSVYVRGENTRLAQPGDHVGITGVFLPMLRTGFRQVVQGLLSETYLESHRLVKMNKTEDDELG-TEELSEEELRQITEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDHSPRGMKIRGNINVCLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMKDPVTGEMTLEGGALVLADQGVCCIDEFDKMMDSDRTAIHEVMEQQTISIAKAGIMTTLNARCSILAAANPAYGRYNPKKTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAQHITYVHQHSKQPPSQFQ----------PMDMKLMRRYITMCKSK-QPAIPESLADYLTAAYVEMRKEART-NKDMTFTSARTLLSILRLSTALARLRLEDVVEKEDVNEAMRLTEMSKDSLQGDKGHASRTQRPADVIFSTIREMVPEKGARSVKYSEAEQRCVSKGFTPAQFEAALEEYEELNVWLVNQARTKITFV 720          
BLAST of DNA replication licensing factor MCM7 vs. UniProt/SwissProt
Match: sp|Q91876|MCM7A_XENLA (DNA replication licensing factor mcm7-A OS=Xenopus laevis OX=8355 GN=mcm7-a PE=1 SV=2)

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 386/738 (52.30%), Postives = 530/738 (71.82%), Query Frame = 1
Query:   31 RNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMG-RATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAAD--SSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            R+Y+++K+K K F++ FY++    KK F Y  Q+ NI+ +EQ A+YI LDD+ E D EL + I +N  RY  L   A+ E++     R  V+K A D++I+H L +EQ  RD       P  + D + ++P EL+RR+E YF A  +SKA  +R+V +  +G ++ ++ +V R T VKP+M +ATYTCD+CG+ET+Q I + T +PL+ C +  C+   + GRL+LQT+GSK++K QE++IQE SDQVP+GNIPR M+V+  G NTRL QPGDHV ITGVFLP+L TG R + +GL++E +L+ H + ++ K E D+LG T   +E EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V++D +TGEMTLE G+LVLAD G+CCIDEFDKM D+DRTAIHEVMEQQTISIAKAGIMTTLNAR SILAAANPAYGRYNP++T+EQNI LPAALLSRFD+LWLIQDKPDRD DLRLAQHI+YVH +++ PPS             PL M  +RRY+ + + +  PA+PE L +YL   Y+ MRKE++  +K+  FTSAR+LL+++R+STAL+R++ +  V++ DV+EA+RL+E SK S+  D+          ++I+  IR +  +  + +V+ ++  ++CVS GFTP Q    ++ YEELN+W VN  RT+I  V
Sbjct:    3 RDYQTEKEKCKTFLQEFYKDDEIGKKHFKYGVQLANIAHREQVALYIDLDDLAEEDPELVDAICENTRRYTNLFADAVQELLPQYKEREVVHKDALDVYIEHRLMMEQRGRD-------PNEMRDSQNQYPPELMRRFELYFKAPSSSKARVVRDVKADSIGKLVNIRGIVTRVTEVKPMMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSRECQTNRSGGRLYLQTRGSKFIKFQELKIQEHSDQVPVGNIPRCMSVYVRGENTRLAQPGDHVGITGVFLPMLRTGFRQVVQGLLSETYLECHRLVKMNKSEDDELG-TEELSEEELRQITEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDNSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMKDPVTGEMTLEGGALVLADQGVCCIDEFDKMMDTDRTAIHEVMEQQTISIAKAGIMTTLNARCSILAAANPAYGRYNPKKTVEQNIQLPAALLSRFDVLWLIQDKPDRDNDLRLAQHITYVHQHSKQPPSQFQ----------PLDMKLMRRYITMCKRK-QPAIPEALADYLTAAYVEMRKEART-NKDMTFTSARTLLSVLRLSTALARLRLEDVVEKEDVNEAMRLMEMSKDSLLGDKGHTSRTQRPADVIFSTIREMVPEKGARSVKYSEAEQRCVSKGFTPAQFEAALEEYEELNVWLVNQARTKITFV 720          
BLAST of DNA replication licensing factor MCM7 vs. TrEMBL
Match: A0A4E0S1N1 (DNA replication licensing factor MCM7 OS=Fasciola hepatica OX=6192 GN=MCM7 PE=3 SV=1)

HSP 1 Score: 842.417 bits (2175), Expect = 0.000e+0
Identity = 424/767 (55.28%), Postives = 555/767 (72.36%), Query Frame = 1
Query:   31 RNYESDKDKFKNFIENFYE-ETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRAT-VNKTAFDIFIDHCLQIEQNL---------RDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCK---IGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLL--------NTGMRTL------NRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXT-KIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLG----YKELIYQAIRGL-AADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            RNY+ DK     F+  F + ++S +K F+Y EQ+ N++ +EQ A+YI++DDI+EF  ELAE +E N  RYQKL    +D+++        V +   DIFIDH +++EQ +         R +A    Q + IE++R++FP ELLRR+E YF  R   K +S+R+VL+  +G +I+++ +V RAT VKPL+ IATYTC+RCG+ET+QEI N T +PL  C    CK    G  GRLHLQT+GSK+ K QEIRIQE+SDQVP+GNIPR ++++  G NTR   PGDHV ITGVFLP L        N G RT       + GL+ E +L+AH I  ++K  +D++ ET   TE E+E+L+DPE+YSLMARS+APEI+GHEDVKK LL+++ GG  +      +IRG+LN+CLMGDPGVAKSQLLGFVDRL  RSQYT GRGSSG GLTASV++D LTGEMTLE GSLVLAD G+CCIDEFDKMT+ DRTAIHEVMEQQTISIAKAGI+TTLNAR +ILAAANPAYGRYNP RT+EQNIDLPAALLSRFDLLWLIQDKP+R+ DLRLAQHI+YVH +  AP +   T+   +      ++ ELRR + I + QP P+VP  L +YLVG Y+ MRKE++  +KE  +TSAR+LLA++R+STA +R++  TEV + D+DEA+RL+EAS+AS+ S  +    R+G    YK++IY   R L  A   T R+AD+ ++C + G+TP Q+NEV+D+YE LN+WQ NVGRTR+ +V
Sbjct:    7 RNYDEDKQSISEFLRTFNKVDSSGNKHFLYSEQLTNVANREQTAVYIAVDDISEFSEELAEAVESNASRYQKLFAECVDKLLPDFRTGDLVPQDVLDIFIDHRIRMEQRVMAEDSGEVSRSAAQSRNQNVDIEEIRSRFPPELLRRFEVYFCGRIDRKPISVRSVLAASIGRLIQVRGIVTRATEVKPLISIATYTCNRCGAETYQEITNPTFMPLSLCGTSACKNAGPGGGGRLHLQTRGSKFAKFQEIRIQELSDQVPVGNIPRGLSIYLRGENTRSAMPGDHVLITGVFLPSLKHASFSGGNQGGRTAMAVNSASGGLMAETYLEAHSIQLLSK--TDEVTETGEPTEDEVERLRDPEVYSLMARSLAPEIYGHEDVKKALLLLLVGGVELAPKAGLRIRGNLNVCLMGDPGVAKSQLLGFVDRLSTRSQYTTGRGSSGVGLTASVMKDPLTGEMTLEGGSLVLADQGVCCIDEFDKMTEFDRTAIHEVMEQQTISIAKAGILTTLNARVAILAAANPAYGRYNPNRTVEQNIDLPAALLSRFDLLWLIQDKPEREHDLRLAQHITYVHMHGSAPTTTEGTSLPGAEQQNLFTLTELRRLIQIAKMQPAPSVPAHLADYLVGAYVEMRKEARV-NKEMTYTSARTLLAIMRLSTAHARLRAATEVTKSDIDEAMRLMEASRASINSTGSGDFDRVGRPQSYKDIIYHIARELTGAGGGTARLADVMERCAARGYTPLQVNEVVDAYENLNVWQTNVGRTRLTVV 770          
BLAST of DNA replication licensing factor MCM7 vs. TrEMBL
Match: A0A0R3TBZ2 (DNA replication licensing factor MCM7 OS=Rodentolepis nana OX=102285 GN=MCM7 PE=3 SV=1)

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 417/764 (54.58%), Postives = 553/764 (72.38%), Query Frame = 1
Query:   28 MRNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEII--HGMGRATVNKTAFDIFIDHCLQIEQNLR---------DSANGIGQPLTIE--DLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKI---GTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLN--------TGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXT-KIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTR---LGYKELIYQAIRG-LAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
             R+YE+DK +   F++ F++   D +K F Y EQ+  ++ +++  I ISLDD+ + + EL   +E N  R+Q+L   AID++I  +  G A ++    DIFIDH +++EQ +               + QP + E  ++R KFP ELLRRYE YF AR T K +S+R VL+  +G +I+++ +V R T VKPL+++ATYTCDRCG+ET+QEI + + +PL+ C    CK    G+AG+L LQT+GSK+ K QEIRIQE+SDQVP+GNIPR + V+  G NTRLVQPGDHV ITGVFLP           + M      L+ + FLDAHFI +++K ES+ L E    TEAE+E+L+DP+MYSLMA+S+APEI+GHEDVKK LL+++ GG  I      +IRG++NICLMGDPGVAKSQLLGFV RL PRSQYT GRGSSG GLTA+V +D  TGEMTLE G+LVLAD G+CCIDEFDKM + DRTAIHEVMEQQTISIAKAGI+TTLNAR ++LAAANPAYGRYNP R++EQN+DLPAALLSRFDLLWLIQD+PDR+ D+RLAQHI+YVH++  AP +   + A   A    LS+AELRR +A+ RSQP+P VP  L +YLVG Y+ MRKE++  +KE  +TSAR+LLA++R+STA +R++  +EV + D+DEA+RL+EAS+ASV +     R R   + YK+ IY  IR  L     + R+ D+ ++C + GFTP+Q+NEV+D+YE LN+WQVN+GRTRI  V
Sbjct:    6 FRDYEADKAEITRFLKEFHKSEKDGEKYFPYLEQLSKLANRKENVIRISLDDLWDMNEELTTAVEINTTRFQRLFSEAIDDLIPDYREGEAQIHDV-LDIFIDHRIRMEQRMHTEDIGGESPPQGQAVDQPNSTEMREIRAKFPPELLRRYEVYFTARSTFKPMSVRKVLASSIGHLIQVRGIVSRTTEVKPLLRVATYTCDRCGAETYQEITSSSFMPLMLCQTPACKAAGAGSAGQLQLQTRGSKFEKFQEIRIQELSDQVPVGNIPRGLTVYTHGENTRLVQPGDHVLITGVFLPSARGTVAGRAASAMSGTTGALLADTFLDAHFIIQLSKSESN-LDEE--PTEAEIERLQDPDMYSLMAQSVAPEIYGHEDVKKALLLLLVGGVEIRPQAGLRIRGNINICLMGDPGVAKSQLLGFVYRLSPRSQYTTGRGSSGVGLTAAVTKDPFTGEMTLEGGALVLADQGVCCIDEFDKMAEFDRTAIHEVMEQQTISIAKAGILTTLNARVALLAAANPAYGRYNPHRSVEQNVDLPAALLSRFDLLWLIQDRPDRENDMRLAQHIAYVHSHGSAPTNAAASDAAGHASGRLLSLAELRRLIAVARSQPEPVVPAYLADYLVGAYVEMRKEARV-NKEMTYTSARTLLAIMRLSTARARLRVASEVTKADIDEAMRLMEASRASVSNPVGGPRDRNRPVSYKDQIYAVIRELLGMGGGSTRLTDVMERCANKGFTPNQVNEVVDAYENLNVWQVNMGRTRITAV 764          
BLAST of DNA replication licensing factor MCM7 vs. TrEMBL
Match: G4VSF5 (DNA replication licensing factor MCM7 OS=Schistosoma mansoni OX=6183 GN=MCM7 PE=3 SV=1)

