FMRFamide-activated amiloride-sensitive sodium channel-like

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel-like
Smed IDSMED30030944
Length (bp)1727
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel-like (SMED30030944) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel-like (SMED30030944) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel-like (SMED30030944) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel-like (SMED30030944) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030944

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30030944SMESG000013072.1 dd_Smed_v4_34707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030944SMESG000013072.1 dd_Smed_v4_34707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30030944SMESG000013072.1 dd_Smed_v4_34707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30030944SMESG000013072.1 dd_Smed_v4_34707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30030944SMESG000013072.1 Contig2691newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30030944SMESG000013072.1 Contig2691uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30030944SMESG000020808.1 Contig2691newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30030944SMESG000020808.1 Contig2691uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Ensembl Mouse
Match: Asic5 (acid-sensing (proton-gated) ion channel family member 5 [Source:MGI Symbol;Acc:MGI:1929259])

HSP 1 Score: 56.6102 bits (135), Expect = 5.896e-8
Identity = 114/506 (22.53%), Postives = 193/506 (38.14%), Query Frame = 1
Query:  145 ETFCLKTNAHGFFKVIED-TKIMRIIWICIMCVTVSGXXXXXXXXXXXXXXXXXXXXVEIKSKHEFSMPDVTICPKQRFFFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIWKILGF-EVDANKLG------------RYSILQISQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCLIFRPNDRNIKTLNEIP--DLFLIILIPMIGNDDIYESIFQSSSEVEQMRSGSSIFIHPPMTLPEFETQELIVP-----RDNLLQLAIERNEYYLYEINNKCQNNNSPLRIRQSEKISEFL-YTQSGCLNLRKQLYIYRNCNCVSEILFLPEEIPETVIPCHQISVELISNSFKDNYTAWLVQQPSARSLQLNHQCHDKFLLSFNSDNEINNCPVPCDSVTFTYDVSLLNIKDIVPQFQPLIFEAASEVIAKFANSTVPTGQVENLYNIEFSMKLGFMSLLPKSFKITIMKETLVYQLGQFFSDVGGSMGLFVG 1596
            + F + T+ HG   + ++  K+ ++IW+ ++  +VS L+  I   L           +E++   +   P VT+C   RF                  ++      I F+ + I S    K+L   E+ AN  G             +SI +  +N N     ND LV   +  +  S  +F  +    G  C  F   + NI+  N++      L +L+      D+++  F  +       +G    IH P   P+F+   L  P     R  + QL     EY   E N                K+  F+ Y+  GCL   K  +I R C C      LP  +P   + C                   L++  +  S  L+H    K L +  + N  ++CPV C+   +   VS          +     + A+  +AK  N +    + ENL NIE    + +  L   ++KIT  ++ +   + +  +DVGG +GLF G
Sbjct:   39 QDFAMSTSFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKIEFPAVTLCNLNRF-----------------QTEAVSRFGIIFFLWDIVS----KVLRLQEISANNTGSPETLDFVTNHQNFSITEFVKN-NGFYLNNDTLVHCEFFGKTCSPKDFKHVFTEYG-NCFTFNYGE-NIQNKNKVSVSGRGLKLLL------DVHQEEFTDNPVPGFADAGVIFVIHSPKKEPQFDGLGLSSPVGMHARVTIRQLKTVHQEYPWGECNPNI-------------KLRNFITYSTYGCLKECKARHIQRLCGC------LPFLLPGNGVECD------------------LLEYYNCVSPILDH-IERKGLCTMGTHN--SSCPVSCEETEYPATVS----------YSTFPSQRATRFLAKKLNQSQEYIR-ENLVNIE----INYSDL---NYKITQQQKAV--SVPELLADVGGQLGLFCG 454          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Ensembl Mouse
