FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30030945
Length (bp)1375
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30030945) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30030945) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30030945) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30030945) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030945

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030945SMESG000045054.1 SmedASXL_011144SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 70.0922 bits (170), Expect = 3.985e-12
Identity = 79/378 (20.90%), Postives = 145/378 (38.36%), Query Frame = 2
Query:   23 LKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTME-----VYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKIL--DTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVA-VLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVV 1132
            L NF+  C+   ++        C++  +++ + H  Y NCYT+N K        +M      + L L  + N+          + S ++GA + +   +  + +++ G +L PG  T I ++     R+   YG C++N             Y+++ C  +  Q    +EC C  I YP                N   C     S    C   L  D   +++ C               C  PCS  SY+     S WP+ + Q                           E + + ++++    ++N    +RN VA V +     N     E   +++ + LS +G   S+W G +++S+VEM EL+  L +++
Sbjct:  275 LGNFIFACRFNQVS--------CNQ-ANYSHFHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQNDF-------IPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQ-------------NVEYCDYRKHSSWGYCYYKLQVDFSSDHLGC------------FTKCRKPCSVTSYQLSAGYSRWPSVTSQ---------------------------EWVFQMLSRQNNYTVNN----KRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIM 580          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 70.0922 bits (170), Expect = 4.288e-12
Identity = 79/378 (20.90%), Postives = 145/378 (38.36%), Query Frame = 2
Query:   23 LKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTME-----VYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKIL--DTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVA-VLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVV 1132
            L NF+  C+   ++        C++  +++ + H  Y NCYT+N K        +M      + L L  + N+          + S ++GA + +   +  + +++ G +L PG  T I ++     R+   YG C++N             Y+++ C  +  Q    +EC C  I YP                N   C     S    C   L  D   +++ C               C  PCS  SY+     S WP+ + Q                           E + + ++++    ++N    +RN VA V +     N     E   +++ + LS +G   S+W G +++S+VEM EL+  L +++
Sbjct:  298 LGNFIFACRFNQVS--------CNQ-ANYSHFHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQNDF-------IPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQ-------------NVEYCDYRKHSSWGYCYYKLQVDFSSDHLGC------------FTKCRKPCSVTSYQLSAGYSRWPSVTSQ---------------------------EWVFQMLSRQNNYTVNN----KRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIM 603          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 69.707 bits (169), Expect = 5.545e-12
Identity = 79/378 (20.90%), Postives = 145/378 (38.36%), Query Frame = 2
Query:   23 LKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTME-----VYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKIL--DTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVA-VLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVV 1132
            L NF+  C+   ++        C++  +++ + H  Y NCYT+N K        +M      + L L  + N+          + S ++GA + +   +  + +++ G +L PG  T I ++     R+   YG C++N             Y+++ C  +  Q    +EC C  I YP                N   C     S    C   L  D   +++ C               C  PCS  SY+     S WP+ + Q                           E + + ++++    ++N    +RN VA V +     N     E   +++ + LS +G   S+W G +++S+VEM EL+  L +++
Sbjct:  334 LGNFIFACRFNQVS--------CNQ-ANYSHFHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQNDF-------IPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQ-------------NVEYCDYRKHSSWGYCYYKLQVDFSSDHLGC------------FTKCRKPCSVTSYQLSAGYSRWPSVTSQ---------------------------EWVFQMLSRQNNYTVNN----KRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIM 639          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: ASIC1 (acid sensing ion channel subunit 1 [Source:HGNC Symbol;Acc:HGNC:100])

HSP 1 Score: 54.6842 bits (130), Expect = 2.651e-7
Identity = 82/372 (22.04%), Postives = 137/372 (36.83%), Query Frame = 2
Query:   17 HQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTM--------EVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENT-PKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFE 1105
            H+L++ ++YC  +Y  G      PC         +   Y  CYT+N     R   KTM        E+ L +++D      P     D  S  +G  + I   +    I++ G  + PG  T +  +    I + PP+G C   T    L  FD    YS   C+           C C  +  P +    P+C          EC+ P+          LD ++E         Q Y       C MPC+   Y  + S    P+K+    L  K                + K ++ IG+             N+L  ++   +L     N   +E+K    +   L  IGG   ++IG ++++++E+F+
Sbjct:  197 HRLEDMLLYC--SYQGG------PCGPHN--FSVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEY---LPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLDFFDS---YSITACRIDCETRYLVENCNCRMVHMPGDA---PYCTPEQY----KECADPA----------LDFLVEK-------DQEYCV-----CEMPCNLTRYGKELSMVKIPSKASAKYLAKK----------------FNKSEQYIGE-------------NILVLDIFFEVL-----NYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFD 489          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 54.6842 bits (130), Expect = 2.766e-7
Identity = 79/366 (21.58%), Postives = 132/366 (36.07%), Query Frame = 2
Query:   80 AYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSEN---TPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSP---SKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPC--------SFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVT 1135
            A PC+   ++T   +  Y NCY +N  +  + +        +  + + +I   D + +   +  +G  L +    ++  I ++GI  M GT T I +   +  R+  PY  C+ N    P +    D    YS + C ++  Q    R C C    YP       +C     F +   C S    S ++  TCI +         CKE      Y+  I     P           LS E D+ST+        I L  KG+ K N    +                                            FN   +EE A  ++   LS +GG    W+G +++ ++E  E+I+  F+ +T
Sbjct:  298 AEPCN-YRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPF--LASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGE-KYCNNRD-FPDWAHCYSDLQMSVAQRETCIGM---------CKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTN--------ITLSRKGIVKLNIYFQE--------------------------------------------FNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIID-FVWIT 596          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 70.0922 bits (170), Expect = 1.513e-12
Identity = 63/267 (23.60%), Postives = 96/267 (35.96%), Query Frame = 2
Query:  362 IRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENM--RCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAKS 1156
            +R+K F  IR+ PPYG C              F YS + C ++  Q      C C    YP             +F N  +       +   C++     L  +  + KE I    Y      C  PC   +YE   S++ WP+ S ++     G F           E YRK                         N   V +     N   ++E    +LTS L+ +GGL  +WIG +++S++E+  LI+         RK  S
Sbjct:  564 VRMKQF--IRLEPPYGHCRHGGEDAATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPV----------AEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSKGKEAIIPDCY------CHQPCQETNYEVTYSSARWPSGSAKVMECLPGDFL--------CLEKYRK-------------------------NAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLIVFATQAYVRKRKGVS 779          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 70.0922 bits (170), Expect = 1.811e-12
Identity = 64/269 (23.79%), Postives = 98/269 (36.43%), Query Frame = 2
Query:  362 IRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENM--RCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAKSRL 1162
            +R+K F  IR+ PPYG C              F YS + C ++  Q      C C    YP             +F N  +       +   C++     L  +  + KE I    Y      C  PC   +YE   S++ WP+ S ++     G F           E YRK                         N   V +     N   ++E    +LTS L+ +GGL  +WIG +++S++E+  LI  +F      RK K  +
Sbjct:  478 VRMKQF--IRLEPPYGHCRHGGEDAATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPV----------AEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSKGKEAIIPDCY------CHQPCQETNYEVTYSSARWPSGSAKVMECLPGDFL--------CLEKYRK-------------------------NAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLI--VFATQAYVRKRKGSI 693          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 70.0922 bits (170), Expect = 1.811e-12
Identity = 64/269 (23.79%), Postives = 98/269 (36.43%), Query Frame = 2
Query:  362 IRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENM--RCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAKSRL 1162
            +R+K F  IR+ PPYG C              F YS + C ++  Q      C C    YP             +F N  +       +   C++     L  +  + KE I    Y      C  PC   +YE   S++ WP+ S ++     G F           E YRK                         N   V +     N   ++E    +LTS L+ +GGL  +WIG +++S++E+  LI  +F      RK K  +
Sbjct:  478 VRMKQF--IRLEPPYGHCRHGGEDAATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPV----------AEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSKGKEAIIPDCY------CHQPCQETNYEVTYSSARWPSGSAKVMECLPGDFL--------CLEKYRK-------------------------NAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLI--VFATQAYVRKRKGSI 693          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 70.0922 bits (170), Expect = 1.867e-12
Identity = 64/269 (23.79%), Postives = 98/269 (36.43%), Query Frame = 2
Query:  362 IRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENM--RCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAKSRL 1162
            +R+K F  IR+ PPYG C              F YS + C ++  Q      C C    YP             +F N  +       +   C++     L  +  + KE I    Y      C  PC   +YE   S++ WP+ S ++     G F           E YRK                         N   V +     N   ++E    +LTS L+ +GGL  +WIG +++S++E+  LI  +F      RK K  +
Sbjct:  564 VRMKQF--IRLEPPYGHCRHGGEDAATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPV----------AEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSKGKEAIIPDCY------CHQPCQETNYEVTYSSARWPSGSAKVMECLPGDFL--------CLEKYRK-------------------------NAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLI--VFATQAYVRKRKGSI 779          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 70.0922 bits (170), Expect = 1.867e-12
Identity = 64/269 (23.79%), Postives = 98/269 (36.43%), Query Frame = 2
Query:  362 IRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENM--RCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAKSRL 1162
            +R+K F  IR+ PPYG C              F YS + C ++  Q      C C    YP             +F N  +       +   C++     L  +  + KE I    Y      C  PC   +YE   S++ WP+ S ++     G F           E YRK                         N   V +     N   ++E    +LTS L+ +GGL  +WIG +++S++E+  LI  +F      RK K  +
Sbjct:  564 VRMKQF--IRLEPPYGHCRHGGEDAATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPV----------AEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSKGKEAIIPDCY------CHQPCQETNYEVTYSSARWPSGSAKVMECLPGDFL--------CLEKYRK-------------------------NAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLI--VFATQAYVRKRKGSI 779          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Match: ppk28 (gene:FBgn0030795 transcript:FBtr0074335)