HSP 1 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 413/776 (53.22%), Postives = 561/776 (72.29%), Query Frame = 1
Query:   13 MKMVFMRNYESDKDKFKNFIENFYE--ETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRAT-VNKTAFDIFIDHCLQIEQNLRDSANGIG--------QPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCK---IGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLL--------------NTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXT-KIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPS----VLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKS---DRARQRTRLGYKELIYQAIRGL-AADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            M +  +RNY+ DK     F+  FY   ++  +K F+Y EQ+  I+ +EQ  +Y+S+DD+ E  S+LA  IE N  RY K+    ID+++        V +   DIFIDH +++EQ +R +             +P+ + ++R++FP ELLRR+E YF  R  +K L +RNVL+  +G +I+++ VV RAT VKPL+  ATYTCDRCG+ET+QEI N T +PL  C    CK    G  GRLH+QT+GSK++K QEIRIQE+SDQVP+G+IPR++ ++  G NTR  QPGDH+ +TGVFLP +              +  + T++ GL+T+ +L+AH +  ++K  +DD+ +    +E E+E+L+D E YSLMA+S+APEI+GHEDVKK LL+++ GG  +      +IRG+LNICLMGDPGVAKSQLLGFVDRL PRSQYT GRGSSG GLTASV++D LTGEMTLE G+LVLAD G+CCIDEFDKMT+ DRTAIHEVMEQQTISIAKAGI+TTLNAR +ILAAANPAYGRYNP +++EQN+DLPAALLSRFDLLWLIQDKPDR+ DLRLAQHI++VH +  AP +    + +T++ +   L  LS+ ELRR +A+ ++QP PAVP  L +YLVG Y+ MRKE++A +KE  +TSAR+LLA++R+STA +R++  +EV + D+DEA+RL+EAS+AS+ +   D  R      YK++IY  IR L AA   T R+ADI+++C + G+TP Q+NEVI++YE+LN+WQVN+GRTRI  V
Sbjct:    1 MALSTVRNYDEDKKACDQFLR-FYSKMDSCGNKHFVYSEQLTRIANREQSVLYVSIDDVAEHSSDLANAIECNAVRYTKIFAEVIDDLLPDFRTVELVPQDVLDIFIDHRIRMEQRIRAADAETAPRAVSRDPEPVNMAEVRSRFPPELLRRFEVYFCGRSDAKPLCVRNVLASSIGHLIQVRGVVTRATEVKPLITTATYTCDRCGAETYQEINNPTFMPLTVCGTAACKNAGPGGGGRLHMQTRGSKFLKFQEIRIQELSDQVPVGHIPRALTIYLRGENTRAAQPGDHILVTGVFLPSVRGASFSGSGRTNQASVSLNTVSGGLLTDTYLEAHSVQLLSK--TDDVTDANEPSEEEIERLRDLEFYSLMAQSLAPEIYGHEDVKKALLLLLVGGVELAPKEGLRIRGNLNICLMGDPGVAKSQLLGFVDRLSPRSQYTTGRGSSGVGLTASVMKDPLTGEMTLEGGALVLADQGVCCIDEFDKMTEFDRTAIHEVMEQQTISIAKAGILTTLNARVAILAAANPAYGRYNPDKSVEQNVDLPAALLSRFDLLWLIQDKPDREHDLRLAQHITFVHMHGSAPSATDSQIDSTSSTNHQQL--LSLPELRRLIAVAKAQPAPAVPAHLADYLVGAYVEMRKEARA-NKEMTYTSARTLLAIMRLSTARARLRAASEVSKGDIDEAMRLMEASRASIITSYEDSNRSGRPQSYKDVIYHIIRELTAAGDGTARIADIAERCATKGYTPAQLNEVIEAYEDLNVWQVNIGRTRITTV 770          
BLAST of DNA replication licensing factor MCM7 vs. TrEMBL
Match: A0A3Q0KE52 (DNA replication licensing factor MCM7 OS=Schistosoma mansoni OX=6183 GN=MCM7 PE=3 SV=1)

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 412/776 (53.09%), Postives = 561/776 (72.29%), Query Frame = 1
Query:   13 MKMVFMRNYESDKDKFKNFIENFYE--ETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRAT-VNKTAFDIFIDHCLQIEQNLRDSANGIG--------QPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCK---IGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLL--------------NTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXT-KIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPS----VLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKS---DRARQRTRLGYKELIYQAIRGL-AADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            M +  +RNY+ DK     F+  FY   ++  +K F+Y EQ+  I+ +EQ  +Y+S+DD+ E  S+LA  IE N  RY K+    ID+++        V +   DIFIDH +++EQ +R +             +P+ + ++R++FP ELLRR+E YF  R  +K L +RNVL+  +G +I+++ VV RAT VKPL+  ATYTCDRCG+ET+QEI N T +PL  C    CK    G  GRLH+QT+GSK++K QEIRIQE+SDQVP+G+IPR++ ++  G NTR  QPGDH+ +TGVFLP +              +  + T++ GL+T+ +L+AH +  ++K  +DD+ +    +E E+E+L+D E YSLMA+S+APEI+GHEDVKK LL+++ GG  +      +IRG+LNICLMGDPGVAKSQLLGFVDRL PRSQYT GRGSSG GLTASV++D LTGEMTLE G+LVLAD G+CCIDEFDKMT+ DRTAIHEVMEQQTISIAKAGI+TTLNAR +ILAAANPAYGRYNP +++EQN+DLPAALLSRFDLLWLIQDKPDR+ DLRLAQHI++VH +  AP +    + +T++ +   L  LS+ ELRR +A+ ++QP PAVP  L +YLVG Y+ MRKE++A +KE  +TSAR+LLA++R+STA +R++  +EV + D+DEA+RL+EAS+AS+ +   D  R      YK++IY  +R L AA   T R+ADI+++C + G+TP Q+NEVI++YE+LN+WQVN+GRTRI  V
Sbjct:    1 MALSTVRNYDEDKKACDQFLR-FYSKMDSYGNKHFVYSEQLTRIANREQSVLYVSIDDVAEHSSDLANAIECNAVRYTKIFAEVIDDLLPDFRTVELVPQDVLDIFIDHRIRMEQRIRAADAETAPRAVSRDPEPVNMAEVRSRFPPELLRRFEVYFCGRSDAKPLCVRNVLASSIGHLIQVRGVVTRATEVKPLITTATYTCDRCGAETYQEINNPTFMPLTVCGTAACKNAGPGGGGRLHMQTRGSKFLKFQEIRIQELSDQVPVGHIPRALTIYLRGENTRAAQPGDHILVTGVFLPSVRGASFSGSGRTNQASVSLNTVSGGLLTDTYLEAHSVQLLSK--TDDVTDANEPSEEEIERLRDLEFYSLMAQSLAPEIYGHEDVKKALLLLLVGGVELAPKEGLRIRGNLNICLMGDPGVAKSQLLGFVDRLSPRSQYTTGRGSSGVGLTASVMKDPLTGEMTLEGGALVLADQGVCCIDEFDKMTEFDRTAIHEVMEQQTISIAKAGILTTLNARVAILAAANPAYGRYNPDKSVEQNVDLPAALLSRFDLLWLIQDKPDREHDLRLAQHITFVHMHGSAPSATDSQIDSTSSTNHQQL--LSLPELRRLIAVAKAQPAPAVPAHLADYLVGAYVEMRKEARA-NKEMTYTSARTLLAIMRLSTARARLRAASEVSKGDIDEAMRLMEASRASIITSYEDSNRSGRPQSYKDVIYHIVRELTAAGDGTARIADIAERCATKGYTPAQLNEVIEAYEDLNVWQVNIGRTRITTV 770          
BLAST of DNA replication licensing factor MCM7 vs. TrEMBL
Match: A0A0R3SBV4 (DNA replication licensing factor MCM7 OS=Hymenolepis diminuta OX=6216 GN=MCM7 PE=3 SV=1)

HSP 1 Score: 810.061 bits (2091), Expect = 0.000e+0
Identity = 419/770 (54.42%), Postives = 553/770 (71.82%), Query Frame = 1
Query:   13 MKMVFMRNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEII--HGMGRATVNKTAFDIFIDHCLQIEQNLR---------DSANGIGQPLT--IEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKI---GTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLN--------TGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXT-KIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAA-GDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTR---LGYKELIYQAIRG-LAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            M  V  R+YESD+ +   F++ F+    D +K F Y EQ+  ++ + +  I I+LDD+ + + EL   +E N  R+QKL   AID++I  +  G A ++    DIFIDH +++EQ +                 QP    + ++R KFP ELLRRYE YF AR T K +S+R VL+  +G +I+++ VV R T VKPL+++ATYTCDRCG+ET+QEI + + +PL+ C    CK    G+AG+L LQT+GSK+ K QEIRIQE+SDQVP+GNIPR + V+  G NTRLVQPGDHV ITGVFLP           + M      L+ + FLDAH I +++K ES+ L E    +EAE+E+L+DP+MYSLMA+S+APEI+GHEDVKK LL+++ GG  I      +IRG++NICLMGDPGVAKSQLLGFV RL PRSQYT GRGSSG GLTA+V +D  TGEMTLE G+LVLAD G+CCIDEFDKM D DRTAIHEVMEQQTISIAKAGI+TTLNAR ++LAAANPAYGRYNP R++EQNIDLPAALLSRFDLLWLIQD+PDR+ D+RLAQHI+YVH++  AP +   + A G ++G L LS+ ELRR +AI R+QP+P VP  L +YLVG Y+ MRKE++  ++E  +TSAR+LLA++R+STA +R++  +EV + D+DEA+RL+EAS+ASV +     R R   + Y++ IY  IR  L +   + R+ D+ ++C + GFTPDQ+NEVID+YE LN+WQVN+ RTRI  V
Sbjct:    1 MAPVHFRDYESDRVEIIRFLKEFHRSEKDGEKYFPYLEQLSKLANRNENVIRIALDDLWDMNEELTTAVELNTNRFQKLFSEAIDDLIPEYREGEAQIHDV-LDIFIDHRIRMEQRMHTEDIGSEPTPQGQAAEQPNASDMREIRAKFPPELLRRYEVYFTARSTFKPMSVRKVLASSIGHLIQVRGVVSRTTEVKPLLRVATYTCDRCGAETYQEITSPSFMPLILCQTPACKAAGAGSAGQLQLQTRGSKFEKFQEIRIQELSDQVPVGNIPRGLTVYARGENTRLVQPGDHVLITGVFLPSARGTVASRAASAMGGSTGALLADTFLDAHSIIQLSKSESN-LDEE--PSEAEIERLQDPDMYSLMAQSVAPEIYGHEDVKKALLLLLVGGVEIRPQAGLRIRGNINICLMGDPGVAKSQLLGFVYRLSPRSQYTTGRGSSGVGLTAAVTKDPFTGEMTLEGGALVLADQGVCCIDEFDKMADFDRTAIHEVMEQQTISIAKAGILTTLNARVALLAAANPAYGRYNPHRSVEQNIDLPAALLSRFDLLWLIQDRPDRENDMRLAQHIAYVHSHGSAPANAAASGAQGHASGRL-LSLPELRRLIAIARAQPEPVVPAYLADYLVGAYVEMRKEARV-NREMTYTSARTLLAILRLSTARARLRAASEVTKADIDEAMRLMEASRASVSNPVGGPRDRNRPVSYRDQIYAVIRELLGSGGGSTRLTDVMERCANKGFTPDQVNEVIDAYENLNVWQVNMSRTRITAV 764          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Cavefish
Match: mcm7 (minichromosome maintenance complex component 7 [Source:ZFIN;Acc:ZDB-GENE-020419-27])

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 316/557 (56.73%), Postives = 413/557 (74.15%), Query Frame = 1
Query:   31 RNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEII-HGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLT 1692
            ++Y ++K+K K F++ FY E    KK F Y  Q++ ++ +EQ  + + LDD+ E D EL E + +N  RY  L   A+ E++     R  V K A D++I+H L +E   RD A+       + D R ++P+EL+RR+E YF    TSK   +R+V +  +G ++ ++ +V RAT VKP+M +ATYTCD+CG+ET+Q I + + +PL+ C ++ C    + GRL+LQT+GSK+VK QE+RIQE SDQVP+GNIPRSM ++  G NTRLVQPGDHV ++GVFLPLL +G R   +GL++E +L+AH +  + K E D+LG T   +E EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V+RD +TGEMTLE G+LVLAD G+CCIDEFDKM D+DRTAIHEVMEQQTISIAKAGIMT+LNAR SILAAANPAYGRYNPR+TIEQNI LPAALLSRFDLLWLIQDKPD D DLRLAQHI+YVH +++ PP+  T
Sbjct:    4 KDYLAEKEKCKRFLQEFYSEDDSGKKVFKYGAQLVALAHREQVGLVVDLDDVAEEDPELVESVCENTKRYTVLFADAVHELLPEYREREVVAKDALDVYIEHRLMMETRGRDPAD-------MRDPRNQYPAELMRRFEVYFRPPSTSKPKVVRDVKADSIGKLVTVRGIVTRATEVKPMMAVATYTCDQCGAETYQPIASPSFMPLIMCPSQECVTNRSGGRLYLQTRGSKFVKFQELRIQEHSDQVPVGNIPRSMTIYARGENTRLVQPGDHVAVSGVFLPLLRSGFRQAVQGLLSETYLEAHCVTLMNKTEDDELG-TEDLSEEELRQITEEDFYEKLAGSIAPEIYGHEDVKKALLLLLVGGVEQAPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMRDPVTGEMTLEGGALVLADLGVCCIDEFDKMADADRTAIHEVMEQQTISIAKAGIMTSLNARCSILAAANPAYGRYNPRKTIEQNIQLPAALLSRFDLLWLIQDKPDTDNDLRLAQHITYVHQHSKQPPTHFT 552          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Cavefish
Match: mcm4 (minichromosome maintenance complex component 4 [Source:ZFIN;Acc:ZDB-GENE-030131-9544])

HSP 1 Score: 313.923 bits (803), Expect = 7.163e-95
Identity = 232/679 (34.17%), Postives = 351/679 (51.69%), Query Frame = 1
Query:   49 KDKFKNFIENFYEETS--------DSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPL-LNTGMRTLNRGLVTELFLDA-HFINRITKDES----DDLGETIPATEAELEKLKD----PEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXT---KIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTS-ARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLL-EASKASVKSDR 2016
            K+KF+ F++ F +  S        D  + +Y +++  IS      + ++   I  FD++L          Y++LI Y   E+I      +VN+  FD F D  L+ +  +R                          Y A        K  ++R++  +++  +I +  +VIR + + P M+ A + C  C   T  E+    +     C +  C   T   L L    S +   Q I++QE  + +P G  P +  V+        VQPGD V ITG++    +    R      V +  +DA HF  R T +      D+  E    TE  +  LK+    P++Y  ++ ++AP I+ HED+KKG+L+ + GG   D + T     R  +NI L GDPG +KSQLL +V  L PR QYT+G+GSS  GLTA V++D  T ++ L+ G+LVL+D GICCIDEFDKM+DS R+ +HEVMEQQT+SIAKAGI+  LNAR SILAAANP   ++NP++T  +NI LP  LLSRFDL++L+ D  D   D RLA H+  ++  +E    ++            L MA L+ Y+A  R+  +P + E     L+  Y+ MR   K GS   + ++  R L +LIR++ A ++++   +V+ IDV+EA RL  EA K S    R
Sbjct:  115 KEKFQRFLQRFIDPESREDENASLDLNEPLYLQKLDEISVVGDPVLNVNCSHIQAFDADL----------YRQLISYP-QEVIPTFD-MSVNELFFDRFPDSVLEHQIQVRP-------------------------YNAL-------KTRNMRSLNPEDIDQLITISGMVIRTSQLIPEMQEAFFRCQVCAFSTRVEVDRGRIAEPAVCRH--C--NTTHSLALVHNRSVFSDKQMIKLQESPEDMPAGQTPHTTVVYAHNDLVDKVQPGDRVNITGIYRAAPMRVNPRQSQVKSVYKTHIDAIHF--RKTDERRLHSLDEENEQKLFTEERVATLKELAAKPDVYERLSSALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGNFRAEVNILLCGDPGTSKSQLLQYVFNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVALYYQSEE--QIVEEY---------LDMAVLKDYIAYARTYINPRLSEEASQALIEAYVDMR---KIGSGRGMVSAYPRQLESLIRLAEAHAKVRFSDKVETIDVEEAKRLHREALKQSATDPR 729          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Cavefish
Match: mcm6 (minichromosome maintenance complex component 6 [Source:NCBI gene;Acc:103037949])