Match: Asic5 (acid-sensing (proton-gated) ion channel family member 5 [Source:MGI Symbol;Acc:MGI:1929259])

HSP 1 Score: 54.6842 bits (130), Expect = 2.313e-7
Identity = 113/502 (22.51%), Postives = 191/502 (38.05%), Query Frame = 1
Query:  157 LKTNAHGFFKVIED-TKIMRIIWICIMCVTVSGXXXXXXXXXXXXXXXXXXXXVEIKSKHEFSMPDVTICPKQRFFFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIWKILGF-EVDANKLG------------RYSILQISQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCLIFRPNDRNIKTLNEIP--DLFLIILIPMIGNDDIYESIFQSSSEVEQMRSGSSIFIHPPMTLPEFETQELIVP-----RDNLLQLAIERNEYYLYEINNKCQNNNSPLRIRQSEKISEFL-YTQSGCLNLRKQLYIYRNCNCVSEILFLPEEIPETVIPCHQISVELISNSFKDNYTAWLVQQPSARSLQLNHQCHDKFLLSFNSDNEINNCPVPCDSVTFTYDVSLLNIKDIVPQFQPLIFEAASEVIAKFANSTVPTGQVENLYNIEFSMKLGFMSLLPKSFKITIMKETLVYQLGQFFSDVGGSMGLFVG 1596
            + T+ HG   + ++  K+ ++IW+ ++  +VS L+  I   L           +E++   +   P VT+C   RF                  ++      I F+ + I S    K+L   E+ AN  G             +SI +  +N N     ND LV   +  +  S  +F  +    G  C  F   + NI+  N++      L +L+      D+++  F  +       +G    IH P   P+F+   L  P     R  + QL     EY   E N                K+  F+ Y+  GCL   K  +I R C C      LP  +P   + C                   L++  +  S  L+H    K L +  + N  ++CPV C+   +   VS          +     + A+  +AK  N +    + ENL NIE    + +  L   ++KIT  ++ +   + +  +DVGG +GLF G
Sbjct:    1 MSTSFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKIEFPAVTLCNLNRF-----------------QTEAVSRFGIIFFLWDIVS----KVLRLQEISANNTGSPETLDFVTNHQNFSITEFVKN-NGFYLNNDTLVHCEFFGKTCSPKDFKHVFTEYG-NCFTFNYGE-NIQNKNKVSVSGRGLKLLL------DVHQEEFTDNPVPGFADAGVIFVIHSPKKEPQFDGLGLSSPVGMHARVTIRQLKTVHQEYPWGECNPNI-------------KLRNFITYSTYGCLKECKARHIQRLCGC------LPFLLPGNGVECD------------------LLEYYNCVSPILDH-IERKGLCTMGTHN--SSCPVSCEETEYPATVS----------YSTFPSQRATRFLAKKLNQSQEYIR-ENLVNIE----INYSDL---NYKITQQQKAV--SVPELLADVGGQLGLFCG 412          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. UniProt/SwissProt
Match: sp|Q9R0Y1|ASIC5_MOUSE (Acid-sensing ion channel 5 OS=Mus musculus OX=10090 GN=Asic5 PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 4.124e-7
Identity = 114/506 (22.53%), Postives = 193/506 (38.14%), Query Frame = 1
Query:  145 ETFCLKTNAHGFFKVIED-TKIMRIIWICIMCVTVSGXXXXXXXXXXXXXXXXXXXXVEIKSKHEFSMPDVTICPKQRFFFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIWKILGF-EVDANKLG------------RYSILQISQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCLIFRPNDRNIKTLNEIP--DLFLIILIPMIGNDDIYESIFQSSSEVEQMRSGSSIFIHPPMTLPEFETQELIVP-----RDNLLQLAIERNEYYLYEINNKCQNNNSPLRIRQSEKISEFL-YTQSGCLNLRKQLYIYRNCNCVSEILFLPEEIPETVIPCHQISVELISNSFKDNYTAWLVQQPSARSLQLNHQCHDKFLLSFNSDNEINNCPVPCDSVTFTYDVSLLNIKDIVPQFQPLIFEAASEVIAKFANSTVPTGQVENLYNIEFSMKLGFMSLLPKSFKITIMKETLVYQLGQFFSDVGGSMGLFVG 1596
            + F + T+ HG   + ++  K+ ++IW+ ++  +VS L+  I   L           +E++   +   P VT+C   RF                  ++      I F+ + I S    K+L   E+ AN  G             +SI +  +N N     ND LV   +  +  S  +F  +    G  C  F   + NI+  N++      L +L+      D+++  F  +       +G    IH P   P+F+   L  P     R  + QL     EY   E N                K+  F+ Y+  GCL   K  +I R C C      LP  +P   + C                   L++  +  S  L+H    K L +  + N  ++CPV C+   +   VS          +     + A+  +AK  N +    + ENL NIE    + +  L   ++KIT  ++ +   + +  +DVGG +GLF G