HSP 1 Score: 48.9062 bits (115), Expect = 8.159e-6
Identity = 56/246 (22.76%), Postives = 97/246 (39.43%), Query Frame = 2
Query:  464 YSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKA-VLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAKS-RLKYKENLDQ-TW 1192
            YS K C+         REC CV    P        CG      N N+C+   ++E       +++ L N+ C             ENC   C  L+Y +  ST+                    +I+S P F+    + E I  G    A++            +++L      N+ +   K+ +   T FLS  GGL  +++G ++ S++E+F      +I V     +++ R ++K  L+Q +W
Sbjct:  351 YSRKNCELECEAKLLLRECSCVLYYLPRIDPLARVCGP-----NDNQCTDRVQTE-------IESSLTNLSC-------------ENCWPGCFELTYRATLSTA--------------------SIVSDPRFQAGENLPEYIFHGPYSNASE------------ISILHFYYMTNIFRSTTKSEMFGFTEFLSNTGGLLGLFMGFSIFSVIEIF-----FYITVRPYCASRTLRQRHKRRLEQLSW 534          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Match: asic1b (acid-sensing (proton-gated) ion channel 1b [Source:NCBI gene;Acc:407672])

HSP 1 Score: 55.0694 bits (131), Expect = 1.179e-7
Identity = 80/379 (21.11%), Postives = 136/379 (35.88%), Query Frame = 2
Query:   11 LGHQLKNFVIYCQI-TYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRK--------MTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQL 1120
            LGHQL+  ++YC+    L G +  +            I   Y  CYT+N     R         M   +E+ L +++D      P     D  +  +G  + I   +    I++ G  + PG  T +  +      + PP+G C + TP     F+    YS   C+           C C  +  P +    P+C          EC+ P+          LD ++E              DY   C  PC+   Y  + S    P+K+                             + + K  NK    + DN  VL+    A+       N   +E+K    L   L  IGG   ++IG ++++I+E+F+ + ++
Sbjct:  176 LGHQLEEMLLYCRFQGQLCGPRNFS-----------TIFTRYGKCYTFNSGQDGRPLLITTKGGMGNGLEIMLDIQQDE---YLPVWGETDETTFEAGIKVQIHTQDEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDC-KATPIDSDFFN---TYSITACRIDCETRYLVENCNCRMVHMPGDA---PYCTPEQY----KECADPA----------LDFLVERD-----------NDYCV-CETPCNMTRYGKELSFVRIPSKA---------------------------SAKYLAKKYNKTEQYISDNIMVLDIFFEAL-------NYETIEQKKAYELAGLLGDIGGQMGLFIGASILTILELFDYLYEV 473          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Match: asic1a (acid-sensing (proton-gated) ion channel 1a [Source:NCBI gene;Acc:791696])