HSP 1 Score: 308.916 bits (790), Expect = 7.449e-93
Identity = 221/691 (31.98%), Postives = 339/691 (49.06%), Query Frame = 1
Query:   58 FKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQ-EILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITG--VFLPLL-----------------------NTGMRTLNRGLVTEL-----FLDAH-------FINRITKDESDDLGETIP--ATEAELEKL----KDPEMYSLMARSIAPEIFGHEDVKKG-LLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIF-TSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEAS 1992
            F+ F+E F+    + K     E+++   + E+  + +S  D+  F+ ELA  I++  +R    +C A+       G    +K  +                        + I+DL T+                       IR + +  +GS++++   V+R   V P +   T+ C  C S     E   K   P + C N VC      R  L T  SK++  Q++RIQE   ++P G+IPRSM +          Q GD     G  + +P +                       N G+R L    V EL     FL +H       F  +  +DE +   E+I    T  E EK+    +D  +Y  +  S+ P I G+++VK+G LL++  G       GT +RG +N+C++GDP  AKSQ L  V+   PR+ YT+G+ SS AGLTA+VVRD+ + E  +EAG+L+LAD G+CCIDEFDKM   D+ AIHE MEQQTISI KAG+  TLNAR SILAAANP  GRY+  ++++QN++L A ++SRFDL +++ D  +   D  +A+ I  +H+  E     + T            + E+RRYL   R Q  P + +   +++V  Y  +R+   +G  +S +  + R L ++IR+S +++R+ C  EV    V EA RLL  S
Sbjct:   27 FQAFLEEFHNSDGELKYLRDAEELI---RPERNTLLVSFTDVEGFNQELATTIQEEFYRIYPYLCRAVRNFARDRGNVPASKEFY------------------------VAIQDLPTRH---------------------KIRELTTLRIGSLVRISGQVVRTHPVHPELVSGTFLCLDCQSAIKDVEQQFKYTQPSI-CRNPVC--NNRRRFLLDTNKSKFIDFQKVRIQETQAELPRGSIPRSMEIILRAEAVESAQAGDKCDFIGCLIVVPDVSQLATSGVRAETSSRTAGTQGYENEGVRGLKALGVRELTYKLAFLASHVAPTNPRFGGKEIRDE-EQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMETRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYDRSKSLKQNVNLTAPIMSRFDLFFILVDDSNEVTDYAIARRIVDLHSRIENSIDRMYT------------LDEIRRYLLFAR-QFKPKISKESEDFIVEQYKRLRQRDGSGVTKSAWRITVRQLESMIRLSESMARMHCCDEVQPKHVKEAFRLLNKS 652          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Cavefish
Match: mcm6l (maternal DNA replication licensing factor mcm6-like [Source:NCBI gene;Acc:111194477])

HSP 1 Score: 293.893 bits (751), Expect = 3.016e-87
Identity = 212/698 (30.37%), Postives = 335/698 (47.99%), Query Frame = 1
Query:   58 FKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGS---ETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNT----------------------------GMRTLN-RGLVTELFLDAHFIN----RITKDE---SDDLGETIP--ATEAELEKL----KDPEMYSLMARSIAPEIFGHEDVKKG-LLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIF-TSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKS 2010
            F  F+E F ++  D    +Y  +   + + E+  + +S  +I  ++ +LA  I++  +R    +C A+       G    +K  +  F D                            FPS                    IR + +  +G+++++   V+R   V P +   T+ C  C S   +  Q+   K   P + C N VC      R  L T  S++V  Q++RIQE   ++P G+IPRS+ V          Q GD    TG  + + +                             G++ L  R L   L   A+++     R    E    D   E++    T  E EK+    +D  +Y  +  S+ P I G++++K+G LL++  G A     GT +RG +N+C++GDP  +KSQ L  V+   PR+ YT+G+ SS AGLTA+VV+D+ + E  +EAG+L+LAD G+CCIDEFDKM   D+ AIHE MEQQTISI KAG+  TLNAR SILAAANP  GRYN  ++++QN+++ A ++SRFDL +++ D+ +   D  +A+ I  +H  N    SV    A +          +++RY+   R Q  P +      ++V  Y  +R+    G+ +S +  + R L +++R+S  ++R+ C  EV    V EA RLL  S   V S
Sbjct:   25 FLEFLEEFQDKVGDP---LYLPEAQELIRPERNTLTVSFTNIEHYNQQLATTIQEEYYRVYPFLCRAVRHFARDHGNIPPSKEFYVAFSD----------------------------FPSRQ-----------------KIRELSTARIGTLLRISGQVVRTHPVHPELVSGTFLCLDCQSVIKDVEQQF--KYTQPTI-CKNPVC--ANRRRFMLDTNKSRFVDFQKVRIQETQAELPRGSIPRSVEVVLRAEAVETAQAGDRCDFTGTLIVVPDVSAMALSGTRAETSSRVTGKEGFEADGIQGLKALGVRELSYRLAFLANYVAPTNPRFGGKELRQEDQTAESVKNQMTVQEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEIKRGILLMLFGGVAKTTMEGTSLRGDINVCIIGDPSTSKSQFLKHVEDFVPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIDGRYNRSKSLKQNVNMSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHARN--IDSVERVYASE----------DIQRYILFAR-QFQPKITPEAQEFVVEQYKRLRQRDGGGTTKSAWRITVRQLESMLRLSEGMARLYCSDEVQPKHVKEAFRLLNKSIIRVDS 656          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Cavefish
Match: mcm5 (minichromosome maintenance complex component 5 [Source:NCBI gene;Acc:103021452])

HSP 1 Score: 291.582 bits (745), Expect = 3.741e-87
Identity = 216/676 (31.95%), Postives = 338/676 (50.00%), Query Frame = 1
Query:   49 KDKFKNFIENFYEETSDSK-KFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRC-GSETFQEILNKTLLPLLT--CTNEVCKIGTAGRLHLQTKGSKY---------VKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDD-------LGETIPATEAELEKLK-DPEMYSLMARSIAPEIFGHEDVKKGL--LXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKE-----SIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEAS 1992
            K +F+ F+  F   T  +   + YR+++       +  + + ++D+  FD +L++ + K       L+  A  E+   + R                            +G+  T++D++    S+              +   SIR++ S+++  ++K+  ++I ++ V+     AT  C +C G      I N  L P L        C    AGR+        Y         V  Q +R+QE  D VP G +PR M ++C       V PG+ V I G++        +T  R     + + + ++ R+   + D         G   P  E EL  L   P +Y  +ARS+AP I+G +D+KK +  L+       +    T+ RG +N+ ++GDPG AKSQLL FV+R  P   YT+G+GSS AGLTASV+RD  T    +E G++VLADGG+ CIDEFDKM + DR AIHE MEQQTISIAKAGI TTLN+R S+LAAAN  +GR++  +  E NID    +LSRFD++++I+D+ D   D+ LA+H+  VH + +       T      G +PL  A L++Y+A  R +  P +       L   Y+ MR  ++   +E     SI  + R L A++RI+ +L+++K Q      +VDEA+RL + S
Sbjct:   34 KKRFREFLRQFRVGTDRTGFTYKYRDELKRHYTLGEYWVEVEMEDLASFDEDLSDCLYKLPTENLPLLEEAAQEVADEVTRP-------------------------RPVGEE-TVQDIQVMLKSD--------------AHPASIRSLKSEQVSRLVKIPGIIISSSAVRAK---ATRVCLQCRGCRAV--ISNIPLPPGLQGYALPRKCNTEQAGRVKCPV--DPYFIIPDRCVCVDFQTLRLQESPDAVPHGEMPRHMQLYCDRYLCDRVVPGNRVTIMGIYSIKKMATSKTKGRDKGAGVGIRSAYL-RVVGIQVDTEGAGRGATGSVSPLEEEELRALAASPAVYDSIARSLAPSIYGSDDLKKAIACLLFGGSRKRLPDGLTR-RGDINLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVLRDPNTRGFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDDTKG-EDNIDFMPTILSRFDMIFIIKDQHDHQRDMTLARHVMNVHLSAQ-------TQTEGVEGEIPL--ATLKKYIAYARVKCGPRLSAAAAEKLKNRYVVMRSGAREHERESDRRASIPITVRQLEAVVRIAESLAKMKLQAIAGEEEVDEALRLFQVS 650          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006035.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 687.182 bits (1772), Expect = 0.000e+0
Identity = 362/739 (48.99%), Postives = 501/739 (67.79%), Query Frame = 1
Query:   31 RNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRA-TVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSST---VRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            ++Y ++KD  K F++ FY++    KK F Y EQ+++++++EQ ++ I LDD+ E + ELAE + +N  RY  L   A+ E++    +   V K A D++I+H L + QN    A+         D + ++P EL+RR+E YF A  T K LS+R+V +  +G ++ ++ VV RAT VKP+M +ATYTCD+CG+ET+Q I + + +PL  C +  C+   + GRL+LQ++GSK+VK QE++IQE SDQVP+G IPR+M V   G NTRL QPGDH+ ITG+FLP+L  G R + +GL++E FL+AH + ++ K E ++L +    +E+EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V++D LTGEMTLE G+LVLAD G+CCIDEFDKM DSDRT+IHEVMEQQTISIAK       + R  +L       G      +    I LPAALLSRFDLLWLIQDKPDRD D+RLAQHI+YVH +   PPS  T          PL M  +RRY+A+ + +  PAVP+TL +Y+   Y+ MRKE++  SK++ FTSAR+LLA++R+STAL+R++    V++ DV+EA RL+E SK S+ +DR +        ++I+  IR LA    T   VR A+   +CVS GFTP Q++  +D YEELN+W VN  RT I  V
Sbjct:    4 KDYAAEKDNCKKFLQEFYKDDGLGKKQFKYGEQLVHLAQREQVSLCIDLDDLAELEPELAERVVENARRYAALFADAVSELLPEYRQGEPVQKDALDVYIEHRLML-QNRHGDADA-------HDPKNQYPPELMRRFELYFKAPGTLKPLSVRDVKANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCGAETYQPIASTSFMPLALCPSRDCQTNKSGGRLYLQSRGSKFVKFQELKIQEHSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITGIFLPVLKQGFRAMQQGLLSETFLEAHRVVKMNKTEDNEL-DVEELSESELRQITEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDRSPRGMKIRGNINICLMGDPGVAKSQLLCYIDRLAPRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTRTRVLQLVGYGRGGGGSCCSRWLGIKLPAALLSRFDLLWLIQDKPDRDNDIRLAQHITYVHQHCHQPPSQHT----------PLDMKLMRRYIALCQRR-QPAVPDTLADYITAAYVEMRKEARV-SKDTTFTSARTLLAILRLSTALARLRLVDVVEKEDVNEA-RLMEMSKDSLITDRGQPTRTQRPSDVIFSLIRELAPPDGTNRRVRYAEALSRCVSRGFTPAQVHTALDEYEELNVWHVNQARTAITFV 720          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006014.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 363/742 (48.92%), Postives = 505/742 (68.06%), Query Frame = 1
Query:   31 RNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRA-TVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKA--GIMTTLNARASILAAANPAYGRYNP-RRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSST---VRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            ++Y ++KD  K F++ FY++    KK F Y EQ+++++++EQ ++ I LDD+ E + ELAE + +N  RY  L   A+ E++    +   V K A D++I+H L + QN    A+         D + ++P EL+RR+E YF A  T K LS+R+V +  +G ++ ++ VV RAT VKP+M +ATYTCD+CG+ET+Q I + + +PL  C +  C+   + GRL+LQ++GSK+VK QE++IQE SDQVP+G IPR+M V   G NTRL QPGDH+ ITG+FLP+L  G R + +GL++E FL+AH + ++ K E ++L +    +E+EL ++ + + Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRG++NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V++D LTGEMTLE G+LVLAD G+CCIDEFDKM DSDRT+IHEVMEQQTISIAK   G+  +  A  S       A GR +     +   + LPAALLSRFDLLWLIQDKPDRD D+RLAQHI+YVH +   PPS  T          PL M  +RRY+A+ + +  PAVP+TL +Y+   Y+ MRKE++  SK++ FTSAR+LLA++R+STAL+R++    V++ DV+E +RL+E SK S+ +DR +        ++I+  IR LA    T   VR A+   +CVS GFTP Q++  +D YEELN+W VN  RT I  V
Sbjct:    4 KDYAAEKDNCKKFLQEFYKDDGLGKKQFKYGEQLVHLAQREQVSLCIDLDDLAELEPELAERVVENARRYAALFADAVSELLPEYRQGEPVQKDALDVYIEHRLML-QNRHGDADA-------HDPKNQYPPELMRRFELYFKAPGTLKPLSVRDVKANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCGAETYQPIASTSFMPLALCPSRDCQTNKSGGRLYLQSRGSKFVKFQELKIQEHSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITGIFLPVLKQGFRAMQQGLLSETFLEAHRVVKMNKTEDNEL-DVEELSESELRQITEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDRSPRGMKIRGNINICLMGDPGVAKSQLLCYIDRLAPRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTRALCSDGGGRTVAAGRASRIDDCVWLALMLPAALLSRFDLLWLIQDKPDRDNDIRLAQHITYVHQHCHQPPSQHT----------PLDMKLMRRYIALCQRR-QPAVPDTLADYITAAYVEMRKEARV-SKDTTFTSARTLLAILRLSTALARLRLVDVVEKEDVNE-MRLMEMSKDSLITDRGQPTRTQRPSDVIFSLIRELAPPDGTNRRVRYAEALSRCVSRGFTPAQVHTALDEYEELNVWHVNQARTAITFV 723          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Sea Lamprey
Match: mcm5 (minichromosome maintenance complex component 5 [Source:ZFIN;Acc:ZDB-GENE-021209-1])