Sbjct:   39 QDFAMSTSFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKIEFPAVTLCNLNRF-----------------QTEAVSRFGIIFFLWDIVS----KVLRLQEISANNTGSPETLDFVTNHQNFSITEFVKN-NGFYLNNDTLVHCEFFGKTCSPKDFKHVFTEYG-NCFTFNYGE-NIQNKNKVSVSGRGLKLLL------DVHQEEFTDNPVPGFADAGVIFVIHSPKKEPQFDGLGLSSPVGMHARVTIRQLKTVHQEYPWGECNPNI-------------KLRNFITYSTYGCLKECKARHIQRLCGC------LPFLLPGNGVECD------------------LLEYYNCVSPILDH-IERKGLCTMGTHN--SSCPVSCEETEYPATVS----------YSTFPSQRATRFLAKKLNQSQEYIR-ENLVNIE----INYSDL---NYKITQQQKAV--SVPELLADVGGQLGLFCG 454          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. TrEMBL
Match: A0A1I8J7S3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 3.851e-27
Identity = 138/549 (25.14%), Postives = 229/549 (41.71%), Query Frame = 1
Query:  163 TNAHGFFKVIEDTKIMRIIWICIMCVTVSGXXXXXXXXXXXXXXXXXXXXVEIKSKHE-FSMPDVTICPKQRFFFYDEKLLTNYIIPAFTPSDIAV---LNNISFYQYFIQSSLIWKILGFEVDANKLGRYSILQISQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCLIFRPNDRNIKTLNEIP--DLFLIILIPMIGNDDI--YESIFQSSSEVEQMRSGSSIFIHPPMTLPEFETQELIVP--RDNLLQLAIERNEYYLYEINN---KCQNNNSPLRIRQSEKISEFLYTQSGCLNLRKQLYIYRNCNCVSEILFLPEEIPETVIPCHQISVELISNSFKD--------------------------------NYTAW---------LVQQPSARSLQLNHQCH---DKFLLSFNSDNEINNCPVPCDSVTFTYDVSLLNIKDIVPQFQPLIFEAASEVIAKFA--------NSTVPTGQVE----NLYNIEFSMKLGFMS--LLPKSFKITIMKETLVYQLGQFFSDVGGSMGLFVG 1596
            T AHGF+K+  + K +R +W+ I+C  +  +   + ++L  +        VE K   E F +PDVT CP Q    Y E +     +     S+  +     ++S    F  +   W   G    A ++ RYS+ + +   N+ R P   ++  N+               P    C+     DR +    E    DL L   I  + N  +  Y++I  ++ E      G S+++HPP T+P+  +Q++ V   R+ ++   IER++     IN+   KC  N SPL + Q +K+  F YT+  C +++ Q  I   C+C+SE   +P  +  T   CH+I   LI   +                                  NY+ W          +    A  +    QCH   + FL +     E  +C  PC++V   Y  S L+ K ++ +F    F+A  + +AK +        N++V  G +E    NL+ +  S +L F    LL    +     E   Y   QF+SDVGG +GL+ G
Sbjct:    2 TTAHGFYKLRVENKAVRRLWMLIICCAL--IAFGVHIILLAINYLQYIVTVETKYNSEPFVLPDVTFCPNQP---YHESVWCRRDLACTQDSNATIPSLGGDLSVQTAFRNTYNFWTAAGEGFIAPEIARYSLRKYTVEANMTRNPVTTVLYCNFRGETCGPWNMTIFFDPLSEACVTVSMTDRRVFQAGEQSALDLMLFSFI-FVQNPSVPYYKAI--TNMERFDFNFGYSMYVHPPNTVPD-HSQDVQVSETRNYVISAGIERSK----SINSPVKKCAENPSPLTLLQFDKLRSFAYTKDACESVKAQEIIVGRCSCLSEKYLVPSSLASTKPYCHEIDPSLIQYPYTTVANKTVQYIDRYVASTNFTLCWNATVNLTLPCNYSYWSKWNTTYLDSMALAQATGILTRRQCHKDAEAFLAANQGYKE--SCLKPCETV--AYPFSSLSTK-LISEFSDKNFQAKLDEVAKTSNLYKEWAINNSVYYGDLERVGKNLFKLGLSTRLLFTRVVLLANGNEGVSTVEKYSYPPEQFWSDVGGVLGLWAG 532          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. TrEMBL
Match: A0A1I8I9S9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.303e-17
Identity = 118/528 (22.35%), Postives = 221/528 (41.86%), Query Frame = 1
Query:  151 FCLKTNAHGFFKVIEDTKIMRIIWICIMCVTVSGXXXXXXXXXXXXXXXXXXXXVEIKSKHEFSMPDVTICPKQRFFFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIWKILGFEVDANKLGRYSILQI---SQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCLIFRPNDRNIKTLNEIPDLFLIILIPMIGNDDIYESIFQSSSEVEQMR-SGSSIFIHPPMTLPEFETQELIVPRDNL--LQLAIERNEYYLYEINNKCQNNNS-PLRIRQSEK-ISEFLYTQSGCLNLRKQLYIYRNCNCVSEILFLPEE-------------IPETVIPCHQISVELISNSFKDNYTAWLVQQ-----------PSARSLQLNHQCHDKFLLSFNSDNEINNCPVPCDSVTFTYDVSLLNIKDIVP-QFQPLIFEAASEVIAKFANSTVPTGQVENLYNI----------EFSMKLGFMSLL---PKSFKITIMKETLVYQLGQFFSDVGGSMGLFVG 1596