HSP 1 Score: 49.2914 bits (116), Expect = 6.745e-6
Identity = 78/378 (20.63%), Postives = 138/378 (36.51%), Query Frame = 2
Query:   14 GHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAF--YINCYTYNL------KVQYRK-MTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQL 1120
            GH +K+ ++ CQ     GS     PC       D+   F  Y  CYT+N       +V  +  M   +E+ L +++D      P     D  S  +G  + I   +    I++ G  + PG  T +  +    + +  P+G C    P      D    YS   C+           C C  +  P +    P+C      +   EC+ P+          LD ++E              DY  +C  PC+   Y  + S    P+K+                           +K L  K  +K    + +N  VL+    A+       N   +E++    +   L  IGG   ++IG ++++I+E+F+ + ++
Sbjct:  167 GHDIKDMLLSCQ---FRGS-----PCRP----EDFSVVFTRYGKCYTFNSGETGPPRVSVKGGMGNGLEIMLDIQQDEY---LPVWGESDESSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQEQRLVYLPAPWGSCKSTPPSS----DYFRAYSISACRTDCETRYLVENCNCRMVHMPGDA---PYCTP----VLYKECAHPA----------LDFLVETD-----------SDYC-SCETPCNITRYSKELSFVKIPSKA--------------------------SVKYL-AKKYSKSEKYITENVMVLDVFFEAL-------NYETIEQRKAYEVAGLLGDIGGQMGLFIGASILTILELFDYLYEV 462          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 60.4622 bits (145), Expect = 3.774e-9
Identity = 77/383 (20.10%), Postives = 153/383 (39.95%), Query Frame = 2
Query:    8 SLGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTM-------EVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERE----CKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYI---ENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIM 1114
            ++G++    ++ C   + +G       CD   ++T + H  Y NCYT+N   +   +  +M       +V LY++ED  E N          S  +GA + +   + +  I + G  L   T T I ++  E+ +++ PY  C+ +          E +YS+K   Q  +   F+RE    C C   + P     LP    G+ + N  E  S                   + C  ++ +++ ++ +     C   CSF  +   RS + WP+ + +  ++                   R +   +G+ +NK         N+ + +L  + +   + N   + E    ++ + LS  GG   +W+  +MI ++E+ E+  
Sbjct:  259 AMGYKADELIVTC---FFDG-----LSCD-ARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDED--EYN-------PYLSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSD----VSVENLYSKKYTLQICLNSCFQREMVRTCGCAHYDQP-----LP---NGAKYCNYEEYPS------------------WIYCYFKLYKQFVQEELGCQSACRESCSFKEWTLTRSLAKWPSLNSEQWML-------------------RVLSWELGEKLNK---------NLTKNDLANLNIFYQDLNSRSISESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIVEVFF 565          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 56.9954 bits (136), Expect = 4.576e-8
Identity = 80/391 (20.46%), Postives = 147/391 (37.60%), Query Frame = 2
Query:    8 SLGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTM-------EVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERE----CKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYI---ENCTMPCSFLSYESDRSTSMWP--------AKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIM 1114
            ++G++    ++ C   + +G       CD   ++T + H  Y NCYT+N   +   +  +M       +V LY++ED  E N          S  +GA + +   + +  I + G  L   T T I ++  E+ +++ PY  C+ +          E +YS+K   Q  +   F+RE    C C   + P     LP    G+ + N  E  S                   + C  ++ +++ ++ +     C   CSF  +   RS + WP        A   Q+  +  G F  N+                            L N N+  ++L          N   + E    ++ + LS  GG   +W+  +MI ++E+ E+  
Sbjct:  251 AMGYKADELIVTC---FFDG-----LSCD-ARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDED--EYN-------PYLSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSD----VSVENLYSKKYTLQICLNSCFQREMVRTCGCAHYDQP-----LP---NGAKYCNYEEYPS------------------WIYCYFKLYKQFVQEELGCQSACRESCSFKEWTLTRSLAKWPSLNSEVRSAWVLQLFYVGHGFFNLND----------------------------LANLNIFYQDL----------NSRSISESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIVEVFF 555          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 69.3218 bits (168), Expect = 4.890e-12
Identity = 79/360 (21.94%), Postives = 138/360 (38.33%), Query Frame = 2
Query:   86 PCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTME-----VYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSEN---TPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTI--LENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVL-LIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVV 1132
            PC++  +++ + H  Y NCYT+N K        +M      + L L  + N+          + S ++GA + +   +  + +++ G ++ PG  T I ++      +   YG C+EN    P K     K   Y+++ C  +  Q +  ++C C  I YP          +G  F     C    +S    C   L     L+++ C               C  PCS  +Y+     S WP+   Q  + +    + N  I+                                +RN VA L +     N     E   +++ S LS +G   S+W G +++S+VEM ELI  L ++ 
Sbjct:  316 PCNQ-ANYSQFHHPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTEQNDF-------IPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYPSK---YTQQVCIHSCFQENMIKKCGCAYIFYPK--------PKGVEF-----CDYLKQSSWGYCYYKLQAAFSLDSLGC------------FSKCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQNNYTINN-------------------------------KRNGVAKLNIFFKELNYKTNSESPSVTMVSLLSNLGSQWSLWFGSSVLSVVEMAELIFDLLVIT 608          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 68.9366 bits (167), Expect = 5.172e-12
Identity = 79/360 (21.94%), Postives = 138/360 (38.33%), Query Frame = 2
Query:   86 PCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTME-----VYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSEN---TPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTI--LENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVL-LIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVV 1132
            PC++  +++ + H  Y NCYT+N K        +M      + L L  + N+          + S ++GA + +   +  + +++ G ++ PG  T I ++      +   YG C+EN    P K     K   Y+++ C  +  Q +  ++C C  I YP          +G  F     C    +S    C   L     L+++ C               C  PCS  +Y+     S WP+   Q  + +    + N  I+                                +RN VA L +     N     E   +++ S LS +G   S+W G +++S+VEM ELI  L ++ 
Sbjct:  209 PCNQ-ANYSQFHHPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTEQNDF-------IPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYPSK---YTQQVCIHSCFQENMIKKCGCAYIFYPK--------PKGVEF-----CDYLKQSSWGYCYYKLQAAFSLDSLGC------------FSKCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQNNYTINN-------------------------------KRNGVAKLNIFFKELNYKTNSESPSVTMVSLLSNLGSQWSLWFGSSVLSVVEMAELIFDLLVIT 501          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 68.9366 bits (167), Expect = 5.651e-12
Identity = 79/360 (21.94%), Postives = 138/360 (38.33%), Query Frame = 2
Query:   86 PCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTME-----VYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSEN---TPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTI--LENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVL-LIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVV 1132
            PC++  +++ + H  Y NCYT+N K        +M      + L L  + N+          + S ++GA + +   +  + +++ G ++ PG  T I ++      +   YG C+EN    P K     K   Y+++ C  +  Q +  ++C C  I YP          +G  F     C    +S    C   L     L+++ C               C  PCS  +Y+     S WP+   Q  + +    + N  I+                                +RN VA L +     N     E   +++ S LS +G   S+W G +++S+VEM ELI  L ++ 
Sbjct:  290 PCNQ-ANYSQFHHPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTEQNDF-------IPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYPSK---YTQQVCIHSCFQENMIKKCGCAYIFYPK--------PKGVEF-----CDYLKQSSWGYCYYKLQAAFSLDSLGC------------FSKCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQNNYTINN-------------------------------KRNGVAKLNIFFKELNYKTNSESPSVTMVSLLSNLGSQWSLWFGSSVLSVVEMAELIFDLLVIT 582          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 68.9366 bits (167), Expect = 5.651e-12
Identity = 79/360 (21.94%), Postives = 138/360 (38.33%), Query Frame = 2
Query:   86 PCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTME-----VYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSEN---TPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTI--LENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVL-LIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVV 1132
            PC++  +++ + H  Y NCYT+N K        +M      + L L  + N+          + S ++GA + +   +  + +++ G ++ PG  T I ++      +   YG C+EN    P K     K   Y+++ C  +  Q +  ++C C  I YP          +G  F     C    +S    C   L     L+++ C               C  PCS  +Y+     S WP+   Q  + +    + N  I+                                +RN VA L +     N     E   +++ S LS +G   S+W G +++S+VEM ELI  L ++ 
Sbjct:  290 PCNQ-ANYSQFHHPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTEQNDF-------IPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYPSK---YTQQVCIHSCFQENMIKKCGCAYIFYPK--------PKGVEF-----CDYLKQSSWGYCYYKLQAAFSLDSLGC------------FSKCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQNNYTINN-------------------------------KRNGVAKLNIFFKELNYKTNSESPSVTMVSLLSNLGSQWSLWFGSSVLSVVEMAELIFDLLVIT 582          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 68.9366 bits (167), Expect = 5.713e-12
Identity = 79/360 (21.94%), Postives = 138/360 (38.33%), Query Frame = 2
Query:   86 PCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTME-----VYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSEN---TPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTI--LENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVL-LIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVV 1132
            PC++  +++ + H  Y NCYT+N K        +M      + L L  + N+          + S ++GA + +   +  + +++ G ++ PG  T I ++      +   YG C+EN    P K     K   Y+++ C  +  Q +  ++C C  I YP          +G  F     C    +S    C   L     L+++ C               C  PCS  +Y+     S WP+   Q  + +    + N  I+                                +RN VA L +     N     E   +++ S LS +G   S+W G +++S+VEM ELI  L ++ 
Sbjct:  209 PCNQ-ANYSQFHHPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTEQNDF-------IPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYPSK---YTQQVCIHSCFQENMIKKCGCAYIFYPK--------PKGVEF-----CDYLKQSSWGYCYYKLQAAFSLDSLGC------------FSKCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQNNYTINN-------------------------------KRNGVAKLNIFFKELNYKTNSESPSVTMVSLLSNLGSQWSLWFGSSVLSVVEMAELIFDLLVIT 501          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.122e-15
Identity = 85/419 (20.29%), Postives = 180/419 (42.96%), Query Frame = 2
Query:    5 KSLGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYN----LKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAV-LAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYP----YNTSRLPFCGQGSVF--INKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCT--MPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKE-----NNIISKPEFEPYRKIKELIGKGMNKEAAKLLD----------------NTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAKSR 1159
            K L H L++ +++C+      ++ + +    + +++ +    Y NC+T+N    L++        + +   +E+D           +D     S  V + +  P +  +  + GI + PG  + + LK   + R+  PYG C+ +    +K +   F    + CKQ  I     + C C +   P    YN +   FCG    +  IN+N  S+   +++      + T       +EQ      R Y  +C    PCS  SY    S S WP + +Q++ +++  FK+      N   K  +E   K+     K + +  + + D                 ++++ +N++ + +   + ++ +  +     L    + IGG   +W+G+++++I+E+ EL+++L  +V ++ K   R
Sbjct:  172 KKLSHNLEDMLMHCRF-----NRELCH----VSNFSTFFDGNYFNCFTFNSGQRLQMHATGPENGLSLIFSVEKDDPLPGTYGVYNFDNNILHSAGVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTNDMLNGIKQYKYTFFACLQLCKQRLII----QRCGCKSSALPEVPSYNAT---FCGVIKDWQEINRNH-SNEDHNQSEEDRAFIPTPYLACEEREQKNLNNDRTYELSCGCFQPCSETSYLKSVSLSYWPLEFYQLSAVER-FFKQERQAGQNHFMKTAYEYLEKLAHPSQKHLARNDSHMDDILSKSYSLSEKEMAKEASDLIRQNMLRLNIYLEDLSVVEYRQLPAYGLADLFADIGGTLGLWMGISVLTIMELIELVIRLTGLVFNSEKGLPR 572          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|O97741|SCNNA_RABIT (Amiloride-sensitive sodium channel subunit alpha OS=Oryctolagus cuniculus OX=9986 GN=SCNN1A PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.127e-12
Identity = 86/380 (22.63%), Postives = 144/380 (37.89%), Query Frame = 2
Query:   20 QLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTME-----VYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSEN---TPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIK-PNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVV 1132
            QL NF+  C+          A+  D  G+++ + H  Y NCYT+N K        +M      + L L  + N+          + S ++GA + +   +  + +++ G +L PG  T I ++     R+   YG C++N    P K     K   Y+++ C  +  Q +  +EC C  I YP     LP   +G  +     C     +    C   L     + R                C  PCS  +YE     S WP+ + Q  +      + N  +S                                +RN VA L I     N     E   +++ + LS +G   S+W G +++S+VEM EL+  L ++ 
Sbjct:  251 QLGNFIFTCRFNQ-------AFCGD--GNYSHFHHPMYGNCYTFNDKNNSSLWMSSMPGINNGLSLTLRTEQNDF-------IPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKESLDRLGGDYGDCTQNGSDVPVKNLYRSK---YTQQVCIHSCFQENMVKECGCAYIFYP-----LP---EGVEY-----CDYRKHNSWGYCYYKLQDAFSSDRL----------GCFTKCRKPCSVTNYELSAGYSRWPSVTSQDWVFQMLSLQNNYTVSN-------------------------------KRNGVAKLNIYFKELNYKANSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELLFDLSVIT 557          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q22851|ASIC2_CAEEL (Degenerin-like protein asic-2 OS=Caenorhabditis elegans OX=6239 GN=asic-2 PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 4.110e-9
Identity = 74/354 (20.90%), Postives = 146/354 (41.24%), Query Frame = 2
Query:   86 PCDRIGSWTDYIHAFYINCYTYN--LKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIE-NCTMPCSFLSYESDRSTSMWPAKSFQIALID-KGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEM--FELIMQLFIV 1129
            PC     +T +I   Y  CY++N    + Y    + ++  L L   + +            ++++GA + ++   +   ++  GI    G  + + +   +N+R   PYG C +  P     + K+F+Y+ + C     Q D   +C+C            P    GS     +    P K++       LD  L+ ++  +  +       +E NC  PC   +Y    S + +P+ S+ +A     GV   ++  SK   +               +  K  +N  +    ++ V L   ++ L+   E A  ++++ ++ +GG   +W+GL++IS+VEM    L+M  F V
Sbjct:  174 PCSE-SDFTKFIDPVYGACYSFNEDASLNYSVSREGIQFGLKLMLTVTQTKTNGNTDSLPTTKLAGARIGVNSRGSSPGLDSNGIDAGVGYESAVSVSLTQNVRAKKPYGTCVDREPDSSDYY-KDFIYTLETCFNGCKQRDTIAKCQCAN----------PRLALGST----DTACQPIKAD-------LD-CLQTLKGNQTSSTPNIDLLVECNCNPPCDESTYTPTVSLAQFPSTSYYVATSSTAGVGSCSSTNSKFSSK--------------SDCQKWYNNNGM----IIQVFLETLSYELYT--ETAGYTVSNVINDLGGQAGLWLGLSVISVVEMTGLMLVMGAFCV 483          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|A5D7U4|SCNNB_BOVIN (Amiloride-sensitive sodium channel subunit beta OS=Bos taurus OX=9913 GN=SCNN1B PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.047e-8
Identity = 81/381 (21.26%), Postives = 148/381 (38.85%), Query Frame = 2
Query:   80 AYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKT---MEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSEN---TPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSP---SKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFEL--------IMQLFIVVTSNRKAKSRLKYK 1171
            A PC+   ++T   H  Y NCY +N  +  + +       E  L L  DM + +          +  +GA L +    ++  I E+GI  M G  T I +   +  R   PY +C++N    P +    +    YS + C ++  Q    REC C    YP    R  +C     F +   C S    S ++  TCI           CKE                 C+   Y+   S ++WP+++ +                           + I   +++E  +   N  +  + +V + +    FN   +EE A  ++   LS +GG    W+G +++ ++E  E+        I++L  +  S R+ +++ +Y+
Sbjct:  254 AEPCN-YRNFTPIFHPDYGNCYIFNWGMTEKALPSANPGTEFGLKLILDMGQED-----YVPFLTSTAGARLMLHEQRSYPFIKEEGIYAMAGMETSIGVLVDKLQRKGEPYSQCTKNGSDVPIQNLYSNYNTTYSIQACIRSCFQEHMIRECGCGHYLYPLPHKR-KYCNNQE-FPDWAHCYSALRISLAQRETCI---------YACKES----------------CNDTQYKMTISMAVWPSEASE---------------------------DWIFHVLSQERDQ-SSNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSVRQKRAQARYE 573          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|H1AFJ6|SCNNB_NEOFS (Amiloride-sensitive sodium channel subunit beta OS=Neoceratodus forsteri OX=7892 GN=scnn1b PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.172e-8
Identity = 81/383 (21.15%), Postives = 152/383 (39.69%), Query Frame = 2
Query:   11 LGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKT---MEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSE---NTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNV-LERNLVAVL-LIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQ-LFIVV 1132
            +G+  K+F++ C    L G +   Y      ++T + H+ Y NCY +N  +    +  +   +   L L  D+N+            +  +GA   +    TF  +   G   + GT+T + +   E  R+  PYG C+    + P           Y+ + C  +  QI     C C    YP     LP   +G+ +     C++ + S+ + C  +L           Q ++ +  + ++ C   C+ L +    S + WP++S            E+ I     +E  R                  D+TN+ ++R+ V  L L    FN   + E    ++   LS +GG    W+G +++ I+E  E+ +  ++I V
Sbjct:  247 MGYSGKDFILTC----LFGGEACNY-----DNFTQFYHSSYGNCYVFNWGLDGNVLIVSNPGVGFGLQLALDVNQEE-----YIPFLTTRAGARFLLHTQNTFPFVETMGTYALVGTVTSVGILVDEVQRMGQPYGTCTTDGLDVPIDNLYSQYNLSYTMQSCLWSCFQIQMVNSCGCAYYLYP-----LP---EGATY-----CNNQNNSDWAYCYYLL-----------QDSKDHKNECLQTCIQTCNELQFRISTSMADWPSES-----------SEDWIFHVLSYE--RD-----------------DSTNITMKRDGVLKLNLYFKEFNYRVITESVATNVVWLLSNLGGQFGFWMGGSVLCIIEFGEVFIDCIWIAV 561          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4V3SD10 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009422 PE=3 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 4.376e-115
Identity = 168/387 (43.41%), Postives = 257/387 (66.41%), Query Frame = 2
Query:   11 LGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKE-FVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNEC------SSPSKSENST--------CIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGK-GMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLF 1123
            LGH +   +I+C + Y  GSK +   C ++G W  ++HA Y+NCY+Y+L  +YR   +T+E+++YL+   N+ +C DC   +IKSQ+SGAV+ +   +T+ +IN++GI++ PG+LTEI++KT ++I+ TPPYGRCS +TPK ++++    + YSE  C+ +TIQ      C C AIE+PY +S LPFC     F+++  C       S SK  NST        C+  L+ +  ++ CK  +T+ +  D + +CT+PC F SYE+DRSTS WP KS+Q+  +  G      I+++PE  PYR+ ++L+ +   +  A  LL  TNVLE+NL+A+++I+PNFNLH VEEK VLSLTS LSQ GGL SIWIG+ ++S++E+FEL++ LF
Sbjct:  184 LGHHMNQTIIHCMVLYSEGSKRVLNDCHQVGRWRRFVHAQYLNCYSYDLLEKYRDHVRTIELFVYLDVPPNKTSCVDCFSAEIKSQLSGAVVVVHNADTYPDINQEGINIQPGSLTEIKVKTIKHIQKTPPYGRCSPDTPKTIELYGAAPYRYSEHACRMSTIQTQINDRCGCNAIEFPYRSSSLPFCLAMGSFVHEGSCDVQSLQGSGSKVANSTKIGSLKSECLAELEVVKNHVTCKSDVTRHFEGDVVPSCTLPCQFFSYETDRSTSTWPTKSWQLGWL--GTRAGRMILNRPELAPYREARDLMRQPNGDVRAQTLLSQTNVLEKNLLAIMIIRPNFNLHNVEEKEVLSLTSLLSQTGGLLSIWIGMNIMSVIELFELLVHLF 568          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4S2L707 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009422 PE=3 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 3.409e-112
Identity = 164/381 (43.04%), Postives = 252/381 (66.14%), Query Frame = 2
Query:   29 NFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKE-FVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNEC------SSPSKSENST--------CIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGK-GMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLF 1123
            N   + ++ Y  GSK +   C ++G W  ++HA Y+NCY+Y+L  +YR   +T+E+++YL+   N+ +C DC   +IKSQ+SGAV+ +   +T+ +IN++GI++ PG+LTEI++KT ++I+ TPPYGRCS +TPK ++++    + YSE  C+ +TIQ      C C AIE+PY +S LPFC     F+++  C       S SK  NST        C+  L+ +  ++ CK  +T+ +  D + +CT+PC F SYE+DRSTS WP KS+Q+  +  G      I+++PE  PYR+ ++L+ +   +  A  LL  TNVLE+NL+A+++I+PNFNLH VEEK VLSLTS LSQ GGL SIWIG+ ++S++E+FEL++ LF
Sbjct:   19 NLHAHKKVLYSEGSKRVLNDCHQVGRWRRFVHAQYLNCYSYDLLEKYRDHVRTIELFVYLDVPPNKTSCVDCFSAEIKSQLSGAVVVVHNADTYPDINQEGINIQPGSLTEIKVKTIKHIQKTPPYGRCSPDTPKTIELYGAAPYRYSEHACRMSTIQTQINDRCGCNAIEFPYRSSSLPFCLAMGSFVHEGSCDVQSLQGSGSKVANSTKIGSLKSECLAELEVVKNHVTCKSDVTRHFEGDVVPSCTLPCQFFSYETDRSTSTWPTKSWQLGWL--GTRAGRMILNRPELAPYREARDLMRQPNGDVRAQTLLSQTNVLEKNLLAIMIIRPNFNLHNVEEKEVLSLTSLLSQTGGLLSIWIGMNIMSVIELFELLVHLF 397          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: G7Y609 (FMRFamide-activated amiloride-sensitive sodium channel OS=Clonorchis sinensis OX=79923 GN=CLF_101553 PE=3 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 4.442e-111
Identity = 161/375 (42.93%), Postives = 249/375 (66.40%), Query Frame = 2
Query:   47 QITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKE-FVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNEC------SSPSKSENST--------CIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGK-GMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLF 1123
            ++ Y  GSK +   C ++G W  ++HA Y+NCY+Y+L  ++R   +T+E+++YL+   N+ +C DC   +IKSQ+SGAV+ +   +T+ +IN++GI++ PG+LTEI++KT ++I+ TPPYGRCS +TPK ++++    + YSE  C+ +TIQ      C C AIE+PY  S LPFC     F+++  C      +  SK+ NST        C+  L+ +  ++ CK  +T+ +  D + +CT+PC F SYE+DRSTS WP KS+Q+  +  G      I+ +PE  PYR+ ++L+ +   +  A  LL  TNVLE+NL+A+++I+PNFNLH VEEK VLSLTS LSQ GGL SIWIG+ ++S++E+FEL++ LF
Sbjct:   11 KVLYSEGSKRVLNDCHQVGHWRRFVHAQYLNCYSYDLLEKFRDHVRTIELFVYLDVPPNKTSCVDCFSAEIKSQLSGAVVVVHNADTYPDINQEGINIQPGSLTEIKVKTIKHIQKTPPYGRCSPDTPKTIELYGAAPYRYSEHACRMSTIQTQINDRCGCNAIEFPYRNSSLPFCLAMGSFVHEGSCDVQKLQADGSKATNSTTIGSLKSQCLAELEVVKNHVTCKSDVTRHFEGDVVPSCTLPCQFFSYETDRSTSTWPTKSWQLGWL--GTRAGRMILDRPELAPYREARDLMRQPNGDVRAQTLLSQTNVLEKNLLAIMIIRPNFNLHNVEEKEVLSLTSLLSQTGGLLSIWIGMNIMSVIELFELLVHLF 383          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4Z2CZ76 (FMRFamide-activated amiloride-sensitive sodium channel OS=Schistosoma japonicum OX=6182 GN=EWB00_006254 PE=3 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 6.237e-110
Identity = 177/391 (45.27%), Postives = 250/391 (63.94%), Query Frame = 2
Query:    5 KSLGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYN--TSRLPFCGQGSVFINKNECS---------SPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNR 1144
            + LG+Q    +I CQITYLNGSK +A PC+R G W  +IHA Y+NC T+    + R  T  +E+Y+YL+E +    C DC   ++KSQ+SGA+++I   +T  NIN+K I+L PGTLTE+RL   ENI+  PPYGRCS+N P  L + D  + YSE  C++ATIQ D  + C C ++EYPYN  T   P C   S FIN   C+         + + +  ++CI      ++ M CK  + + Y    + NCTMPCSF SYES++STS WP KS+Q+  ++    K+  + +  EF+PY + + L+  G   EAA +LDN +VLER L+AVL+ +PNF++ KVEEK VLSLTS LSQ GGL SIWIGL+MIS+ E+ E+ ++ ++ V  +R
Sbjct:  247 RKLGYQHNKLIIKCQITYLNGSKPVAAPCERKGIWRKFIHAQYLNCATFEPFSELRSDTTNIEMYIYLDEMLKRAECVDCFHGEVKSQLSGALISIHGADTLPNINDKSINLKPGTLTELRLSIVENIQQMPPYGRCSKNHPINLNLHDMIYNYSEYACREATIQNDINQRCGCYSMEYPYNEYTGYEP-CTGLSQFINITSCNRNELLLYQQNNTVTSINSCINEFKKFVDRMMCKRSVIENYVHGALRNCTMPCSFYSYESEQSTSTWPTKSWQLTWLNSSYNKKLGVFNSTEFKPYHEAQRLLELGNESEAANILDNIDVLERKLLAVLINRPNFDVRKVEEKEVLSLTSLLSQTGGLFSIWIGLSMISLGEVVEMCIRCYLRVKHSR 636          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4E0RGY9 (FMRFamide activated amiloride sensitive sodium OS=Fasciola hepatica OX=6192 GN=D915_002226 PE=3 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 3.171e-109
Identity = 165/390 (42.31%), Postives = 249/390 (63.85%), Query Frame = 2
Query:    5 KSLGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYN-TSRLPFCGQGSVFINKNECSSPSKSENS------TCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAK 1153
            + LG+Q    V  CQ+TYLNGSK +A  CD  G W  +IH  Y+NC T+    + R  T ++E+Y+YL+E  +   CPDC   ++KSQ+SGA++ I   +   N+N+K I+L PG+LTEIRL T EN++  PPYGRCS   P+ L+++D E+ YSE  C+++TIQ +  + C C ++EYPYN  +    CG+   F+N++ CS+      S       C +  +  L+ + CK  IT+  +   +  CTMPC+F SYE+++STS WP K++Q+  ++    +   +   PEF+ YR+ ++L   G    A  +L+  N+LERNL+AVL+ +PNF++ KVEEK VLSLTS LSQ GGL SIW+GL+MIS+ E+FE IM+ ++ V   R+++
Sbjct:  240 RKLGYQNDKLVTKCQMTYLNGSKPVAARCDTRGRWRKFIHPQYLNCATFEPYRELRATTTSIEMYVYLDELTDHAFCPDCFSTEVKSQLSGALIVIHAADRLPNVNDKSINLKPGSLTEIRLSTVENVQKMPPYGRCSPELPESLQLYDTEYAYSEYACRESTIQNNIIQRCGCYSMEYPYNEKAGYEPCGRLPRFVNQSSCSATGLRNQSNSDDIEACTRETELFLKRIMCKRTITESSFHGAVSACTMPCAFYSYEAEQSTSSWPTKAWQLTFLNSSHNRRLGVFQGPEFDVYRRAQQLAEAGNETAAIHILEGVNLLERNLLAVLINRPNFDVRKVEEKEVLSLTSLLSQTGGLFSIWMGLSMISLGEIFEFIMRCYVKVRHARQSR 629          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Match: ENSAMXT00000038299.1 (acid-sensing ion channel 1 [Source:NCBI gene;Acc:103026179])