HSP 1 Score: 268.855 bits (686), Expect = 2.113e-81
Identity = 166/442 (37.56%), Postives = 255/442 (57.69%), Query Frame = 1
Query:  715 KYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVF-LPLLNTGMRTLNRGLVTELFLDAHF-INRITKDESDDLGETI-----PATEAELEKLK-DPEMYSLMARSIAPEIFGHEDVKKGL--LXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAK-AGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKE-----SIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEAS 1992
            K V  Q +++QE  D VP G +PR M ++C       V PG+ + + G++ +    T M+   R        + +  +  IT D +D  G ++     P  E E+ +L   P +Y  +ARSIAP I+G  D+KK +  L++      +    T+ RG +N+ L+GDPG AKSQLL FV+R  P   YT+G+GSS AGLTASV+RD  T    +E G++VLADGG+ CIDEFDKM + DR AIHE MEQQTIS  +  GI TTLN+R S+LAAAN  +GR++  +  E+NID    +LSRFD++++I+D+ +   D+ LA+H+  VH N +   + +    G+      + ++ L++++A  RS+  P +       L   Y+ MR  ++   ++     SI  + R L A++RIS + ++++ Q       VDEA+RL + S
Sbjct:   28 KCVDYQTLKLQEAPDAVPHGEMPRHMQLYCDRYLCDRVVPGNRITVMGIYSIKKAFTKMQGKGRDRTGAGIRNPYLRVVGITVD-TDGAGRSMGIALHPQEEEEIRQLAASPSVYETIARSIAPSIYGFMDIKKAIASLLIGGSRKRLPDGLTR-RGDINLLLLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVMRDPATRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISTLRIGGITTTLNSRCSVLAAANSVFGRWDDSKG-EENIDFMPTILSRFDMIFIIKDEHNEKRDMILAKHVMNVHLNAK---TQMQAVEGE------IELSTLKKFIAYCRSKCGPRMSAEACEKLKNRYVLMRSGAREHDRDRDHRNSIPITVRQLEAIVRISESQAKMRLQPFATEAHVDEALRLFQVS 457          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008164.1 (pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:ENSPMAG00000007367.1 transcript:ENSPMAT00000008164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 251.136 bits (640), Expect = 1.104e-75
Identity = 156/424 (36.79%), Postives = 242/424 (57.08%), Query Frame = 1
Query:  430 RRYEAYFIARKTS---KALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEV-CKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVF--LPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAE-------LEKLKDPEMYSLMARSIAPEIFGHEDVKKGLL-XXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVH 1659
            +++E++++  + S   + LS R + S+ +G+++ ++ +V + ++V+P +  + + C        ++  + T L     +     K   +  L  +   S Y   Q I +QE+ ++ P G +PRS +V          +PGD V + G F  LP    G  +   G    + +  + + ++ K       E +P    E         K     ++  +++S+AP I GHE +KK +L +++ G   I   G++IRG +N+ L+GDP VAKSQ+L +V    PR+  T GRGSSG GLTA+V  DQ TGE  LEAG++VL D G+ CIDEFDKMTD DRTAIHEVMEQ  ++IAKAGI   LNAR S+LAAANP YGRY+  +T  +NI L  +LLSRFDLL+++ D+ D + D  ++ H+  +H
Sbjct:   30 KQFESFYVGLEGSFGARHLSPRTLTSRFLGNMVCVEGIVTKCSLVRPKVVRSVHYCPATQKSIERKYSDLTSLDAFPSSAAYPTKDEESNPLETEYGLSIYRDHQTISLQEMPEKAPAGQLPRSADVVLDDDLVDRCKPGDRVQVIGTFRCLPGKKAGYTS---GTFRTILI-GNNVKQMNK-------EVVPTFSGEDVNKIKTFSKTHSKNIFDQLSKSLAPSIHGHEYIKKAVLCLLLGGTEKILDNGSRIRGDINVLLIGDPSVAKSQMLRYVLHTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLGDRGVVCIDEFDKMTDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPIYGRYDQYKTPMENIGLQDSLLSRFDLLFIVLDQTDPEYDREISDHVLRMH 442          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Sea Lamprey
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:ZFIN;Acc:ZDB-GENE-120927-1])

HSP 1 Score: 239.965 bits (611), Expect = 3.723e-68
Identity = 174/559 (31.13%), Postives = 288/559 (51.52%), Query Frame = 1
Query:  481 IRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEI-LNKTLLPL--LTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEV--SDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVF-LPLLNTGMRTLNRG-LVTELFLDAHFINRITKDESDDLGE-TIP--ATEAELEKL-------KDPEMYSLMARSIAPEIFGHEDVKKGL---LXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNE----------APPSVLTTAAGDSAGLL------------------PLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSD 2013
            ++N+ +   G ++ ++  V+R   +KPL     ++C+ CG+E    +   K  LP   + C +E C+  T    + +++ ++ V  Q I++QE+   +Q   G IPR++             PGD + +TG+  +   + G    N+   +  L++ A  ++      SD  GE T P  A +  L++L         P ++ L+  SI P I+GHE VK GL   L       G D     +RG  ++ ++GDPG+ KSQ+L  V  + PR  Y  G  ++ AGLT ++ +D  +G+  LEAG+LVL D G+CCIDEFDKM +  + A+ E MEQQ+IS+AKAG++ +L AR SI+AAANP  G YN  +T+ +N+ + +ALLSRFDL++++ D PD + D  L++H+  +H              A P +  TA+  S  +L                  P+  + LR+Y+   R    P +       L   Y+ +R++   G    I T  R L +LIR++ A +R++ +    + D D+ I +++ S +   SD
Sbjct:  211 LKNLRANCYGRLVAIRGTVVRVGNIKPLCTRLAFSCNACGTEQVLRLPYGKFTLPTKRVKCADEDCRSRTF-MPNRRSQLTETVDWQNIKVQELMHGEQREAGRIPRTVECELTHDLVDSCVPGDVITLTGIVKVASSDEGRNKSNKDKCMFLLYIQAVAVSNTKGQRSDGGGEDTAPGVALDFSLKELYAVQEIQAQPHLFRLLVHSICPTIYGHELVKAGLALALFGGVQRYGTDKNRIPVRGDPHVLIVGDPGLGKSQMLQAVCNIAPRGVYVCGNTTTTAGLTVTLSKDGPSGDYALEAGALVLGDQGLCCIDEFDKMPNQHQ-ALLEAMEQQSISLAKAGVVCSLPARTSIVAAANPVCGHYNKSKTVSENLKMGSALLSRFDLVFILVDTPDEERDHVLSEHVMAMHAGKRMLAGASVSRAAAPGLKLTASSSSDDVLGGLSLSDRLKARRGEALDPVPHSLLRKYVGYARRYVRPCLSAEAAQTLQDFYLELRRQHHGGDGTPITT--RQLESLIRLTEARARLELRENATKEDADDVIDIMKHSFSDTLSD 765          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Yeast
Match: MCM7 (Component of the Mcm2-7 hexameric helicase complex; MCM2-7 primes origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation in S-phase; forms an Mcm4p-6p-7p subcomplex [Source:SGD;Acc:S000000406])

HSP 1 Score: 507.294 bits (1305), Expect = 3.652e-169
Identity = 309/754 (40.98%), Postives = 448/754 (59.42%), Query Frame = 1
Query:  115 YREQVLNISKQEQQAIYISLDDINEFDSE----------LAEVIEKNGFRYQKLICYAIDEIIHGMGRAT----VNKTAFDIFIDH-CLQIEQNLRDSANGI----------GQPLT--------IEDLRTKFPSELLRRYEAYF------IARK------TSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXX-XXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFT----SARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADS--STVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQ-VNVGRT 2214
            Y   +  ++ +E  ++ I LDDI ++ +E          L   I++N   + +L C AID   + M   T          D+ ++   L+ E+ L D  N I            P +        +ED    FP  L RRY  YF       AR+      +SK LS+R +    +G +I ++ ++ R + VKP +++  YTCD+CG E FQE+ ++T  PL  CT+E C    T G+L + T+ SK+   QE +IQE+S QVP+G+IPRS+N+H  G   R + PGD V +TG+FLP   TG + L  GL+TE +L+A F+ R  K +      T    E  +E +   ++Y+ +A+SIAPEI+G+ DVKK LL+++ GG       G KIRG +N+CLMGDPGVAKSQLL  + ++ PR  YT G+GSSG GLTA+V++D +T EM LE G+LVLAD GICCIDEFDKM +SDRTAIHEVMEQQTISI+KAGI TTLNAR SILAAANP YGRYNPR +   NI+LPAALLSRFD+L+L+ D P RD D +LA+H++YVH +N+ P    T          P+  +++R Y+A  +++  P + E + +Y+V  YI +R++SK    +S F+    + R+LL +IR+S AL++++    VD  DV+EA+RL+  SK S+  +  + +        I+  I+ +  ++  +T+   +I K     GFT  Q++  I  Y  LN+W  +N G T
Sbjct:   63 YMAMLQKVANRELNSVIIDLDDILQYQNEKFLQGTQADDLVSAIQQNANHFTELFCRAID---NNMPLPTKEIDYKDDVLDVILNQRRLRNERMLSDRTNEIRSENLMDTTMDPPSSMNDALREVVEDETELFPPNLTRRYFLYFKPLSQNCARRYRKKAISSKPLSVRQIKGDFLGQLITVRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTSEECSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPGDIVDVTGIFLPAPYTGFKALKAGLLTETYLEAQFV-RQHKKKFASFSLTSDVEERVMELITSGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGVDKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLDNINLPAALLSRFDILFLMLDIPSRDDDEKLAEHVTYVHMHNKQPDLDFT----------PVEPSKMREYIAYAKTK-RPVMSEAVNDYVVQAYIRLRQDSKR-EMDSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLVRVSKESLYQETNKSKEDESPTTKIFTIIKKMLQETGKNTLSYENIVKTVRLRGFTMLQLSNCIQEYSYLNVWHLINEGNT 800          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Yeast
Match: MCM6 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; forms a subcomplex with Mcm4p and Mcm7p [Source:SGD;Acc:S000003169])

HSP 1 Score: 318.546 bits (815), Expect = 7.584e-96
Identity = 243/755 (32.19%), Postives = 368/755 (48.74%), Query Frame = 1
Query:   40 ESDKDKFKNFIENFYEETSDSKKF--IYREQVLNISKQEQQAIYISLDDIN-EFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVN-------------KTAFDIFIDHCLQIEQNLRDSA------NGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGS-----ETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPL----------------------------LN---TGMRTLN-RGLVTEL-FLDAHFI------------------------------NRITKDESDD---LGETIPATE-AELEKL-KDPEMYSLMARSIAPEIFGHEDVKKG-LLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAG-SKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSD 2013
            E  ++ F+ F+E+F  +++D+ +   +YR Q+  +   +   IYI    ++   +  LA  I +  +R+   +   +  ++       +N             +   D   D  +      RDS       NG     T     +  P +  R ++  F    T     IR++ S+++GS++ +   V R + V+P +  A++TCD C +     E   +    T  P  +C N            L    S+++  Q++RIQE ++++P G++PR+++V   G +    +PGD    TGV + +                            LN   TG+R+L  R L  ++ FL  H I                              N + +D   D      ++ + E  EL+++ KD  +Y  + RSIAP +FGHE VKKG LL M+ G       G K+RG +NIC++GDP  +KSQ L +V    PRS YT+G+ SS AGLTA+VVRD+  G+ T+EAG+L+LAD GICCIDEFDKM  SD+ AIHE MEQQTISIAKAGI  TLNAR SILAAANP  GRYN + ++  N+++ A ++SRFDL ++I D  +   D  LA HI  +H               D A   P S  +LRRY+   R+   P + +   +YLV  Y  +RK+   G S+ S   + R L ++IR+S A++R  C  E+    + EA  LL  S   V  D
Sbjct:  109 EKVREAFEQFLEDFSVQSTDTGEVEKVYRAQIEFMKIYDLNTIYIDYQHLSMRENGALAMAISEQYYRFLPFLQKGLRRVVRKYAPELLNTSDSLKRSEGDEGQADEDEQQDDDMNGSSLPRDSGSSAAPGNGTSAMATRSITTSTSPEQTERVFQISFFNLPT--VHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENRAF-------WTLNVTRSRFLDWQKVRIQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSSTLDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRETELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMKR------------DEAIEPPFSAEQLRRYIKYARTF-KPILTKEARSYLVEKYKELRKDDAQGFSRSSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDVD 841          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Yeast
Match: MCM4 (Essential helicase component of heterohexameric MCM2-7 complexes; MCM2-7 complexes bind pre-replication complexes on DNA and melt DNA prior to replication; forms an Mcm4p-6p-7p subcomplex; shows nuclear accumulation in G1; homolog of S. pombe Cdc21p [Source:SGD;Acc:S000006223])