            F + T AHGF  +++++  +RI+W  ++ +   G    +  L+E+ L+  L  E+   S+ EF  PDVT+C   ++       + +  I   T S +  L N +F+     +   WK   + +  + L +YS + +   +  +N+     DI     Y  + ++ +       P+ FRC   RP +R I ++N+   L L I    IGN        +++  +++   +G  + +  P   P       IVP   +   ++++ R E       +  +++N  P+++   +  +S + YTQS C  L  Q Y+ R C CVS    +P E             +  T++   +I    ++NS  +     LV++            +    +  H+CH K L  F +  E   CP  C  V +TY     + + + P Q      E    +     N ++  G    L+            ++   +G+ + +     S + T  +E   Y L   FS++GG +GL+VG
Sbjct:   41 FFVTTTAHGFLHIVQNSIYLRIVWALLIVIAFGGFGLHLSTLVEKYLSYPLTTEIRY-SEVEFEFPDVTVCLTTKYRHCLNIDVRDPRIGLVTNSTVPSLGNYNFWSALNNTFTFWK-QAYGLKDDLLIKYSTVGMRSYTYEINITNRRTDIATGIEYKQKALNLDNVVAYDDPELFRCATVRPKNRAINSVNDAMGLILSIFDQYIGN--------KTTPLIDRAWVAGVRVTLSEPNARPNL-INSFIVPPGTIKHTKVSMTRQEKRKTPKQDCYESSNDLPIQVLNPDGTLSSYRYTQSDCRELELQKYVMRKCGCVSNFKLVPAEFKSLSGSLKYCLDLDPTILKAKKI---FLANSSSNGSQTLLVEKFDSSVVPMELILAQTGFRAQHECHLKALGDFVASAE--TCPPSC--VAYTYQA--YSSESLWPFQIDQYFAERILNLFQSAYNYSLEKGLPVPLFKCFEAGATITSRDYWKMIGYFNRVVISSNSLRGTQYQEKESYPLAGLFSNMGGILGLYVG 548          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. TrEMBL
Match: A0A1I8J7I0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.514e-16
Identity = 99/426 (23.24%), Postives = 181/426 (42.49%), Query Frame = 1
Query:  151 FCLKTNAHGFFKVIEDTKIMRIIWICIMCVTVSGXXXXXXXXXXXXXXXXXXXXVEIKSKHEFSMPDVTICPKQRFFFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIWKILGFEVDANKLGRYSILQI---SQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCLIFRPNDRNIKTLNEIPDLFLIILIPMIGNDDIYESIFQSSSEVEQMR-SGSSIFIHPPMTLPEFETQELIVPRDNL--LQLAIERNEYYLYEINNKCQNNNS-PLRIRQSEK-ISEFLYTQSGCLNLRKQLYIYRNCNCVSEILFLPEE-------------IPETVIPCHQISVELISNSFKDNYTAWLVQQ-----------PSARSLQLNHQCHDKFLLSFNSDNEINNCPVPCDSVTFTYDV 1332
            F + T AHGF  +++++  +RI+W  ++ +   G    +  L+E+ L+  L  E+   S+ EF  PDVT+C   ++       + +  I   T S +  L N  F+     +   WK   + +  + L +YS + +   +  +N+     DI     Y  + ++ +       P+ FRC   RP DR I ++N+   L L I    IGN        +++  +++   +G  + +  P   P       IVP   +   ++++ R E       +  +++N  P+++   +  +S + YTQS C  L  Q Y+ R C CVS    +P E             +  T++   +I    ++NS  +     LV++            +    +  H+CH K L  F +  E   CP  C  V +TY  
Sbjct:   41 FFVTTTAHGFLHIVQNSIYLRIVWALLIVIAFGGFGLHLSTLVEKYLSYPLTTEIRY-SEVEFEFPDVTVCLTTKYRHCLNIDVRDPRIGLVTNSTVPSLGNYHFWSALNNTFTFWK-QAYGLKDDLLIKYSTVGMRGYTYEINITNRRTDIATGIEYKQKALNLDNVVAYDDPELFRCATVRPKDRAINSVNDAMGLILSIFDQYIGN--------KTTPLIDRAWVAGVRVTLSEPNARPNL-INSFIVPPGTIKHTKVSMTRQEKRKTPKQDCYESSNDLPIQVLNPDGTLSSYRYTQSDCRELELQKYVMRKCGCVSNFKLVPAEFKSLSGSLKYCLDLDPTILKAKKI---FLANSSSNGSQTLLVEKFDSSVVPMELILAQTGFRAQHECHLKALGDFVASAE--TCPPSC--VAYTYQA 448          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. TrEMBL
Match: A0A1I8IIE8 (RRM domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 3.979e-16
Identity = 120/503 (23.86%), Postives = 208/503 (41.35%), Query Frame = 1