HSP 1 Score: 51.6026 bits (122), Expect = 1.122e-6
Identity = 79/379 (20.84%), Postives = 135/379 (35.62%), Query Frame = 2
Query:   11 LGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWT-DYIHAFYINCYTYNLKVQYRKMTKTME------VYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEF--VYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQL 1120
             GHQL++ ++ C+           +  +R G      I   Y  CYT+N     R +  TM+      + L L+   +E   P     D  S  +G  + I   +    I++ G  + PG  T +  +      + PP+G C +         D +F   YS   C+           C C  +  P +    P+C          EC+ P+          LD ++E              DY   C  PC+   Y  + S    P+K+                             + + K  NK    + DN  VL+    A+       N   +E+K    L   L  IGG   ++IG ++++I+E+F+ + ++
Sbjct:  168 FGHQLEDMLLQCR-----------FQGERCGPRNFSTIFTRYGKCYTFNSGQDGRPLLVTMKGGMGNGLELMLDIQQDEY-LPVWGETDETSFEAGIKVQIHTQDEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCRDAP------MDSDFFTTYSITACRIDCETRYLVENCNCRMVHMPGDA---PYCTPEQY----KECADPA----------LDFLVERDN-----------DYCV-CETPCNMTRYGKELSFVKIPSKA---------------------------SAKYLAKKFNKSEQYISDNILVLDIFFEAL-------NYETIEQKKAYELAGLLGDIGGQMGLFIGASILTILELFDYLYEV 465          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Match: ENSAMXT00000047165.1 (acid-sensing ion channel 1 [Source:NCBI gene;Acc:103026179])