HSP 1 Score: 314.309 bits (804), Expect = 8.404e-95
Identity = 197/540 (36.48%), Postives = 303/540 (56.11%), Query Frame = 1
Query:  481 IRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVF--LPL-LNTGMRTLNRGLVTELFLDAHFINRIT------------------KDESDDLGETIPATEAELEKLKD----PEMYSLMARSIAPEIFGHEDVKKG-LLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRK---ESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSD 2013
            +R +   ++  +I LK +V+R+T V P MK+A + C+ C      EI    +     C    C       + L      +   Q I++QE  D VP G  P S+++          + GD + +TG F  +P+  N+  R L    + + ++D   + +++                  K + +++ E    T+ +L K+++     ++YSL+ARSIAP I+  EDVKKG LL +  G       G + RG +NI L GDP  +KSQ+L +V ++ PR  YT+G+GSS  GLTA + RD  T ++ LE+G+LVL+DGG+CCIDEFDKM+DS R+ +HEVMEQQTISIAKAGI+TTLNAR+SILA+ANP   RYNP   + +NIDLP  LLSRFDL++L+ DK D   D  LA+H++ ++   E  P  ++        +LP+    L  Y++  +    P + E     LV  Y+ MRK   +S++  K  I  + R L ++IR++ A +++K +  V+  DV EA+RL+ ++     +D
Sbjct:  314 MRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCERIDC--NEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKS--LYKTYVDVVHVKKVSDKRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYL--EDKPEHIS-----QDDVLPVEF--LTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKR-ITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATD 839          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Yeast
Match: MCM5 (Component of the Mcm2-7 hexameric helicase complex; MCM complex is important for priming origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation when activated by Cdc7p-Dbf4p in S-phase [Source:SGD;Acc:S000004264])

HSP 1 Score: 293.123 bits (749), Expect = 2.650e-88
Identity = 218/695 (31.37%), Postives = 357/695 (51.37%), Query Frame = 1
Query:   58 FKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAY-FIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSET------FQEILNKTL-LP---LLTCTNEVCKIGTAGRLHLQTK-------------GSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTG-----MRTLNRGLVTELFLDAHFINRITKDESDDLGETIPAT---------EAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLL-XXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRK-----ESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKS 2010
            FKNFI  F  ++    +FIYR+Q+ N    +  ++ ++++ +  ++ ++          Y+KL     D  I  +    + + A  I       I    + + N    P   E+      S LL     +  I    +  + +R++ S+ +  +++L  ++I  +++       +  C  C   T      F  I   T+ LP   L T  +E      +      TK              SK++  Q +++QE+ + VP+G +PR++ + C    T  V PG  V I G++  + N+       R+      + + +   +I +I   +SD    +I  +         E  L+  ++P++Y ++  SIAP IFG+ED+KK ++ ++M G   I   G ++RG +N+ L+GDPG AKSQLL FV+++ P + YT+G+GSS AGLTASV RD +T E  LE G++VLADGG+ CIDEFDKM D DR AIHE MEQQTISIAKAGI T LN+R S+LAAANP YGRY+  ++   NID    +LSRFD++++++D  + + D+ +A H+  +HT N           G       +S+ +++RY+   R +  P +       L   ++++RK     E ++  + SI  + R L A+IRI+ +L++++         VDEAIRL +AS     S
Sbjct:   31 FKNFILEFRLDS----QFIYRDQLRNNILVKNYSLTVNMEHLIGYNEDI----------YKKLSDEPSD--IIPLFETAITQVAKRI------SILSRAQSANNNDKDP---ENTSMDTDSLLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNCRHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDPYIIIHESSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIY-SIYNSKNGAGSGRSGGGNGGSGVAIRTPYI-KILGIQSDVETSSIWNSVTMFTEEEEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSE-----ISIEKMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEAIIRITESLAKLELSPIAQERHVDEAIRLFQASTMDAAS 693          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Yeast
Match: MCM2 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000000119])

HSP 1 Score: 271.937 bits (694), Expect = 9.596e-80
Identity = 182/558 (32.62%), Postives = 287/558 (51.43%), Query Frame = 1
Query:  478 SIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGS---ETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINR---ITKDESDDLGETIPATEAELEKLK----DPEMYSLMARSIAPEIFGHEDVKKGL-LXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLA-----QHISYVHTNNEAPPSVLTTAAGDSA---------------------------GLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRL-----LEASKASVK 2007
            S+R +    + S++++  VV R T V P +K   + C +CGS     FQ+   +  +    CTN  CK  + G   +  + + Y   Q + +QE    VP G +PR   V  +     + +PG+ V +TG++    +  +   N   V    ++A+ I R    T +E ++  +    TE E  + +    D  +   +  S+AP I+GH D+K  +   +  G          IRG +N+ L+GDPG AKSQ+L +V++   R+ +  G+G+S  GLTASV +D +T E TLE G+LVLAD G+C IDEFDKM D DRT+IHE MEQQ+ISI+KAGI+TTL AR SI+AAANP  GRYN    + QN+ L   +LSRFD+L +++D  D + D RLA      H+     N+E          G+SA                            + P+    L +Y+   R++  P + +  ++ +   Y  +R+ES   S  S   + R L +++RI+ + ++++    V   D+D AI++     ++A K SV+
Sbjct:  305 SLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIRISF--CTN--CK--SKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIYKNNYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDMDKVSRVYADLRRESI--STGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKVVVDSFVDAQKVSVR 854          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Nematostella
Match: EDO37946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEF9])

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 381/737 (51.70%), Postives = 525/737 (71.23%), Query Frame = 1
Query:   28 MRNYESDKDKFKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMG-RATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAG-RLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLK-DPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            M +Y+ + DK K F+  FY +  + K+F Y EQ++ I+ +EQQ + I LDDI E D +LAE +++N  RY++L   AI E++     R    K A DI+I+H L +EQ  R+  N  G  +   D RTK+P ELLRR+E  F    T K  S+RNV +  +G +  ++ +V+R T VKP++++ATYTCD+CG+E++Q I ++T +PLL C +E CK   AG RL+LQT+GSK+VK QE++IQE SDQVP+G+IPRSM +   G NTRL  PGDHV +TG+FLP++ TG R + +GL+++ FL+AH I R+ K E D++  T   ++ E+  L  + + Y  +A S+APEI+GHED+KK LL+++ GG      G KIRG++NI LMGDPGVAKSQ+L ++DRL PRSQYT GRGS+G GLTA+V++D LTGEM LE G+LVLAD G+CCIDEFDKM D DRTAIHEVMEQQT+SIAKAGIMTTLNAR SILAAANPAYGRYNP+++ EQNI LPAALLSRFDLLWLIQDKPD++ DLRLAQHI+YVH ++  PPS             PL M  +RRY+A  + +  P VP  L +Y+V  Y+ MRK+++  + ++ FTSAR+LLA++R++TAL+R++    V++ DV+EA+RL+E SKAS+  D    R  +   + IY  I+ +A D+S+V+M +  ++C+S GFTPDQ  + +  YE L++WQ+N  +TRI  V
Sbjct:    1 MPDYQEELDKAKRFLAEFYVQEDEGKEFKYGEQLIKIAHREQQELLIELDDIAEIDQDLAENVKENTRRYKRLFEDAIYEMLPEYKEREVQTKDALDIYIEHRLLLEQ--RNRQNEPGGAI---DPRTKYPPELLRRFEVNFKHLSTQKHESVRNVKADCIGKLTVVRGIVMRCTEVKPVVEVATYTCDQCGAESYQTIQSQTFMPLLMCPSEECKTNRAGGRLYLQTRGSKFVKFQELKIQEHSDQVPVGHIPRSMTIIAKGENTRLATPGDHVSVTGIFLPMMKTGFRQMTQGLLSDTFLEAHRIVRMNKTEDDEM-PTDDLSDEEIRALSTEADFYDKLASSLAPEIYGHEDIKKALLLLLVGGVDCTPHGMKIRGNINILLMGDPGVAKSQMLSYIDRLAPRSQYTTGRGSTGVGLTAAVMKDPLTGEMILEGGALVLADKGVCCIDEFDKMMDGDRTAIHEVMEQQTVSIAKAGIMTTLNARVSILAAANPAYGRYNPKKSAEQNIQLPAALLSRFDLLWLIQDKPDKENDLRLAQHITYVHQHSAHPPSHYD----------PLDMNLMRRYIAACKEK-QPIVPGELSDYIVSAYVEMRKDAR-NNHDTTFTSARTLLAVLRLATALARLRLADVVEKEDVNEAMRLMEMSKASLSDDEGTVRV-VDPVDAIYGIIKEIAGDASSVKMQEAKQRCLSKGFTPDQFQKCLQEYENLDVWQINQKQTRITFV 718          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Nematostella
Match: EDO48453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIT1])

HSP 1 Score: 305.449 bits (781), Expect = 7.181e-93
Identity = 223/679 (32.84%), Postives = 339/679 (49.93%), Query Frame = 1
Query:   34 NYESDKDKFKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGR-------LHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVF-----LPLLNTGMRTLNRGL------VTELFLDAHFINRITKDESDDLGETIPATEAELEKLKD-PEMYSLMARSIAPEIFGHEDVKK--GLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKE-----SIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEAS 1992
            N  S K +FK F+  F+E T     F YR+Q+       Q  + + L+D++ FD  LA+ + KN   Y  L   A  E+   + R         I  +    ++  LR  AN    P  I +LR                              S+ M +++K+  ++I A+ ++      T  C  C   T   I  K  L       + C     GR         +     K V  Q +++QE  D VP G +PR M ++C    T  V PG+ V + G++         N     +  G+      V  +++D     R T    +      PA E E  +L   P++  ++ARSIAP I+G  D+KK    L+       +    T+ RG +N+ L+GDPG AKSQLL FV+++ P   YT+G+GSS AGLTASV+RD ++    +E G++VLADGG+ CIDEFDKM + DR AIHE MEQQTISIAKAGI TTLN+R ++LAAAN  +GR++  +  +QNID    +LSRFD +++++D+ ++  D+ LA+H+  VH N     +  TT A +      LS++ L++Y++  +S+  P + E+    L   Y+ MR  +K   ++     SI  + R L A+IRIS +L+++          VDEA+RL + S
Sbjct:   27 NRVSAKKRFKEFLREFHEGTF---AFPYRDQLKQHYNLGQYYLEVDLEDLSSFDENLADKLRKNPSEYLPLFETAAKEVADEVTRPR------PIGEEEVQDVQITLRSGAN----PFQIRELR------------------------------SEHMAALVKIPGIIISASSIRSKATNITIQCRSC-QNTISSIPLKPGLEGYAMPRK-CPTDQTGRPPCPLDPFFIMPDKCKCVDFQVLKLQESPDAVPNGEMPRHMQLYCDRYLTERVVPGNRVTVIGIYSIKKVAQKANKERDAIGVGIRKPYLRVVGIYVDTEGPGRSTGAPMN------PADEEEFRRLATRPDVADVIARSIAPSIYGSVDIKKCIACLLFGGSRKRLPDGLTR-RGDINVLLLGDPGTAKSQLLKFVEKVSPIGVYTSGKGSSAAGLTASVMRDPVSRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCAVLAAANSVFGRWDDTKG-DQNIDFMPTILSRFDTIFIVKDEHNQAKDIHLAKHVMQVHLN-----AAQTTQANEGE----LSLSFLKKYISYCKSKCGPRLSESAAEKLKNRYVLMRSGAKEHERDTEKKISIPITVRQLEAIIRISESLAKMSLSPFATETHVDEALRLFQVS 643          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Nematostella
Match: EDO33971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQR1])

HSP 1 Score: 303.908 bits (777), Expect = 1.821e-91
Identity = 215/694 (30.98%), Postives = 344/694 (49.57%), Query Frame = 1
Query:   52 DKFKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGS---ETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLN------------TGMRTLN---------RGL----VTELFLDAHFINRITK-----------DESDDLGETIPA--TEAELEKL----KDPEMYSLMARSIAPEIFGHEDVKKG-LLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIF-TSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEAS 1992
            D+ +   ++F EE     +  Y      + + E+  + +S  D+  ++++LA +I+++ +R    +C A+       G+   NK  +  FID                                L  R++             IR + S+++GS++++   V+R   V P +  AT+TC  C +   +  Q+   K   P + C N +C+     R  L    S+YV  Q++RIQE   ++P G IPRS+ V          Q GD    TG  + + +            TG R  +         RGL    V +L     F+    +           D  D   E I    T  E +K+    +D  +Y  +  SI P I G+++VK+G LL++  G        T +RG +NIC++GDP  AKSQ L  V+    R+ YT+G+ SS AGLTA+VV+D+ + E  +EAG+++LAD G+CCIDEFDKM   D+ AIHE MEQQTIS+ KAG+  +LNAR S+LAAANP  GRY+  ++++QN+++ A ++SRFDL +++ D+ +   D  +A+ I  +H+  E   SV    A D          E++RYL   R Q  P + +   +Y+V  Y  +R+   + + +S +  + R L ++IR+S A++R+ CQ +V+   V EA RLL  S
Sbjct:   19 DRCQKLFQDFLEEFELDGEVKYLADAQELIRPERNTLVVSYQDVESYNAQLATLIQEDYYRVFPYLCQAVRNFARDRGQVPPNKEFYVSFID--------------------------------LPTRHK-------------IRELTSQKIGSLLRISGQVVRTHPVHPELVTATFTCLDCQTVIKDVEQQF--KYTQPTV-CRNPICQ--NRARFALDINKSRYVDFQKVRIQETQAELPRGCIPRSVEVILRAEAVEQAQAGDKCDFTGTLIVVPDIAQLATPGTRSETGQRQTSGEGYEAEGVRGLKALGVRDLTYRLSFLACSVQATNPRFGGKDLDGDDMTAEAIKKQMTPQEWQKIYEMSRDKNLYQNIINSIFPTIHGNDEVKRGVLLMLFGGVPKKTLEKTSLRGDINICVVGDPSTAKSQFLKHVEEFSARAVYTSGKASSAAGLTAAVVKDEESSEFVIEAGAMMLADNGVCCIDEFDKMDPRDQVAIHEAMEQQTISLTKAGVKASLNARTSVLAAANPIGGRYDRTKSLKQNLNMSAPIMSRFDLFFILVDECNEVVDYAIARRIVDLHSRREQ--SVERVYAVD----------EVQRYLTFAR-QFKPTITKEAQDYMVEQYKHLRERDGSSTTKSAWRITVRQLESMIRLSEAMARLYCQDKVEPKHVKEAYRLLNKS 649          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Nematostella
Match: EDO35060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMI2])