Query:  151 FCLKTNAHGFFKVIEDTK--IMRIIWICIMCVTVSGXXXXXXXXXXXXXXXXXXXXVEIKSKHEFSMPDVTICPKQRFFFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIWKILGFEVDAN----KLGRYSILQISQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCLIFRPNDRNIKTLNEIPDLFLIILIPMIGNDDIYESIFQSSSEVEQMRSGSSIFIHPPMTLPEFETQELIVPRDNLLQLAIERNEYYLYEINNKCQNNNSPLRIRQSEKISEFLYTQSGCLNLRKQLYIYRNCNCVSEILFLPEEIPETV-IP-CHQISVELISNSFKDNYTAWLVQQPSARSLQLNHQ--CHDKFLLSFNSDNEI---NNCPVPCDSVTFTYDVSLLNIKDIVPQFQPLIFEAASEVIAKFA---NSTVPTGQVENLYNIE-----FSMKLGFMSLLPKSFKITIMKETLVYQLGQFFSDVGGSMGLFVG 1596
            FC  T+AHGF K++E+ +  + R  W+ I+    +G  A +  L  R L R +N E  +    +F  PDVTIC    F     +   N  +P+          NIS ++        W   G   D N        +SI    + LN+ +   ++++  ++   + S   F   + P+ F C  F P +R++    E      +I+   +G+   + +  +S S  E  R+     IH P T PE   +   V RD    + +   E  + +  +   N  +   + +  +I+E+ YT   CL    Q Y+  NC+CVSE L LP  +   + +P CH IS E +  S  D   A   +    R+    H+  CHD  +   +        + CP+ C +V +    +         +    + EA    IA  A   +      +++   + E     F      +++   S   ++M+E+  Y      SD+GG +GL++G
Sbjct:   30 FCDSTSAHGFHKIVENGEGALHRAAWLFIILAAGAGFTAHLFALFSRYLERPVNTETSVYGT-KFVFPDVTICATSHFSRL--RYQQNPPVPSL---------NISTHELLHHIRTFWDP-GENADTNISINADVMHSIKSYLRELNITKQRQEMILHCDFAGDSCSYRNFSLYVDPNYFSCYTFAPTERHLIVGGERDGGLNVIM--YVGDVKNFITGEESLSYSEGFRA----VIHEPGTRPEL-LEGFYVQRDTSTYVQLGYTEEVVLKNCSLDANFQTVKFVDRYNRITEYRYTIRDCLVNTYQTYLRTNCSCVSEALPLPANLNSNLSVPFCHSISRESLMESI-DQQAATEAEAAIERNQAAEHRRACHDSVVSEIHKKTSGLAPDVCPLRCKNVRYEMRFTQNRWPSACNETSQALAEAVERTIALAAEQGDDLTTLVEIQRRMSDEHREPAFRESFAKLTIYTHSTMGSVMRESWAYPDRNLASDIGGILGLWLG 511          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. TrEMBL
Match: A0A1I8IAE1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.904e-13
Identity = 81/310 (26.13%), Postives = 131/310 (42.26%), Query Frame = 1
Query:  826 GSSIFIHPPMTLPEFETQELIVP--RDNLLQLAIERNEYYLYEINN---KCQNNNSPLRIRQSEKISEFLYTQSGCLNLRKQLYIYRNCNCVSEILFLPEEIPETVIPCHQISVELISNSFKDNYTAWLVQQPSARSLQLNHQCHDKFLLSFN---SDNEINNCPVPC-------------DSVTFTYDVSLLNIKD------------------IVPQFQPLIFEAASEVIAKFA--------NSTVPTGQVE----NLYNIEFSMKLGFMS--LLPKSFKITIMKETLVYQLGQFFSDVGGSMGLFVG 1596
            G S+++HPP T+P+  +Q++ V   R+ ++   IER++     IN+   KC  N SPL + Q +K+  F YT+  C +++ Q  I   C+C+SE   +P  +  T   CH+I   LI             Q P         Q  D+++ S N     N   N  +PC             DS+       +L  +                   ++ +F    F+A  + +AK +        N++V  G +E    NL+ +  S +L F    LL    +     E   Y   QF+SDVGG +GL+ G
Sbjct:  163 GYSMYVHPPNTVPD-HSQDVQVSETRNYVISAGIERSK----SINSPVKKCAENPSPLTLLQFDKLRSFAYTKDACESVKAQEIIVGRCSCLSEKYLVPSSLASTKPYCHEIDPSLI-------------QYPYTTVANKTVQYIDRYVASTNFTLCWNATVNLTLPCNYSYWSKWNTTYLDSMALAQATGILTRRQCHKDAEAFLAENPGYRTALISEFSDKNFQAKLDEVAKTSNLYKEWAINNSVYYGDLERVGKNLFKLGLSTRLLFTRVVLLANGNEGVSTVEKYSYPPEQFWSDVGGVLGLWAG 454          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Ensembl Nematostella
Match: EDO39413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA77])

HSP 1 Score: 48.521 bits (114), Expect = 6.285e-6
Identity = 46/196 (23.47%), Postives = 81/196 (41.33%), Query Frame = 1