HSP 1 Score: 48.9062 bits (115), Expect = 7.973e-6
Identity = 79/362 (21.82%), Postives = 128/362 (35.36%), Query Frame = 2
Query:  119 IHAFYINCYTYNLKVQYRKMTKTME------VYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAKSRLKYKENLDQ 1186
            I   Y  CYT+N     R +  TM+      + L L+   +E   P     D  S  +G  + I   +    I++ G  + PG  T +  +      + PP+G C  + P     F     YS   C+           C C  +  P +    P+C          EC+ P+          LD ++E              DY   C  PC+   Y  + S    P+K+                             + + K  NK    + DN  VL+    A+       N   +E+K    L   L  IGG   ++IG ++++I+E+F+ + ++ I     R AK   K   N D+
Sbjct:  222 IFTRYGKCYTFNSGQDGRPLLVTMKGGMGNGLELMLDIQQDEY-LPVWGETDETSFEAGIKVQIHTQDEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDC-RDAPMDSDFFT---TYSITACRIDCETRYLVENCNCRMVHMPGDA---PYCTPEQY----KECADPA----------LDFLVERDN-----------DYCV-CETPCNMTRYGKELSFVKIPSKA---------------------------SAKYLAKKFNKSEQYISDNILVLDIFFEAL-------NYETIEQKKAYELAGLLGDIGGQMGLFIGASILTILELFDYLYEV-IKYKLCRCAKKSHKRSNNNDR 514          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 61.6178 bits (148), Expect = 1.967e-10
Identity = 78/359 (21.73%), Postives = 133/359 (37.05%), Query Frame = 2
Query:   86 PCDRIGSWTDYIHAFYINCYTYNLK-----VQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSE---NTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKIL--DTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVV 1132
            PC     ++ + H  Y NCYT+N        Q  K  +   + L L  + N+            S ++GA + +   E+   + E G  + PG  T + ++  E  R+  PYG C+E   N P  L ++   +      C  +  Q+     C C    YP     LP         N + CS  + +    C   L    I + + C            ++ C  PC+   +      + WP  S +  + +    + N  ++                 +  + AKL    NV  R L          N+  + E A  ++   LS IG   S+W G +++S +E+ EL +   I+V
Sbjct:  224 PCSD-SEYSRFHHPTYGNCYTFNSANSSKLWQASKPGRDYGLSLILRTEQNDY-------IPFLSTVAGARIMVHDQESPPFMEEGGFDMRPGFETSLGIRMLEATRMPDPYGNCTEDGSNVP-VLNLYSSAYTVQVPEC--SCFQLALVEACGCGYYFYP-----LP--------PNASYCSYNNTAWAGHCYYKLYRQFISDELGC------------VDKCAQPCTTKRFAVTPGYAAWPDSSSEKWIFNLLSLQNNYSVTT----------------VRNDVAKL----NVYFREL----------NMKTISESAATNVIWLLSNIGSQWSLWFGSSVLSWLEVGELGIDCCIMV 516          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: asic1b (acid-sensing (proton-gated) ion channel 1b [Source:NCBI gene;Acc:407672])

HSP 1 Score: 47.3654 bits (111), Expect = 5.877e-6
Identity = 80/384 (20.83%), Postives = 138/384 (35.94%), Query Frame = 2
Query:   11 LGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAF--YINCYTYNLKVQYRKMTKT--------MEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTIL--ENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFL--SQIGGLCSIWIGLTMISIVEMFELIMQL 1120
            LGH L   V+ C+             C +     D+I  +  Y  CYT+N     R +  T        +E+ L +++   E   P     D  S  +G  + I   +    I++ G  + PG  T +  +    I + PP+G C ++TP     F+    YS   C+           C C  +  P +    P+C          EC+ P          +LD ++  +N  C               C  PC+   Y  + S    P+K+                             + + K  NK  A + +N  VL+    A+       N   +E+K    +   L    IGG   ++IG ++++I+E+F+ + +L
Sbjct:  167 LGHPLDEMVLSCRF------------CGQDCKPQDFITVYTRYGKCYTFNSGKGGRPLLTTVKGGMGNGLEIMLDIQQ---EEYLPVWGENDETSFEAGIKVQIHSQDEPPLIDQLGFGVSPGFQTFVSCQEQRLIYLPPPWGDC-KSTPISSDFFE---TYSITACRIDCETRYLVENCNCRMVHMPGDA---PYCTPEQY----TECARP----------VLDVLVKRDNDFCL--------------CETPCNMTRYGKELSMVKIPSKA---------------------------SAKYLAKKYNKTEAYIAENVLVLDIFFEAL-------NYETIEQKKAYEVAGLLETGDIGGQMGLFIGASILTILEIFDYVYEL 466          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO31696 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX71])