HSP 1 Score: 274.633 bits (701), Expect = 1.258e-80
Identity = 177/522 (33.91%), Postives = 277/522 (53.07%), Query Frame = 1
Query:  481 IRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTA------GRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKL----KDPEMYSLMARSIAPEIFGHEDVKKGL-LXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRR----------YLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLL 1983
            +R++    +  +I+   VV  +T + P + +  Y C +C            L P    +++  K G+       G   +  + + Y   Q+I+IQE   +V  G +PR  +V  +       +PGD + +TG++    ++ +   N   V    ++A+FI +      DD       T+ +++ +    KD  +   +  SI P I+GHED+K+ L L +  G A       KIRG +N+ L GDPG AKSQ L +V++  PR+ +T G+G+S  GLTA V R  +T E TLEAG+LVLAD G+C IDEFDKM D+DRT+IHE MEQQ+ISI+KAGI+T+L AR SILAAANP  GRY+P  T  +N+DL   +LSRFD+L +++D  D   D  LA+ +   H  +   P+       D    + + M  LRR          Y+   R +  P +     + +   +  +RKES A    SI  + R + ++IR++ + +++  +  V   DV+ AIR++
Sbjct:  218 LRSLRQLHVNQLIRTGGVVTSSTGIMPQLSVIKYDCPKCSF---------ILGPFFQGSDQEVKPGSCPECQSRGPFEINMEQTLYQNYQKIKIQESPSKVAAGRLPRYKDVILMADLVDSCKPGDEIELTGIYKINYDSSLNRSNGFPVFATIIEANFITK-----QDDKMAVTSLTDEDIKAINALSKDERIGERIIASIGPSIYGHEDIKRALALSLFGGVAKDPGGKHKIRGDINVLLCGDPGTAKSQFLKYVEKTAPRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADKGMCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCSILAAANPIGGRYDPSLTFAENVDLTEPILSRFDILCVVRDTVDAIQDELLARFVVNSHVRHH--PNTPENEDED----MEVHMFTLRRNAIPQDLLKKYMIYARERVHPRLNNMDQDKVAKMFADLRKESMATG--SIPITVRHIESMIRMAESHAKMHLREYVMEDDVNMAIRVM 717          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Nematostella
Match: EDO34425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPE9])

HSP 1 Score: 258.455 bits (659), Expect = 4.755e-75
Identity = 179/569 (31.46%), Postives = 302/569 (53.08%), Query Frame = 1
Query:  418 SELLRRYEAYFIARKTS---KALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLL-TCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVF--LPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKD---PEMYSLMARSIAPEIFGHEDVKKGLL-XXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVH-------TNNEAPP-----SVLTTAAGDSAGLL----------PL-------------SMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFT--SARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLL 1983
            +E  +++E +F+  + S   K ++ R++ S+ +GS++ ++ +V + ++V+P +  + + C +      ++  + T L  + T +    K      L  +     Y   Q   IQE+ ++ P G +PRS+++          +PGD V + G +  LP       +   G  +  F     +N + +  S ++     A++    K       +++ ++A+S+AP I GHE +KK +L +++ G   +   GT++RG +NI L+GDP  AKSQ+L +V    PR+  T GRGSSG GLTA+V  D  TG+  LEAG++VLAD G+ CIDEFDKM+D DRTAIHEVMEQ  ++I+KAGI   LNAR S+LAAANP +GRY+  +    NI +  +LLSRFDLL+++ D+ D D D R+++H+  +H          EA P      VL T   D               P+             SMA +++Y+ + ++   PA+ +   + +   Y  +R +   G+ ++  T  +AR+L  +IR+STA ++ +    +   D   A+ ++
Sbjct:   86 TEYGKKHEEFFVGFEGSFGSKHVTPRSLSSRYIGSMVCVEGIVTKCSLVRPKVVRSVHYCPKTKKTLIRKYTDMTSLEAVPTSSVYPTKDEDGNPLETEYGLCTYKDHQTFTIQEMPERAPAGQLPRSVDIIADNDLVDKCKPGDRVQVIGTYRCLP-------SKRSGFTSGTFRTVLIVNNV-QVMSKEVAPNFSASDISKIKKFSKSKQDVFEVLAKSLAPSIHGHEFIKKAVLCLLLGGTEKVLENGTRLRGDINILLIGDPSTAKSQMLRYVLHSAPRAIPTTGRGSSGVGLTAAVTTDPETGDRRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHAKLNARCSVLAAANPVFGRYDEFKNPMDNIGMQDSLLSRFDLLFIVLDQMDPDNDRRISEHVLRIHRYRKPGEQEGEALPFGEESDVLATRDPDQEEEDEDTPVYEKHDPMLFGKQKDKKDKFVSMAFMKKYIHVAKAI-KPALTKPAADLISKAYSELRDQENIGNDKAKTTPVTARTLETMIRLSTAHAKARMSKTITEGDAQAAVDMV 645          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Medaka
Match: mcm7 (minichromosome maintenance complex component 7 [Source:NCBI gene;Acc:101165815])

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 390/744 (52.42%), Postives = 526/744 (70.70%), Query Frame = 1
Query:   31 RNYESDKDKFKNFIENFYEETSDSKK-FIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMG-RATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIG-TAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAAD--------SSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLV 2229
            ++Y ++K+K K F++ FY E  + KK F Y  Q++ ++ +EQ  +++ LDD+ E D EL E I +N  RY  L   A+ E++     R  V K + D++I+H L +EQ L+DSA+         D R ++P EL+RR+E YF    TSK+  +R++ +  +G ++ ++ +V RAT VKP+M +ATYTCD+CG+ET+Q I + + +PL+ C ++ C    + GRL+LQT+GSK+VK QE+RIQE SDQVP+GNIPRSM V+  G NTRL QPGDHV ITGVFLPLL +G     +GL++E +L+AH I  + K E D+L  T   ++ EL  + +   Y  +A SIAPEI+GHEDVKK LL+++ GG      G KIRGS+NICLMGDPGVAKSQLL ++DRL PRSQYT GRGSSG GLTA+V+RD LTGEMTLE G+LVLAD G+CCIDEFDKM D+DRTAIHEVMEQQTISIAKAGIMT+LNAR SILAAANPAYGRYNPR++IE NI LPAALLSRFDLLWLIQDKPD D DLRLAQHI+YVH +   PP+  T          P+ M  +RRY+A+ + +  P VPE L +Y+   Y+ MRKE++  SK++ FTSAR+LL+++R+STAL+R++    V++ DV+EA+RL+E SK S+++D++         ++I+  +R LA +           VRMA+  ++CVS GFTP Q  E ++ YEELN+WQ+N  R+RI  V
Sbjct:    4 KDYAAEKEKCKRFLQEFYTEDGNGKKVFKYGAQLVALAHREQVGLFVELDDVAEEDPELVESISENAKRYTGLFADAVHELLPEYKERDVVAKDSLDVYIEHRLMMEQRLQDSAD-------TRDSRNQYPPELMRRFELYFKPASTSKSKVVRDIRADSIGQLVTVRGIVTRATEVKPMMAVATYTCDQCGAETYQPIQSPSFMPLIMCPSQECVTNKSGGRLYLQTRGSKFVKFQELRIQEHSDQVPVGNIPRSMTVYARGENTRLAQPGDHVAITGVFLPLLRSGYSQAIQGLLSETYLEAHNITLMNKTEDDELA-TEELSDEELRSITEEGFYEKLAGSIAPEIYGHEDVKKALLLLLVGGVEQAPKGMKIRGSINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMRDPLTGEMTLEGGALVLADLGVCCIDEFDKMADADRTAIHEVMEQQTISIAKAGIMTSLNARCSILAAANPAYGRYNPRKSIEANIQLPAALLSRFDLLWLIQDKPDADADLRLAQHITYVHQHCRQPPTHFT----------PIDMKLMRRYIALCKKR-QPVVPEALADYITAAYVEMRKEARV-SKDTTFTSARTLLSILRLSTALARLRMMDTVEKEDVNEAMRLMEMSKDSLQADKSSATRAHRPADVIFSLVRELATESAAGRGGSGGVVRMAEAEQRCVSRGFTPAQFQEALEEYEELNVWQINQARSRITFV 727          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Medaka
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:101173977])

HSP 1 Score: 323.168 bits (827), Expect = 3.764e-98
Identity = 234/679 (34.46%), Postives = 354/679 (52.14%), Query Frame = 1
Query:   49 KDKFKNFIENFYEETS--------DSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPL-LNTGMRTLNRGLVTELFLDA-HFINRITKDES----DDLGETIPATEAELEKLKD----PEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXT---KIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTS-ARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLL-EASKASVKSDR 2016
            K+KF+ F++ F + TS        D  + +Y +++  IS      + ++   +  FD+EL          Y++LICY   E+I     A VN+  F+ F D  L+ +  +R              L+TK                      ++RN+  +++  +I L  +VIR + + P M+ A + C  C      E+    +     C N  C       + L    S +   Q I+IQE  + +P G  P +  ++        VQPGD V ITG++  + +    R  N   V +  +DA HF  R T ++     D  GE    TE  ++ LK+    P++Y  +A ++AP I+ HED+KKG+L+ + GG   D + T     R  +NI L GDPG +KSQLL +V  L PR QYT+G+GSS  GLTA V++D  T ++ L+ G+LVL+D GICCIDEFDKM+D+ R+ +HEVMEQQT+SIAKAGI+  LNAR ++LAAANP   ++NP++T  +NI LP  LLSRFDL++L+ D  D   D RLA H+  ++  +E           +      L MA L+ Y+A  R+   P + E     L+  Y+ MR   K GS   + ++  R L +LIR++ A ++++   +V+ IDV+EA RL  EA K S    R
Sbjct:  122 KEKFQRFLQRFIDPTSTEDENAGLDLNEPLYMQKLEEISVVGDPVLNVNCRHVQSFDAEL----------YRQLICYP-QEVIPTFDMA-VNELFFERFPDSVLEYQIQVR----------PYNALKTK----------------------NMRNLNPEDIDQLITLGGMVIRTSQLIPEMQEAFFQCQVCAFSARVEVDRGRIAEPAVCRN--C--NNTHSMTLVHNRSVFSDKQMIKIQESPEDMPAGQTPHTTILYAHNDLVDKVQPGDRVNITGIYRAVPMRVHPRQSNVRSVYKTHIDAIHF--RKTDEKRLHGLDQDGEQKLFTEDRVQTLKELAAKPDVYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGNFRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTAVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSE-----------EQMEEEFLDMAVLKDYIAYARTYISPRLSEEASQALIEAYVDMR---KIGSGRGMVSAYPRQLESLIRLAEAHAKVRFSEKVETIDVEEAKRLHREALKQSATDPR 736          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Medaka
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:101173977])

HSP 1 Score: 322.398 bits (825), Expect = 8.649e-98
Identity = 234/679 (34.46%), Postives = 354/679 (52.14%), Query Frame = 1
Query:   49 KDKFKNFIENFYEETS--------DSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPL-LNTGMRTLNRGLVTELFLDA-HFINRITKDES----DDLGETIPATEAELEKLKD----PEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXT---KIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTS-ARSLLALIRISTALSRIKCQTEVDRIDVDEAIRL-LEASKASVKSDR 2016
            K+KF+ F++ F + TS        D  + +Y +++  IS      + ++   +  FD+EL          Y++LICY   E+I     A VN+  F+ F D  L+ +  +R              L+TK                      ++RN+  +++  +I L  +VIR + + P M+ A + C  C      E+    +     C N  C       + L    S +   Q I+IQE  + +P G  P +  ++        VQPGD V ITG++  + +    R  N   V +  +DA HF  R T ++     D  GE    TE  ++ LK+    P++Y  +A ++AP I+ HED+KKG+L+ + GG   D + T     R  +NI L GDPG +KSQLL +V  L PR QYT+G+GSS  GLTA V++D  T ++ L+ G+LVL+D GICCIDEFDKM+D+ R+ +HEVMEQQT+SIAKAGI+  LNAR ++LAAANP   ++NP++T  +NI LP  LLSRFDL++L+ D  D   D RLA H+  ++  +E           +      L MA L+ Y+A  R+   P + E     L+  Y+ MR   K GS   + ++  R L +LIR++ A ++++   +V+ IDV+EA RL  EA K S    R
Sbjct:  158 KEKFQRFLQRFIDPTSTEDENAGLDLNEPLYMQKLEEISVVGDPVLNVNCRHVQSFDAEL----------YRQLICYP-QEVIPTFDMA-VNELFFERFPDSVLEYQIQVR----------PYNALKTK----------------------NMRNLNPEDIDQLITLGGMVIRTSQLIPEMQEAFFQCQVCAFSARVEVDRGRIAEPAVCRN--C--NNTHSMTLVHNRSVFSDKQMIKIQESPEDMPAGQTPHTTILYAHNDLVDKVQPGDRVNITGIYRAVPMRVHPRQSNVRSVYKTHIDAIHF--RKTDEKRLHGLDQDGEQKLFTEDRVQTLKELAAKPDVYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGNFRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTAVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSE-----------EQMEEEFLDMAVLKDYIAYARTYISPRLSEEASQALIEAYVDMR---KIGSGRGMVSAYPRQLESLIRLAEAHAKVRFSEKVETIDVEEAKRLHREALKQSATDPR 772          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Medaka
Match: mcm6 (minichromosome maintenance complex component 6 [Source:NCBI gene;Acc:101159855])