Query: 1030 SGCLNLRKQL---YIYRNC--NCVSEILFLPEEIPETVIPCHQISVELISNSFKDNYTAWLVQQPSARSLQLNHQCHDKFLLSFNSDNEINNCPVPCDSVTFTYDVSLLNI--KDIVPQFQPLIFEAASEVIAKFANSTVPTGQVENLYNIEFSMKLGFMSLLPKSFKITIMKETLVYQLGQFFSDVGGSMGLFVG 1596
            SGC + + Q    Y Y+NC   C ++++            C  I + L  N      T   VQ    R        H++      S  +  +CPVPC+  TFT  +SL     + +   F P +  A    +   +   +   + E+     F+M    + +  ++ +  +  +   Y++   F+DVGG+MGLF+G
Sbjct:  316 SGCGSRKLQFSQEYSYKNCIRECHTQLMI-------GRCRCRAIGMTLQENDTTPYCTTREVQDCIMR-------VHER------SSRQRCDCPVPCEMTTFTSRISLAYFPSQHVWETFLPFLTTAYDLNLTGLSPDELDM-KAEHFVRKRFAM----VKIFYETLRTEMYHQRPAYEMSDLFADVGGNMGLFLG 486          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Planmine SMEST
Match: SMESG000013072.1 (SMESG000013072.1)

HSP 1 Score: 998.423 bits (2580), Expect = 0.000e+0
Identity = 552/556 (99.28%), Postives = 552/556 (99.28%), Query Frame = 1
Query:   37 MNLFNEKAENLSIQTDEMXXXXXXXXXXXXXXHQIWETFCLKTNAHGFFKVIEDTKIMRIIWICIMCVTVSGXXXXXXXXXXXXXXXXXXXXVEIKSKHEFSMPDVTICPKQRFFFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIWKILGFEVDANKLGRYSILQISQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCLIFRPNDRNIKTLNEIPDLFLIILIPMIGNDDIYESIFQSSSEVEQMRSGSSIFIHPPMTLPEFETQELIVPRDNLLQLAIERNEYYLYEINNKCQNNNSPLRIRQSEKISEFLYTQSGCLNLRKQLYIYRNCNCVSEILFLPEEIPETVIPCHQISVELISNSFKDNYTAWLVQQPSARSLQLNHQCHDKFLLSFNSDNEINNCPVPCDSVTFTYDVSLLNIKDIVPQFQPLIFEAASEVIAKFANSTVPTGQVENLYNIEFSMKLGFMSLLPKSFKITIMKETLVYQLGQFFSDVGGSMGLFVGXXXXXXXXXXXXXXXXXXXXXXXXRRKRHLNSTDVK 1704
            MNLFNEKAENLSIQTDEMRKKSSSKISKRIIIHQIWETFCLKTNAHGFFKVIEDTKIMRIIWICIMCVTVSGLLALIVVLLERLLA NLNAEVEIKSKHEFSMPDVTICPKQRFFFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIW ILGFE DANKLGRYSILQISQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCLIFRPNDRNIKTLNEIPDLFLIILIPMIGNDDIYESIFQSSSEVEQMRSGSSIFIHPPMTLPEFETQELIVPRDNLLQLAIERNEYYLYEINNKCQNNNSPLRIRQSEKISEFLYTQSGCLNLRKQLYIYRNCNCVSEILFLPEEIPETVIPCHQISVELISNSFKDNYTAWLVQQPSARSLQLNHQCHDKFLLSFNSDNEINNCPVPCDSVTFTYDVSLLNIKDIVPQFQPLIFEAASEVIAKFANSTVPTGQVENLYNIEFSMKLGFMSLLPKSFKITIMKETLVYQLGQFFSDVGGSMGLFVGFTIITLFDL ELLIFILEFLIFDFRRKRHLNSTDVK
Sbjct:    1 MNLFNEKAENLSIQTDEMRKKSSSKISKRIIIHQIWETFCLKTNAHGFFKVIEDTKIMRIIWICIMCVTVSGLLALIVVLLERLLASNLNAEVEIKSKHEFSMPDVTICPKQRFFFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIWNILGFEADANKLGRYSILQISQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCLIFRPNDRNIKTLNEIPDLFLIILIPMIGNDDIYESIFQSSSEVEQMRSGSSIFIHPPMTLPEFETQELIVPRDNLLQLAIERNEYYLYEINNKCQNNNSPLRIRQSEKISEFLYTQSGCLNLRKQLYIYRNCNCVSEILFLPEEIPETVIPCHQISVELISNSFKDNYTAWLVQQPSARSLQLNHQCHDKFLLSFNSDNEINNCPVPCDSVTFTYDVSLLNIKDIVPQFQPLIFEAASEVIAKFANSTVPTGQVENLYNIEFSMKLGFMSLLPKSFKITIMKETLVYQLGQFFSDVGGSMGLFVGFTIITLFDLMELLIFILEFLIFDFRRKRHLNSTDVK 556          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Planmine SMEST
Match: SMESG000019202.1 (SMESG000019202.1)

HSP 1 Score: 186.808 bits (473), Expect = 6.612e-52
Identity = 134/499 (26.85%), Postives = 252/499 (50.50%), Query Frame = 1