HSP 1 Score: 71.2478 bits (173), Expect = 1.798e-13
Identity = 83/395 (21.01%), Postives = 154/395 (38.99%), Query Frame = 2
Query:    5 KSLGHQLKNFV-------IYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMN----EINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPP-YGRC--SENTPKKLKMFDKEF--VYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYI---ENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVV 1132
            K +GHQ  + V       + C+  Y  G             WT + H  + NC+ +N  + + + T++  +++Y    +N    ++N       D  ++ +GA++ +          E+G  + PG  T+I L+  +  R+ P   G C   E +     +F ++F   YS+  C  + +      ECKC+   +P                            +S C  +  TI+E   C  ++  +  R+ +     C   C   +Y    S ++WP++ +Q ++ID                       L     N   +   D  N LE N+    L       + +EE     L +FLS IGG   +W+G+++++  E+ EL + +F  V
Sbjct:   75 KPMGHQFDDMVYKCTWRGVDCKANYTQGKY-----------WTSFWHYRFGNCFVFNPSIGWNRNTRS-RLHIYRTGPLNGLQLQLNIQQEEYIDQITKRAGAMIQVFPFGQMPFPEERGTLVAPGFSTDIGLEKMDIKRVDPHNNGSCVTDEASINTENIFKQKFNTSYSKTACVLSCLAYHQMHECKCMEYRFP---------------------------TDSVCDTLNSTIVE---CLAKVKFKLSRNELGCSTACGPACREEAYRLTSSFAVWPSQRYQNSIIDN----------------------LFDGIFNYSRSWFRD--NYLEVNIFFKELN------YFIEESVAYELVNFLSDIGGQLGLWVGVSVMTGAEVVELALLIFFKV 397          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO42137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F2])

HSP 1 Score: 70.0922 bits (170), Expect = 6.243e-13
Identity = 87/398 (21.86%), Postives = 150/398 (37.69%), Query Frame = 2
Query:    8 SLGHQLKNFVIYCQITYLN--GSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNE-------INCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENT---PKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSR-LPFCGQGSVFINKNECSSPSKSENSTCIKILD---TILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAK 1153
            S  HQL++ ++ C    +N   SK    P     +W D     + NCY +N      K     +V LY      E       +N       +  ++++G  + I          ++GI +MPG  T I++   +  RI P   R  E++     K   F     YS   CK + +       C C     P    R +P C +                 NST I  L+      E+  C  +            C   CS +S++   S++ WPA+SF++                 ++  + +++ L    +   ++K   N+     N+  V +     +   V+E    +  S LS IGG   +WIG++ ++  E+ EL+  + +   SNR  K
Sbjct:  160 SAAHQLEDILLSCNFNGVNCRNSKDPTIPTYWTQTWNDN----FGNCYMFN----SVKTHNGEKVDLYSSSVPGESNGLTLQLNLEQNEYLEGITEVAGMKVTISDQGVLPFPGQQGIRIMPGQSTGIQMTKLQTRRIDPFKNRSCESSNEMSDKNLFFGYNMTYSIMACKYSCLNARKIERCGCTNYNTPEMQKRNIPLCNR----------------LNSTIIDCLNKAYDTFEDGSCDRE------------CPPSCSEVSFDLTVSSARWPARSFEVT----------------KYAYFLRVRVL--NKIASSSSKYFVNS----ENIAQVHVYYGELDYLLVQETLAYTFMSLLSDIGGQMGMWIGISALTCAELIELVC-VILANMSNRSKK 498          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO33235 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SST7])

HSP 1 Score: 54.299 bits (129), Expect = 5.407e-8
Identity = 62/274 (22.63%), Postives = 109/274 (39.78%), Query Frame = 2
Query:    5 KSLGHQLKNFVIYCQITYLNGSKG----IAYPC--DRIGSWTDYIHAFYINCYTYNLKVQYRKMT----KTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPY-GRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKS 793
            K  GH + N         LN +KG    + YPC  +   S+  +   +   CYT+N    Y +      +   + LYL+   +E   P    YD      G  +A+       +++  G  + PG LT I +K F+ + + PP+  +C   T   L+ +++   YS KGC+      DF R+ KC  +            G   +   +N    P        + ++   L +         + +   + +C  PC  ++Y +  ST+ +PA S
Sbjct:  145 KKYGHNITNM--------LNRAKGCTFKMLYPCSGENFTSFFSFTRGW---CYTFNAGANYIQRVSVAGRETRLKLYLDAKSHEYYGP--FSYDG----VGFKIAVHDQNDVPDMDNGGYDISPGYLTTISVKRFKEVSLPPPFPTKCGSRT---LEHYER---YSTKGCEYECFAKDFVRKFKCKTL------------GMAPIKEIRNASFCP--------VSVVSAALMDF-------HKNWHLELCDCPKPCETVNYNAQLSTAHYPAPS 368          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO29540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3C8])

HSP 1 Score: 46.9802 bits (110), Expect = 7.708e-6
Identity = 69/307 (22.48%), Postives = 119/307 (38.76%), Query Frame = 2
Query:  317 INEKGISLMPGTLT--EIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYS--------EKGCKQATIQIDFE-------RECKCVAIEYPYNTSR--LPFCGQGSVFINKNEC-----SSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRS----TSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFE-LIMQLFIVVTSNRKA 1150
            I E   +L PGT T   +R+K + N+R  P    C EN     + F+  +  +        + G K+   Q  FE        EC  +   +  N  R  +P C     F    EC     + P   E + C K                        ++C +PC +  YE+  S     S   A+     L+  G           EF+   K+ E   K   +E    LD           V   + +++L  +E+K      S ++ IGG   +++G+++++++E F+ L+M+L   ++SN+K 
Sbjct:    2 IEETIFALQPGTHTFCSVRMKKYVNLR-APYRTECGENITDFNRYFNVNYTMAICSKQCLHDYGIKKCGCQPIFEITSYNNYFECDFLESFFWGNPFRKDVPLCSLNDTF----ECIYPTYNGPYPREAAECFK------------------------KSCPVPCYYTKYETKLSYASAISNAIARDIPTYLLTNG----------SEFDDIEKMTEGERKTFFRENVASLD-----------VYFDELSYDL--IEQKPSFDRWSLIAMIGGYLGLFLGMSLLTVLEFFDFLVMKLLNRISSNKKG 256          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: ENSORLT00000008662.2 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 57.3806 bits (137), Expect = 1.628e-8
Identity = 85/393 (21.63%), Postives = 144/393 (36.64%), Query Frame = 2
Query:   11 LGHQLKNFVIYCQITY-LNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTME------VYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLF---IVVTSNRKAKSR 1159
            LGHQL+  ++YC+    L G +  +            I   Y  CYT+N     + +  TM+      + L L+   +E   P     D  S  +G  + I   E    I++ G  + PG  T +  +      + PP+G C ++TP     F+    YS   C+           C C  +  P +    P+C          EC+ P+          LD ++E              DY   C  PC+   Y  + S    P+K+                             + + K  NK    + DN  VL+    A+       N   +E+K    L   L  IGG   ++IG ++++++E+F+ + ++    +     +K KSR
Sbjct:  178 LGHQLEEMLLYCRYQGELCGPRNFS-----------TIFTRYGKCYTFNSGKDGQPLMVTMKGGTGNGLELMLDIQQDEY-LPVWGETDETSFEAGIKVQIHTQEEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDC-KSTPMDSDFFNS---YSITACRIDCETRYLVENCNCRMVHMPGDA---PYCSPEQY----KECADPA----------LDFLVERD-----------NDYCV-CETPCNLTRYGKELSFVKIPSKA---------------------------SAKYLAKKFNKTEQYIADNILVLDIFFEAL-------NYETIEQKKAYELAGLLGDIGGQMGLFIGASILTVLELFDYLYEILKYKLCRCMKKKHKSR 491          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: asic1a (acid-sensing ion channel 1 [Source:NCBI gene;Acc:101159102])