HSP 1 Score: 317.39 bits (812), Expect = 4.673e-96
Identity = 227/698 (32.52%), Postives = 338/698 (48.42%), Query Frame = 1
Query:   58 FKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFL----------PLLNT----------------GMRTLNRGLVTEL-----FL-------DAHFINRITKDESDDLGETIPA--TEAELEKL----KDPEMYSLMARSIAPEIFGHEDVKKG-LLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAG--SKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKS 2010
            F+ F+E F  +T+D +    RE    + + E+  + +S  D+  F+ ELA  I++  +R    +C A+       G   + K  +                        + IEDL T+                       IR + S  +G+++K+   V+R   V P +   T+ C  C              P   C N VC      R HL T  SK++  Q++RIQE   ++P G+IPRS+ V          Q GD    TG  +          P L                  G+R L    V EL     FL       +  F  +  +DE +   E+I +  TE E EK+    +D  +Y  +  S+ P I G+++VK+G LL++  G       GT +RG +N+C++GDP  AKSQ L  V+   PR+ YT+G+ S+ AGLTA+VVRD+ + E  +EAG+L+LAD G+CCIDEFDKM   D+ AIHE MEQQTISI KAG+  TLNAR SILAAANP  GRY+  ++++QN++L A ++SRFDL +++ D  +   D  +A+ I  +H+  E     L             S+ E+RRYL   R Q  P + +    ++V  Y  +R+    G  SK +   + R L ++IR+S A++R+ C  EV    V EA RLL  S   V++
Sbjct:   27 FQAFLEEF--QTADGEVKYLREGE-ELIRPERNTLVVSFTDLEGFNQELATTIQEEYYRVYPYLCRAVRNFARDHGNVPLTKEFY------------------------VAIEDLPTRH---------------------KIRELSSMRIGTLVKISCQVVRTHPVHPELVSGTFVCMDCQMVIKDVPQQFKYSPPTICRNPVC--SNRSRFHLDTHKSKFIDFQKVRIQETQAELPRGSIPRSLEVVLRAEAVETAQAGDRCDFTGTLIVVPDVSQLSTPGLRAETSSRVGGGRQGYEAEGLRGLKALGVRELSYRLAFLACNVAPTNPRFGGKELRDE-EQTAESIKSQMTEKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDVNVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASTAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDIKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVGGRYDRSKSLKQNVNLTAPIMSRFDLFFILVDDCNEVTDYAIARRIVDLHSRVEESVDRL------------YSLDEIRRYLLFAR-QFKPKISKESEEFIVEQYKRLRQRDSTGSVSKSAWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVET 660          
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Medaka
Match: mcm5 (minichromosome maintenance complex component 5 [Source:NCBI gene;Acc:101167880])

HSP 1 Score: 299.671 bits (766), Expect = 5.135e-90
Identity = 195/530 (36.79%), Postives = 289/530 (54.53%), Query Frame = 1
Query:  478 SIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLT--CTNEVCKIGTAGRLHLQTKGSKY---------VKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRI---TKDESDDLGETIPATEAELEKLK----DPEMYSLMARSIAPEIFGHEDVKKGL--LXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKE-----SIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEAS 1992
            SIRN+ S+++  ++K+  ++I AT VK         C  C S     I N  L P L        C    AGR+  +     Y         V  Q +R+QE  D VP G +PR + ++C       V PG+ V I G++       ++   +     + + + ++  +      E    G T P +  E E+L+     P +YS +A+S+AP I+G +D+KK +  L+       +    T+ RG +N+ ++GDPG AKSQLL FV+R  P   YT+G+GSS AGLTASV+RD  T    +E G++VLADGG+ CIDEFDKM + DR AIHE MEQQTISIAKAGI TTLN+R S+LAAAN  YGR++  +  E NID    +LSRFD++++I+D  D+  D+ LA+H+  VH + +       T      G +PL  A  ++Y+A  R++  P +       L   Y+ MR  ++   +E     SI  + R L A+IRI+ +L+++K Q      +VDEA+RL + S
Sbjct:  152 SIRNLKSEQVSRLVKVHGIIISATAVKAKATKVCLQCRGCRSV----IPNIPLPPGLQGYALPRKCNSENAGRV--KCPMDPYFIIPDRCVCVDFQTLRLQESPDAVPHGEMPRHLQLYCDRYLCDRVVPGNRVTIMGIYSIKKMAAVKAKGKEKGIGVGIRSSYLRVVGIQVDTEGAGRGATGPVSAQEEEELRALSTSPNIYSSLAQSLAPSIYGSDDLKKAITCLLFGGSRKRLPDGLTR-RGDINLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVLRDPSTRGFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVYGRWDDTKG-EDNIDFMPTILSRFDMIFIIKDHHDQQRDMTLARHVMNVHLSAQ-------TQTEGVEGEIPL--ATFKKYIAYARAKCGPRLSAAAAEKLKNRYVVMRSGAREHERESDKRPSIPITVRQLEAVIRIAESLAKMKLQAVAGEEEVDEALRLFQVS 664          
BLAST of DNA replication licensing factor MCM7 vs. Planmine SMEST
Match: SMESG000057772.1 (SMESG000057772.1)

HSP 1 Score: 1489.94 bits (3856), Expect = 0.000e+0
Identity = 737/738 (99.86%), Postives = 737/738 (99.86%), Query Frame = 1
Query:   19 MVFMRNYESDKDKFKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLVN 2232
            MVFMRNYESDKDK KNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLIMMAGGAGIDAAGTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLVN
Sbjct:    1 MVFMRNYESDKDKLKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLIMMAGGAGIDAAGTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLVN 738          
BLAST of DNA replication licensing factor MCM7 vs. Planmine SMEST
Match: SMESG000057772.1 (SMESG000057772.1)

HSP 1 Score: 1483.39 bits (3839), Expect = 0.000e+0
Identity = 734/735 (99.86%), Postives = 734/735 (99.86%), Query Frame = 1
Query:   28 MRNYESDKDKFKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLVN 2232
            MRNYESDKDK KNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLIMMAGGAGIDAAGTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLVN
Sbjct:    1 MRNYESDKDKLKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLIMMAGGAGIDAAGTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVRMADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLVN 735          
BLAST of DNA replication licensing factor MCM7 vs. Planmine SMEST
Match: SMESG000038798.1 (SMESG000038798.1)

HSP 1 Score: 301.212 bits (770), Expect = 1.730e-90
Identity = 222/691 (32.13%), Postives = 340/691 (49.20%), Query Frame = 1
Query:   58 FKNFIENFYEETSDSKKFIYREQVLNISKQEQQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVNKTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYFIARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLT-CTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITG--VFLP----LLNTGMRTLN----------------------RGLVTELFLDAHFINRITKD--ESDDLGE---------TIPATEAELEKL----KDPEMYSLMARSIAPEIFGHEDVKKGLLXXXXXXX-XXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMR-KESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEAS 1992
            F N +ENF  +  D  +F Y E    ++  E+  + +S  D+  +DS L++ I  N +R    +C A    I+     T N                                           R Y  +FI   T    ++RN+    +G ++K +  VIR+  V P + + T+ C  CG+   + I  + +    T C N  C      +  L  + SKYV  Q++R+QE  +++P G IPR M+V          QPGD    TG  + +P    L   G RTL                       R L   +   A+ +  +     +++D+ E             TE E+ K+    +DP +   M   + P  +G+++VK+GLL+M+ GG   +   GTK+RG +NIC++GDP  AKSQ L  +    PR+ YT+G+ SS AGLTA+VVRDQ +GE  +EAG+L+LA+ G+CCIDEFDKM   D+ AIHE MEQQTIS+ KAGI  TLNA+ S+LAAANP  GRY+  R++ QNI L A ++SRFDL +++ D+     D  +A+ I    T ++ P         + +     +  +++RY+   R   +P V E     +V  Y  MR +++ +GS+ +   + R L +L+R+S A +R++    V+  DV EA RLL  S
Sbjct:   25 FLNLLENF--KVGD--EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFLCQATQIFINKQFDETENND-----------------------------------------RTYTCHFIDFPT--LTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGT-VVKNIEQQFIFTKPTICGNPQCM--NRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRI----TESQRP------VDPEKSDTRIYNEDDIQRYITFARC-FEPRVTEEAFKLMVTEYAKMRERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKS 654          
BLAST of DNA replication licensing factor MCM7 vs. Planmine SMEST
Match: SMESG000060238.1 (SMESG000060238.1)

HSP 1 Score: 289.271 bits (739), Expect = 3.575e-86
Identity = 188/515 (36.50%), Postives = 284/515 (55.15%), Query Frame = 1
Query:  478 SIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLL---NTGMRTLNRGLVTELFLDA-HF---INRITKDESDDLG-ETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLXX----XXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHIS--YVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRL 1980
            ++RN+  +++  ++ +  +VIR + + P M  A + C  C + T        ++    C N+     T   +H      +++  Q +++QE  + +P G  P ++ ++C       +QPGD V +TG++       N+  R +    V + +LD  HF    NR+  +E   L  E +    A  +K   P++Y  ++ +IAP I+G+E +KKGLL+M             AG  +R ++++ L GDPG +KSQLL +V  L PR QYT+G+GSS  GLTA + +D  TG  TL++G+L L+D GICCIDEFDKMTD+ R+ +HEVMEQQ++SIAKAGI+  L+AR S+LAAANP    ++ ++TI +NI LP  LLSRFDL++LI D  D   D +LA+HI   Y   N    P  + TA              LR Y+A  +    P + E   NY+   Y+ MRK   AG K  I    R L +LIR++ A +R++   +V   D  EA RL
Sbjct:  183 NLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFC-NQCQAKHTQQIVH---NCCEFIDKQMVKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIK--AVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQK---PDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAM-------------LRDYIAYAKENIHPILSEEAENYVTEEYVEMRKVGNAG-KGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRL 674          
BLAST of DNA replication licensing factor MCM7 vs. Planmine SMEST
Match: SMESG000005389.1 (SMESG000005389.1)