Query:  136 QIWETFCLKTNAHGFFKVIEDTKIMRIIWICIMCVTVSGXXXXXXXXXXXXXXXXXXXXVEIKSKHEFSMPDVTICPKQRFFFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIWKILGFEVDANKLGRYSILQISQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCLIFRPNDRNIKTLNEIPDLFLIILIPMIGNDDIYESIFQSSSEVEQMRSGSSIFIHPPMTLPEFETQELIVPRDNLLQLAIERNEYYLYEINNKCQNNNSPLRIRQS--EKISEFLYTQSGCLNLRKQLYIYRNCNCVSEILFLPEEIPETVIPCHQISVEL---ISNSF-----KDNYTAWLVQQPSARSLQLNHQCHDKFLLSFNSDNEINNCPVPCDSVTFTYDVSLLNIKDIVPQFQPLIFEAASEVIA--KFANSTVPTGQVENLYNIEFSMKLGFMSLLPKSFKITIMKETLVYQLGQFFSDVGGSMGLFVG 1596
            ++ ++FC  T+ HGF K++E T+++R+IWI IM +T  GL+   ++L+ R     +N+       ++  MPD+TICP QRF+F++   L N    + TP    +    +F + F +   IW  +   + +    RYSI++ + ++  LRG NDI++K N+    +S ++       D F C+ F+P  R + +L++     +I  +  +G  D +E+  +S +E+     GS++++H P T+P F++   +V R  + Q +  + +       + C +  + + I+     +++ + Y+QS C+  +K   IY+ CNC SE+L     IP++   CH+IS  L   ++NSF     KDN            +L+ N+ CH   +    ++     C   C   T+ Y+VS   ++  +  F+ +  E+ +E+I   +  N +V   +    Y +    K      +PK   + + +E+L Y +    SD+GG +GL++G
Sbjct:   37 RLIKSFCKHTSGHGFAKIVESTRLVRLIWILIMMLTFIGLVVHFILLILRYFDYGVNSSFYTTPDNQLVMPDITICPNQRFYFFESSPLFN---SSLTPDTTEIYKGTTFAELFSRYVDIWTPITGNISSITYARYSIMRQAYSIKRLRGKNDIIIKINFKKIQISVDKLFATPTFDSFVCVTFKPPSRVLNSLSDSDATVIITNMFYVGALDQFENQMKSPNEITD--PGSTLYMHSPNTMPNFKSDGHMVYRSLVKQFSFNQAKIIRENSGSVCFDKPNDIVIKGYGLNEMNTYTYSQSLCVETKKSEMIYKTCNCRSELLIASSVIPDSASFCHEISSLLSTKLNNSFIMLNPKDNTDV-------IANLKKNYLCHKTQISLLENEKFPETCLPACVESTYRYEVSSSKLERQLIGFKGVYNESINEIIPLLQQENKSVEVIKAAANYELLTDFKFTVSKFIPKQLTVEVTEESLSYPIENLLSDIGGILGLYLG 523          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Planmine SMEST
Match: SMESG000079503.1 (SMESG000079503.1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.307e-18
Identity = 121/510 (23.73%), Postives = 213/510 (41.76%), Query Frame = 1
Query:  151 FCLKTNAHGFFKVIEDTKIM-RIIWICIMCVTVSGXXXXXXXXXXXXXXXXXXXXVEIKSKHEFSMPDVTICPKQRFFFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIWKILGFEVDANKLGRYSILQISQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCLIFRPNDRNIKTLNEIPDLFLIILIPMIGNDDIYESIFQSSSEVEQMRSGSSIFIHPPMTL----------PEFETQELIVPRDNLLQLAIE---RNEYYLYEINNKCQNNNSPLRI-RQSEKISEFLYTQSGCLNLRKQLYIYRNCNCVSEILFLP---EEIPETVIP-CHQISVELISNSFKDNYTAWLVQQPSARSLQLNHQCHDKFLLSFNSDNEINNCPVPCDSVTFTY-DVSLLNIKDIVPQFQP---LIFEAASEVIAKFANSTVPT-----GQVENLYNIEFSMKLGFMSLLPKSFKITIMKETLVYQLGQFFSDVGGSMGLFVG 1596
            F   T AHGF +V     +  RI+WI IM +T  GL+   + +L   LA  +  E+ + +   F MP V ICP   +     KL            D  V+ N++    F   +  WK++    +  +  R+SI   +Q   L     D+ V   Y    V  N  +F++        I  P D    +L+++               +++ S F  +S +      +S +++   T           P F +  +   +  +  + +    +NE+    + N C +N  P++I      I +F YT+S CL ++KQ YI++NC C SE L +P   + I   ++P CH++S   I           ++       L  +  CHD FL S+  D     C  PC S ++++ +++ ++   +     P   LI +  S +  K A   V         ++   +I  + KLG   ++P++     + E+  Y L  F S +G  + L+VG
Sbjct:   41 FASTTKAHGFLQVATTEALSGRILWIIIMALTFGGLIFHFITMLMIFLAHEVQTEM-VNNAVPFEMPTVIICPDAPY----AKLF---------KVDRPVIFNMTLSGAFDTFNAFWKLVNKTTNIQEKSRFSIAPYAQEYQLFTLSEDLTVFCKY-NNAVKCNVSNFMIEDLSVCAKIDIPLDTTKTSLSQL---------------NVWYSFFTDASYLPNTTFYNSKYMYILRTAYLTYQAKEEYPNFHSTRISGFKQFMTTINLNIRIQNEFL---VKNSCLSNPEPMKILSYGNAILQFSYTKSLCLMVKKQNYIFQNCKCFSEALPIPNYSDNITIDIVPFCHKLSKGFIEYLKTIPNPINILNNKETAQLTSSSVCHDHFLNSWIDDGS---CISPCTSKSYSWSNINAVSWPTVTFTNTPNKILISDIQSNINQKMAKYNVTENDLVYSTIKTTSDIISNRKLGSFKIVPQTPSGLKITESENYPLTNFLSTIGSILVLWVG 514          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Planmine SMEST