HSP 1 Score: 52.373 bits (124), Expect = 6.854e-7
Identity = 74/382 (19.37%), Postives = 137/382 (35.86%), Query Frame = 2
Query:   14 GHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYR--------KMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPS-----KSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQL 1120
            GH +K+ ++ C   + +G++       R G +   +   Y  CYT+N     R         M   +E+ L +++D       D      ++ +   + + D P +   I++ G  + PG  T +  +    I + PP+G C + TP     FD    YS   C+           C C  +  P +    P+C          EC+ P+     + +N  C+                           C  PC+   Y  + S    P+K+                             + + K  NK    + DN  VL+    A+       N   +E+K    +   L  IGG   ++IG ++++I+E+F+ + ++
Sbjct:  162 GHDIKDMLLSC---HFHGTEC------RPGDFK-VVFTRYGKCYTFNAGGDGRPPLITTKGGMGNGLELMLDIQQDEYLPVWGDTDETSFEAGVKVQIHSQDEPPS---IDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDC-KVTPMDSDFFDS---YSITACRVDCETRYLVDNCNCRMVYMPGDA---PYCSPELY----KECADPALDFLVQRDNDFCV---------------------------CETPCNMTRYNKELSFVKIPSKA---------------------------SAKYLAKKYNKSEQYIKDNILVLDIFFEAL-------NYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTILEIFDYLYEV 458          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: ENSORLT00000031708.1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 51.6026 bits (122), Expect = 1.283e-6
Identity = 76/356 (21.35%), Postives = 129/356 (36.24%), Query Frame = 2
Query:  119 IHAFYINCYTYNLKVQYRKMTKTME------VYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLF---IVVTSNRKAKSR 1159
            I   Y  CYT+N     + +  TM+      + L L+   +E   P     D  S  +G  + I   E    I++ G  + PG  T +  +      + PP+G C ++TP     F+    YS   C+           C C  +  P +    P+C          EC+ P+          LD ++E              DY   C  PC+   Y  + S    P+K+                             + + K  NK    + DN  VL+    A+       N   +E+K    L   L  IGG   ++IG ++++++E+F+ + ++    +     +K KSR
Sbjct:  221 IFTRYGKCYTFNSGKDGQPLMVTMKGGTGNGLELMLDIQQDEY-LPVWGETDETSFEAGIKVQIHTQEEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDC-KSTPMDSDFFNS---YSITACRIDCETRYLVENCNCRMVHMPGDA---PYCSPEQY----KECADPA----------LDFLVERDN-----------DYCV-CETPCNLTRYGKELSFVKIPSKA---------------------------SAKYLAKKFNKTEQYIADNILVLDIFFEAL-------NYETIEQKKAYELAGLLGDIGGQMGLFIGASILTVLELFDYLYEILKYKLCRCMKKKHKSR 508          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: ENSORLT00000031246.1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 51.2174 bits (121), Expect = 1.626e-6
Identity = 76/356 (21.35%), Postives = 129/356 (36.24%), Query Frame = 2
Query:  119 IHAFYINCYTYNLKVQYRKMTKTME------VYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLF---IVVTSNRKAKSR 1159
            I   Y  CYT+N     + +  TM+      + L L+   +E   P     D  S  +G  + I   E    I++ G  + PG  T +  +      + PP+G C ++TP     F+    YS   C+           C C  +  P +    P+C          EC+ P+          LD ++E              DY   C  PC+   Y  + S    P+K+                             + + K  NK    + DN  VL+    A+       N   +E+K    L   L  IGG   ++IG ++++++E+F+ + ++    +     +K KSR
Sbjct:  187 IFTRYGKCYTFNSGKDGQPLMVTMKGGTGNGLELMLDIQQDEY-LPVWGETDETSFEAGIKVQIHTQEEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDC-KSTPMDSDFFNS---YSITACRIDCETRYLVENCNCRMVHMPGDA---PYCSPEQY----KECADPA----------LDFLVERDN-----------DYCV-CETPCNLTRYGKELSFVKIPSKA---------------------------SAKYLAKKFNKTEQYIADNILVLDIFFEAL-------NYETIEQKKAYELAGLLGDIGGQMGLFIGASILTVLELFDYLYEILKYKLCRCMKKKHKSR 474          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000045054.1 (SMESG000045054.1)

HSP 1 Score: 940.258 bits (2429), Expect = 0.000e+0
Identity = 455/456 (99.78%), Postives = 455/456 (99.78%), Query Frame = 2
Query:    5 KSLGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAKSRLKYKENLDQTWTYDFLNPHCVNPSNSKSSNDSFCKEDQTVKENNCLPHFHQISVFNSGILKCQKCNEENTL 1372
            KSLGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGS FINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAKSRLKYKENLDQTWTYDFLNPHCVNPSNSKSSNDSFCKEDQTVKENNCLPHFHQISVFNSGILKCQKCNEENTL
Sbjct:  206 KSLGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSAFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAKSRLKYKENLDQTWTYDFLNPHCVNPSNSKSSNDSFCKEDQTVKENNCLPHFHQISVFNSGILKCQKCNEENTL 661          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000064187.1 (SMESG000064187.1)

HSP 1 Score: 378.637 bits (971), Expect = 5.218e-126
Identity = 184/373 (49.33%), Postives = 258/373 (69.17%), Query Frame = 2
Query:    5 KSLGHQLKNFVIYCQITYLNGSKGIAYPCDR---IGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIM 1114
            KSLG+ L NFVI CQ+++L GS+  A  C      G+W  +IHA Y+NC+T+++    +    T+E++LYL+E+MN   C DC   +IKSQ+SGAV+A+  P TF NIN + I++ PG+LTEI L+   NI+  PPYGRCS  TPK + M+     YSE  C+Q TIQ +  ++C C AIEYP+ ++ +PFC    +F+ K  C +P+ + NS+CIK +   L  ++CK  +  +Y +D +E+C++PCSF SYE+DRS S WP K +Q+  ++  V K   ++++ EF+PYR+I EL   G  KEA  LL  TNVLERNL+A+L+ +PNFNLHKVEEK VLSLTSFLSQ GGL SIW+GLTMIS+VE+ EL++
Sbjct:  187 KSLGYNLSNFVINCQMSFLKGSQRSAVQCQAGTPYGTWRQFIHAQYLNCHTFDISPILQNNVTTLEMFLYLDENMNSNTCIDCFHAEIKSQLSGAVIAVHTPGTFPNINGRSINVTPGSLTEITLQNILNIQKAPPYGRCSPKTPKTVYMYGYNVSYSEFACRQITIQNEIIKKCGCRAIEYPFVSTDIPFCSSMPIFVPKRNCETPT-AINSSCIKQMTIALNRIKCKISVINQYNKDVVESCSLPCSFHSYETDRSVSTWPTKLWQLEWLNSRVAKSFGMLNRTEFQPYRRIIELQKVGKEKEAMDLLYQTNVLERNLLALLIDRPNFNLHKVEEKEVLSLTSFLSQSGGLFSIWLGLTMISLVEVIELLV 558          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000044381.1 (SMESG000044381.1)

HSP 1 Score: 349.747 bits (896), Expect = 1.285e-114
Identity = 175/382 (45.81%), Postives = 244/382 (63.87%), Query Frame = 2
Query:   11 LGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPY-RKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLFIVVTSNRKAK 1153
            LGH  ++ +IYCQ+TY+NGS      C  IG W   IHA YINCY+YNL   Y + T TME+Y YL++ + +  C DC   D+KSQ+SGA++ I R  TF N N   I+L PGTLTEI+LK F N+   PPYGRCS  +PK +K+++  + YSE  CK  TIQ D  ++C C AIEYP +   L FC     FI    C       +  C   LD +++ + CK  ++ +Y +D +++C++PC   SYESDRSTS WP K++Q+  I     +   +  KPE + Y    +E +   +NK + ++L+  N+LE+NL+AV++ +PN+N+H VEEK VLSLTSFLSQ GGLCSIWIGLTMISIVE+ E+++  F  + + RK K
Sbjct:  165 LGHDEQDLIIYCQVTYMNGSSPHYKVCSDIGKWRVIIHAQYINCYSYNLYENYSRNTNTMELYFYLDQGIPDSMCLDCFSSDVKSQLSGALVLIHRRLTFPNFNHDIINLQPGTLTEIKLKIFNNVHKEPPYGRCSYKSPKTMKIYNDLYSYSEHACKLLTIQHDINKQCGCNAIEYPIDNFNLSFCSNLPRFIEGKLCH--DDQSDMKCKHQLDAVVKKIICKSNVSSQYQKDIVKSCSLPCDIYSYESDRSTSSWPTKTWQMPWIKSNAARR--LRKKPELKGYIDAYREYLNGSVNK-SFRILNQQNILEQNLLAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLCSIWIGLTMISIVEVIEMLLNCFSQLKTARKRK 541          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000069611.1 (SMESG000069611.1)

HSP 1 Score: 347.051 bits (889), Expect = 1.296e-113
Identity = 172/371 (46.36%), Postives = 241/371 (64.96%), Query Frame = 2
Query:   11 LGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKS-ENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQL 1120
            LGH   +FVI C IT+ NGSK     C  IG W    HA +INC++YN+K ++ +   T+E+YLYL E+ N   C DC   ++KSQ+SGA+L I +  +F NIN++ I+L PGTLTE+RLKTF N+  T PYGRC  NTP  L+M ++ + Y+E  CK+ TIQ++   +C C AIEYP     L FC     FI    C + S   E   C + + T L+ + CK  +T  Y+ D I+ C +PC + SYESDRS S WP KS+Q+  ++    + +N+ SK E +PY+   E   +G   +A ++L+  ++LE  L+AV++ +PN NLH+VEEK VLSLTSFLSQ+GGL SIWIGLT+ISIVE+ EL+M++
Sbjct:  198 LGHDYYDFVIDCLITFRNGSKHHVDLCQNIGQWKVTPHAQFINCFSYNIKAEFIEEVTTIELYLYLNEETNVSRCIDCFISNVKSQLSGALLVIHKSNSFPNINQEAINLQPGTLTEVRLKTFFNVMKTAPYGRCKPNTPSNLEMGNETYSYTEHLCKEKTIQLEINNKCHCNAIEYPVVNRNLSFCSALPTFIKFGSCETNSHDKEQEKCFEEIKTSLKRLECKSSVTVLYHNDIIDTCFLPCEYYSYESDRSISTWPTKSWQLTWLNSS--RGSNVRSKKELKPYKIAAEYFKEGKEDKAIEILNKQDILESKLIAVVINRPNKNLHRVEEKEVLSLTSFLSQLGGLFSIWIGLTLISIVEIIELLMRI 566          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000028687.1 (SMESG000028687.1)