HSP 1 Score: 280.411 bits (716), Expect = 3.876e-83
Identity = 180/545 (33.03%), Postives = 290/545 (53.21%), Query Frame = 1
Query:  466 SKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRC----GSETFQEILNKTLLP---LLTCTNEVCKIGTAGR------LHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGET------IPATEAELEKLKD----PEMYSLMARSIAPEIFGHEDVKKGL-LXXXXXXXXXXXXXTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDS----AGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRK-----ESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKAS 2001
            S   S+R + S ++  +IK+  VV+ A+ +K      T  C  C     S + +  LN  +LP   + + ++    +G   +       +++    K    Q +++QE  + VP G +PR   +           PG+ V + G+   +    M     G+        H   R+   E ++ G T      +  T+ E ++ ++    P ++ ++ARSIAP I+G+ D+KK +  ++  G       G  +RG +N+ ++GDPG AKSQLL FV++  P + YT+G+GSS AGLTASV+RD  T    +E G++VLADGG+ CIDEFDKM + DR AIHE MEQQTISIAKAGI T LN+R S+LAAAN  +G ++  +  ++NID    ++SRFD++++++D  D   D ++ +H+  VH  +     V    + DS     G++P+   +L++Y+A  R Q  P +    L  +   Y+SMR      E + G   SI  + R L A++RI+ +L++++        D  EAIRL + S  S
Sbjct:  124 SHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGV-------KHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPV--LKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLS 658          
The following BLAST results are available for this feature:
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MCM70.000e+051.42minichromosome maintenance complex component 7 [So... [more]
MCM70.000e+057.01minichromosome maintenance complex component 7 [So... [more]
MCM70.000e+057.01minichromosome maintenance complex component 7 [So... [more]
MCM42.243e-9233.28minichromosome maintenance complex component 4 [So... [more]
MCM44.973e-9233.28minichromosome maintenance complex component 4 [So... [more]
back to top
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm-70.000e+044.58DNA replication licensing factor MCM7 [Source:Uni... [more]
mcm-43.231e-9835.30DNA replication licensing factor mcm-4 [Source:Un... [more]
mcm-43.231e-9835.30DNA replication licensing factor mcm-4 [Source:Un... [more]
mcm-39.493e-8632.55DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q9XVR7][more]
mcm-29.700e-8631.77DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6][more]
back to top
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm70.000e+050.47gene:FBgn0020633 transcript:FBtr0076585[more]
dpa4.301e-9733.03gene:FBgn0015929 transcript:FBtr0345797[more]
dpa4.301e-9733.03gene:FBgn0015929 transcript:FBtr0088982[more]
Mcm63.366e-8330.28gene:FBgn0025815 transcript:FBtr0070952[more]
Mcm51.621e-8135.62gene:FBgn0017577 transcript:FBtr0082279[more]
back to top
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm70.000e+045.55minichromosome maintenance complex component 7 [So... [more]
mcm77.876e-15957.18minichromosome maintenance complex component 7 [So... [more]
mcm46.090e-9734.65minichromosome maintenance complex component 4 [So... [more]
mcm63.475e-9331.90minichromosome maintenance complex component 6 [So... [more]
mcm51.223e-8832.30minichromosome maintenance complex component 5 [So... [more]
back to top
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trib10.000e+052.30tribbles pseudokinase 1 [Source:Xenbase;Acc:XB-GEN... [more]
trib10.000e+052.17tribbles pseudokinase 1 [Source:Xenbase;Acc:XB-GEN... [more]
trib10.000e+052.03tribbles pseudokinase 1 [Source:Xenbase;Acc:XB-GEN... [more]
trib10.000e+052.47tribbles pseudokinase 1 [Source:Xenbase;Acc:XB-GEN... [more]
trib10.000e+052.47tribbles pseudokinase 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm70.000e+051.15minichromosome maintenance complex component 7 [So... [more]
Mcm43.491e-9233.43minichromosome maintenance complex component 4 [So... [more]
Mcm78.878e-8942.39minichromosome maintenance complex component 7 [So... [more]
Mcm61.830e-8831.60minichromosome maintenance complex component 6 [So... [more]
Mcm63.203e-8831.19minichromosome maintenance complex component 6 [So... [more]
back to top
BLAST of DNA replication licensing factor MCM7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3ZBH9|MCM7_BOVIN0.000e+051.70DNA replication licensing factor MCM7 OS=Bos tauru... [more]
sp|P33993|MCM7_HUMAN0.000e+051.42DNA replication licensing factor MCM7 OS=Homo sapi... [more]
sp|Q61881|MCM7_MOUSE0.000e+051.15DNA replication licensing factor MCM7 OS=Mus muscu... [more]
sp|Q7ZXB1|MCM7B_XENLA0.000e+052.30DNA replication licensing factor mcm7-B OS=Xenopus... [more]
sp|Q91876|MCM7A_XENLA0.000e+052.30DNA replication licensing factor mcm7-A OS=Xenopus... [more]
back to top
BLAST of DNA replication licensing factor MCM7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0S1N10.000e+055.28DNA replication licensing factor MCM7 OS=Fasciola ... [more]
A0A0R3TBZ20.000e+054.58DNA replication licensing factor MCM7 OS=Rodentole... [more]
G4VSF50.000e+053.22DNA replication licensing factor MCM7 OS=Schistoso... [more]
A0A3Q0KE520.000e+053.09DNA replication licensing factor MCM7 OS=Schistoso... [more]
A0A0R3SBV40.000e+054.42DNA replication licensing factor MCM7 OS=Hymenolep... [more]
back to top
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm70.000e+056.73minichromosome maintenance complex component 7 [So... [more]
mcm47.163e-9534.17minichromosome maintenance complex component 4 [So... [more]
mcm67.449e-9331.98minichromosome maintenance complex component 6 [So... [more]
mcm6l3.016e-8730.37maternal DNA replication licensing factor mcm6-lik... [more]
mcm53.741e-8731.95minichromosome maintenance complex component 5 [So... [more]
back to top
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006035.10.000e+048.99pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
ENSPMAT00000006014.10.000e+048.92pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
mcm52.113e-8137.56minichromosome maintenance complex component 5 [So... [more]
ENSPMAT00000008164.11.104e-7536.79pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:... [more]
mcm83.723e-6831.13minichromosome maintenance 8 homologous recombinat... [more]
back to top
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MCM73.652e-16940.98Component of the Mcm2-7 hexameric helicase complex... [more]
MCM67.584e-9632.19Protein involved in DNA replication; component of ... [more]
MCM48.404e-9536.48Essential helicase component of heterohexameric MC... [more]
MCM52.650e-8831.37Component of the Mcm2-7 hexameric helicase complex... [more]
MCM29.596e-8032.62Protein involved in DNA replication; component of ... [more]
back to top
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO379460.000e+051.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484537.181e-9332.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339711.821e-9130.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350601.258e-8033.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344254.755e-7531.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA replication licensing factor MCM7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm70.000e+052.42minichromosome maintenance complex component 7 [So... [more]
mcm43.764e-9834.46minichromosome maintenance complex component 4 [So... [more]
mcm48.649e-9834.46minichromosome maintenance complex component 4 [So... [more]
mcm64.673e-9632.52minichromosome maintenance complex component 6 [So... [more]
mcm55.135e-9036.79minichromosome maintenance complex component 5 [So... [more]
back to top
BLAST of DNA replication licensing factor MCM7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057772.10.000e+099.86SMESG000057772.1[more]
SMESG000057772.10.000e+099.86SMESG000057772.1[more]
SMESG000038798.11.730e-9032.13SMESG000038798.1[more]
SMESG000060238.13.575e-8636.50SMESG000060238.1[more]
SMESG000005389.13.876e-8333.03SMESG000005389.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030946 ID=SMED30030946|Name=DNA replication licensing factor MCM7|organism=Schmidtea mediterranea sexual|type=transcript|length=2284bp
ATGAAAATGTTAATGAAAATGGTTTTTATGAGAAATTATGAAAGTGACAA
AGATAAATTTAAAAATTTCATTGAAAATTTTTATGAAGAAACGAGTGATT
CAAAAAAATTTATTTATAGGGAACAAGTTTTGAATATTTCCAAACAAGAA
CAACAAGCTATTTATATTAGCTTAGACGATATTAATGAATTTGACAGTGA
GTTGGCAGAAGTTATAGAAAAGAATGGATTTCGTTATCAAAAGTTAATTT
GTTATGCAATAGACGAAATAATTCACGGGATGGGAAGGGCAACTGTTAAT
AAAACCGCTTTCGATATATTCATTGATCATTGTCTACAAATTGAGCAAAA
TTTGCGTGACAGTGCTAATGGAATTGGCCAACCACTGACGATTGAAGATT
TACGAACTAAATTTCCATCAGAACTTTTAAGACGATATGAAGCATACTTT
ATTGCAAGAAAGACATCAAAAGCATTATCAATTCGCAATGTTTTGTCCAA
AGAAATGGGAAGTGTAATCAAGTTAAAGGCTGTGGTGATACGAGCGACAA
TGGTAAAGCCATTAATGAAGATTGCAACGTATACCTGTGATCGATGTGGT
TCAGAAACATTTCAAGAAATATTGAATAAGACATTACTTCCTTTATTAAC
TTGTACAAATGAAGTTTGCAAAATTGGCACTGCTGGAAGATTGCACCTAC
AAACTAAAGGTAGCAAATATGTTAAATTGCAAGAAATTCGTATTCAGGAA
GTGTCGGATCAAGTACCAATTGGAAATATACCACGTAGCATGAATGTCCA
TTGTGTTGGTGCTAATACGCGCTTAGTGCAGCCAGGTGATCACGTTTTCA
TAACTGGTGTATTTCTGCCGTTACTTAATACTGGAATGCGAACCCTTAAT
CGAGGCTTGGTGACAGAATTATTCCTGGATGCTCATTTTATTAATCGCAT
TACAAAAGACGAATCGGATGATCTCGGTGAAACGATACCGGCCACAGAAG
CGGAATTGGAAAAATTGAAAGATCCTGAAATGTATTCGTTAATGGCAAGA
AGCATCGCTCCAGAAATATTTGGTCATGAAGATGTTAAAAAAGGTTTGCT
AATAATGATGGCAGGAGGGGCAGGTATCGATGCAGCTGGAACAAAGATTC
GAGGAAGTCTGAATATCTGTTTGATGGGGGATCCTGGAGTGGCGAAATCT
CAATTATTGGGATTTGTCGATCGATTATGTCCGAGATCTCAATACACGAA
TGGAAGAGGCAGTTCTGGTGCCGGTTTGACGGCGAGTGTGGTGAGGGATC
AGCTGACAGGTGAAATGACTTTGGAAGCGGGTTCTTTGGTACTTGCCGAC
GGTGGCATTTGCTGTATTGACGAGTTTGACAAGATGACTGATTCTGATAG
GACTGCGATTCACGAGGTAATGGAACAGCAGACGATCAGCATTGCCAAGG
CTGGCATTATGACGACTCTGAATGCACGCGCTTCGATTTTAGCGGCTGCC
AACCCGGCGTACGGCCGATACAATCCCCGGCGGACGATCGAACAGAATAT
CGATCTGCCAGCCGCTCTGCTGTCGCGGTTTGACCTGTTATGGCTGATCC
AAGACAAGCCGGACCGAGACGGCGATTTGAGATTGGCGCAGCACATTTCA
TACGTGCACACGAACAATGAGGCTCCTCCATCGGTGTTGACAACGGCTGC
AGGGGATTCGGCGGGCCTGTTGCCGTTGTCGATGGCAGAGTTGCGTAGGT
ATCTGGCGATCATCCGCAGCCAACCGGATCCGGCCGTTCCTGAAACGCTG
CTGAATTATCTGGTTGGTTGCTACATTTCCATGCGGAAGGAATCGAAAGC
CGGTAGCAAAGAATCGATATTTACGAGTGCAAGATCGCTGCTGGCGCTCA
TACGAATCTCGACTGCTCTCTCTAGAATCAAGTGCCAAACCGAGGTAGAC
AGAATCGATGTTGACGAGGCGATTCGTCTGCTGGAGGCAAGCAAGGCTAG
TGTGAAATCAGACCGAGCTCGTCAGCGAACCCGACTCGGCTACAAAGAAT
TGATTTATCAAGCGATTCGCGGACTGGCGGCCGACTCGAGCACGGTTAGG
ATGGCAGATATCAGCAAGAAATGCGTGTCGATGGGATTCACGCCTGACCA
GATAAACGAGGTTATCGACAGTTATGAGGAGCTCAATATCTGGCAGGTCA
ATGTCGGTCGCACTCGCATCGTGTTGGTCAACTGAGATTACTGATTATTA
TAATTGTTATTATTTGTCCCCCTCCTCATCCCGC
back to top

protein sequence of SMED30030946-orf-1

>SMED30030946-orf-1 ID=SMED30030946-orf-1|Name=SMED30030946-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=745bp
MKMLMKMVFMRNYESDKDKFKNFIENFYEETSDSKKFIYREQVLNISKQE
QQAIYISLDDINEFDSELAEVIEKNGFRYQKLICYAIDEIIHGMGRATVN
KTAFDIFIDHCLQIEQNLRDSANGIGQPLTIEDLRTKFPSELLRRYEAYF
IARKTSKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCG
SETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQE
VSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLN
RGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMAR
SIAPEIFGHEDVKKGLLIMMAGGAGIDAAGTKIRGSLNICLMGDPGVAKS
QLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLAD
GGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAA
NPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHIS
YVHTNNEAPPSVLTTAAGDSAGLLPLSMAELRRYLAIIRSQPDPAVPETL
LNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVD
RIDVDEAIRLLEASKASVKSDRARQRTRLGYKELIYQAIRGLAADSSTVR
MADISKKCVSMGFTPDQINEVIDSYEELNIWQVNVGRTRIVLVN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0006270DNA replication initiation
GO:0006260DNA replication
GO:0032508DNA duplex unwinding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR041562MCM_lid
IPR033762MCM_OB
IPR008050MCM7
IPR001208MCM_dom
IPR031327MCM
IPR027417P-loop_NTPase
IPR012340NA-bd_OB-fold
IPR027925MCM_N
IPR018525MCM_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003677DNA binding
GO:0003678DNA helicase activity
GO:0000166nucleotide binding
GO:0004386helicase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0042555MCM complex
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 5..25
NoneNo IPR availableGENE3DG3DSA:3.30.1640.10coord: 7..113
e-value: 1.5E-6
score: 30.1
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 156..283
e-value: 2.3E-25
score: 90.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 328..666
e-value: 7.5E-120
score: 402.1
NoneNo IPR availableGENE3DG3DSA:2.20.28.10coord: 186..232
e-value: 2.3E-25
score: 90.9
NoneNo IPR availableCDDcd17758MCM7coord: 343..659
e-value: 3.06479E-170
score: 489.228
IPR008050DNA replication licensing factor Mcm7PRINTSPR01663MCMPROTEIN7coord: 206..218
score: 35.26
coord: 171..182
score: 47.92
coord: 189..200
score: 74.31
coord: 297..307
score: 51.52
coord: 133..145
score: 61.54
IPR008050DNA replication licensing factor Mcm7PANTHERPTHR11630:SF26DNA REPLICATION LICENSING FACTOR MCM7coord: 15..724
IPR001208MCM domainPRINTSPR01657MCMFAMILYcoord: 518..526
score: 73.0
coord: 439..453
score: 73.98
coord: 491..503
score: 69.56
coord: 379..394
score: 61.69
coord: 467..480
score: 84.64
IPR001208MCM domainPFAMPF00493MCMcoord: 332..548
e-value: 7.5E-95
score: 316.3
IPR001208MCM domainPROSITEPS50051MCM_2coord: 339..544
score: 90.338
IPR031327Mini-chromosome maintenance proteinSMARTSM00350mcmcoord: 152..661
e-value: 1.9E-218
score: 741.7
IPR031327Mini-chromosome maintenance proteinPANTHERPTHR11630DNA REPLICATION LICENSING FACTORcoord: 15..724
IPR041562MCM, AAA-lid domainPFAMPF17855MCM_lidcoord: 575..659
e-value: 3.9E-18
score: 65.7
IPR033762MCM OB domainPFAMPF17207MCM_OBcoord: 156..283
e-value: 8.5E-27
score: 93.5
IPR027925MCM N-terminal domainPFAMPF14551MCM_Ncoord: 13..145
e-value: 1.2E-14
score: 54.7
IPR018525Mini-chromosome maintenance, conserved sitePROSITEPS00847MCM_1coord: 447..455
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 16..306
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 349..659