HSP 1 Score: 336.265 bits (861), Expect = 2.498e-109
Identity = 169/371 (45.55%), Postives = 233/371 (62.80%), Query Frame = 2
Query:   11 LGHQLKNFVIYCQITYLNGSKGIAYPCDRIGSWTDYIHAFYINCYTYNLKVQYRKMTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINEKGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEKGCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKSENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTSMWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLLDNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGLTMISIVEMFELIMQLF 1123
            LGH+ ++ +I+C++TY+ GSK  +  CD +G W   IHA Y+NCY ++L       T T+E++LYL+E +N+  C DC   D+KSQ+SGA++ I R  TF N N   I+L PGTLTEI+LKT  N    PPYGRCS  TPK +K+F + + YSE  CK  TIQ D    C C AIEYP+N S L FC     F  +  C+  ++  +  C   L   ++ + CK +    Y  D + +C +PCSF SYE+DRSTS WP KS+Q+  I     K   ++ K E + YR   +L  KG   EA K+L+  N +E+ ++AV++ +PN+N+H VEEK VLSLTSFLSQ GGL SIWIG+T+ SIVE+FE+    F
Sbjct:  189 LGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFNYSSLKFCSALPSFSQRVSCN--NRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKP--LLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMFANCF 555          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCNN1A3.985e-1220.90sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A4.288e-1220.90sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A5.545e-1220.90sodium channel epithelial 1 alpha subunit [Source:... [more]
ASIC12.651e-722.04acid sensing ion channel subunit 1 [Source:HGNC Sy... [more]
SCNN1B2.766e-721.58sodium channel epithelial 1 beta subunit [Source:H... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1051.513e-1223.60Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1051.811e-1223.79Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1051.811e-1223.79Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1051.867e-1223.79Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1051.867e-1223.79Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ppk288.159e-622.76gene:FBgn0030795 transcript:FBtr0074335[more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
asic1b1.179e-721.11acid-sensing (proton-gated) ion channel 1b [Source... [more]
asic1a6.745e-620.63acid-sensing (proton-gated) ion channel 1a [Source... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdh123.774e-920.10cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh124.576e-820.46cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scnn1a4.890e-1221.94sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a5.172e-1221.94sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a5.651e-1221.94sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a5.651e-1221.94sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a5.713e-1221.94sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP1.122e-1520.29FMRFamide-activated amiloride-sensitive sodium cha... [more]
sp|O97741|SCNNA_RABIT1.127e-1222.63Amiloride-sensitive sodium channel subunit alpha O... [more]
sp|Q22851|ASIC2_CAEEL4.110e-920.90Degenerin-like protein asic-2 OS=Caenorhabditis el... [more]
sp|A5D7U4|SCNNB_BOVIN1.047e-821.26Amiloride-sensitive sodium channel subunit beta OS... [more]
sp|H1AFJ6|SCNNB_NEOFS1.172e-821.15Amiloride-sensitive sodium channel subunit beta OS... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4V3SD104.376e-11543.41Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2L7073.409e-11243.04Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7Y6094.442e-11142.93FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A4Z2CZ766.237e-11045.27FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A4E0RGY93.171e-10942.31FMRFamide activated amiloride sensitive sodium OS=... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000038299.11.122e-620.84acid-sensing ion channel 1 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000047165.17.973e-621.82acid-sensing ion channel 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SCNN1A1.967e-1021.73sodium channel epithelial 1 alpha subunit [Source:... [more]
asic1b5.877e-620.83acid-sensing (proton-gated) ion channel 1b [Source... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO316961.798e-1321.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421376.243e-1321.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332355.407e-822.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295407.708e-622.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000008662.21.628e-821.63acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
asic1a6.854e-719.37acid-sensing ion channel 1 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000031708.11.283e-621.35acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
ENSORLT00000031246.11.626e-621.35acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045054.10.000e+099.78SMESG000045054.1[more]
SMESG000064187.15.218e-12649.33SMESG000064187.1[more]
SMESG000044381.11.285e-11445.81SMESG000044381.1[more]
SMESG000069611.11.296e-11346.36SMESG000069611.1[more]
SMESG000028687.12.498e-10945.55SMESG000028687.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030945 ID=SMED30030945|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1375bp
CTGAAAAAGCCTGGGACATCAGCTAAAGAATTTTGTAATTTATTGCCAAA
TAACTTATTTGAACGGCAGCAAAGGAATCGCATATCCATGCGACCGAATC
GGTAGTTGGACTGATTATATACATGCCTTTTATATAAACTGCTATACATA
TAATCTGAAAGTTCAGTATCGAAAGATGACTAAAACAATGGAGGTTTATT
TATACTTGGAAGAAGACATGAATGAAATTAACTGTCCTGATTGTATGCGA
TATGATATTAAGTCACAAATTTCTGGAGCCGTCCTTGCAATTGATCGGCC
AGAGACGTTCTCTAATATAAACGAAAAAGGTATTTCTTTAATGCCGGGGA
CGCTAACGGAAATTCGGTTAAAGACTTTCGAAAACATTCGAATCACTCCA
CCATATGGACGATGTTCGGAGAATACCCCCAAAAAACTAAAAATGTTCGA
CAAAGAATTTGTTTACTCTGAAAAAGGATGCAAACAAGCAACTATTCAAA
TAGATTTTGAACGGGAATGTAAATGTGTTGCCATTGAATATCCGTACAAC
ACGAGCCGTTTGCCGTTTTGTGGCCAAGGATCAGTTTTTATAAACAAAAA
TGAATGCTCTTCACCGTCGAAATCTGAGAATTCAACTTGTATTAAAATAT
TGGACACCATCCTTGAAAATATGAGATGCAAAGAACAAATTACTCAACGA
TATTATCGTGATTACATTGAGAATTGCACAATGCCATGTTCATTTTTATC
CTATGAAAGTGACAGGTCCACGTCTATGTGGCCAGCGAAATCTTTCCAGA
TTGCATTAATTGACAAAGGGGTATTTAAGGAGAATAATATCATTTCCAAA
CCAGAATTTGAGCCCTATCGAAAGATTAAAGAACTTATTGGTAAAGGAAT
GAATAAAGAAGCTGCCAAACTCCTTGACAATACAAATGTTCTTGAAAGAA
ATCTTGTGGCGGTTTTATTAATTAAACCGAATTTTAATTTACACAAAGTT
GAGGAAAAGGCAGTTCTATCATTGACTTCCTTTCTCAGTCAAATCGGAGG
CTTGTGTAGCATTTGGATTGGGTTGACAATGATCAGCATTGTTGAAATGT
TTGAATTGATAATGCAACTCTTTATCGTGGTGACGTCGAATCGAAAAGCA
AAATCTCGTTTGAAATATAAAGAGAACCTTGATCAGACATGGACATACGA
CTTTCTAAATCCACACTGTGTCAACCCATCAAATTCAAAATCGTCTAACG
ACTCTTTCTGTAAAGAAGACCAAACTGTCAAAGAGAACAACTGTTTGCCA
CATTTCCACCAAATATCCGTGTTTAACTCAGGCATTCTCAAGTGTCAAAA
ATGTAACGAAGAGAATACGTTGTAG
back to top

protein sequence of SMED30030945-orf-1

>SMED30030945-orf-1 ID=SMED30030945-orf-1|Name=SMED30030945-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=400bp
MTKTMEVYLYLEEDMNEINCPDCMRYDIKSQISGAVLAIDRPETFSNINE
KGISLMPGTLTEIRLKTFENIRITPPYGRCSENTPKKLKMFDKEFVYSEK
GCKQATIQIDFERECKCVAIEYPYNTSRLPFCGQGSVFINKNECSSPSKS
ENSTCIKILDTILENMRCKEQITQRYYRDYIENCTMPCSFLSYESDRSTS
MWPAKSFQIALIDKGVFKENNIISKPEFEPYRKIKELIGKGMNKEAAKLL
DNTNVLERNLVAVLLIKPNFNLHKVEEKAVLSLTSFLSQIGGLCSIWIGL
TMISIVEMFELIMQLFIVVTSNRKAKSRLKYKENLDQTWTYDFLNPHCVN
PSNSKSSNDSFCKEDQTVKENNCLPHFHQISVFNSGILKCQKCNEENTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 165..182
score: 27.33
coord: 154..165
score: 32.0
coord: 34..50
score: 36.0
coord: 121..137
score: 27.76
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 3..368
e-value: 5.9E-41
score: 140.9
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 32..381
NoneNo IPR availableTMHMMTMhelixcoord: 353..375