Match: SMESG000079502.1 (SMESG000079502.1)

HSP 1 Score: 69.707 bits (169), Expect = 2.958e-12
Identity = 121/519 (23.31%), Postives = 200/519 (38.54%), Query Frame = 1
Query:  163 TNAHGFFKVIEDTKIM-RIIWICIMCVTVSGXXXXXXXXXXXXXXXXXXXXVEIKSKHEFSMPDVTICPKQRF--FFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIWKILGFEVDANKLGRYSILQISQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCL-IFRPNDRNIKTLNEIPDLFLIIL-------IPMIGNDDIYES-----IFQSSSEVEQMRSGSSIFIHPPMTLPEFETQELIVPRDNLLQLAIERNEYYLYEINNKCQNNNSPLRIRQ-SEKISEFLYTQSGCLNLRKQLYIYRNCNCVSEILFLPEEIPETVIP----CHQISVE----LISNSFKDNYTAWLVQQPSARSLQLNHQCHDKFLLSFNSDNEINNCPVPCDSVTFTYDVSLLNIKDIVPQFQPLIF---EAASEVIAKFANSTVPTGQVENLYNIEFSM------------KLGFMSLLP-KSFKITIMKETLVYQLGQFFSDVGGSMGLFVG 1596
            T  HGF +++    I  +IIW+  M V +SGL    V LL   L   +  E+  K    +  P + ICP+  +   F  EK               A+++N++F   F   +  W  +    +     R S    +  L  L    D  +   Y       N F F+++ D   C+ I  P     +  N +   F           +  + N DI         FQS  E                  P+F T  +   R  +  + ++     L+++ + C  N S   I     K ++F YTQS C+ L+KQ  +  NC C SE L +      + I     CH++S      LI N+    Y+  L ++ S + +Q N +CHD +L  +  D     C   C + +++    L N      Q+ PL F   +  S++      + +      NL   EF +            K+G   ++P + + + I+ E   Y L  F S  G  +GL++G
Sbjct:   43 TTTHGFLQIVTTKTITGKIIWLTFMIVAISGLSYHFVTLLIGHLNHEVQTEMS-KDVTPYETPSLVICPEIPYVNLFNTEK---------------AIISNLTFLDIFQLFNNFWSTVNQTTEIKTKSRLSFAPYAYELQQLVLAEDFQLICKYNAEQ-KCNSFTFMVQ-DLSNCIKIDIPTSTVTQPFNSLNIFFAYNFDSSRDSSVAFLDNKDIIAERKSFITFQSKDE-----------------YPDFNTNRIFGIRQQMAAIYLDIRVQQLFQVGDSCFVNPSNYEILSFDSKKTQFAYTQSLCMMLKKQASVKDNCGCYSETLPIESTTQYSKIEQIPFCHKMSRGFINFLIGNANLTLYSLTL-EKESIKLIQ-NSKCHDNYLSIWQDD---GTCKPKCTTKSYSTGYVLYN------QW-PLSFLTSQEYSDIQGAINMTLMKKAAKYNLSLSEFRLSALQQLEELVIYKMGAFKVMPSRQYGLQII-EKESYPLANFLSSFGAILGLWIG 513          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Planmine SMEST
Match: SMESG000068441.1 (SMESG000068441.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.178e-9
Identity = 113/480 (23.54%), Postives = 184/480 (38.33%), Query Frame = 1
Query:  325 SKHEFSMPDVTICPKQRF-------FFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIWKILGFEVDANKLGRYSILQISQNLNLLRGPNDILVKTNYLTRNVSSNEFHFLMRPDGFRCLIFRPNDRNIKT---------LNEIPDLFLIILIPMIGNDDIYESIFQSSSEVEQMRSGSSIFIHPPMTLPEFETQEL-IVPRDNLLQLAIERNEYYLYEINNKCQNNNSPL----------RIRQSEKISEFLYTQSGCLNLRKQLYIYRNCNCVSEILFLP--EEIPETVIPCHQISVELISNSFKDNYTAWLVQQPSARSLQLNHQCHDKFLLSFNSDNEINNCPV-PCDSVTFTYDVSLLNI-----------KDIVPQFQPLIFEAAS----EVIAK---FANSTVPTGQ-----VENLYNIEFSMKLGFM-SLLPKSFK--ITIMKETLVYQLGQFFSDVGGSMGLFVG 1596
            S ++F  PDVTICPK  F       F  + + L+N        + + +          +QS ++ ++L    + N       L I              +   Y     S   F  ++ P   +C  FRP  RNI+T          NEI D F+I+       +D+ +  F S+ E      G ++ IH P+T P   +QE+   P    L+     +        N   N   P             R   K  E+ YT   C+  +KQL+I + C C S+ +F+P  E   +T+                DN+  ++V + S + ++ N  CH+  + S  S  EI +  V P D V +  D S + +           KDI   ++  +++ +S     + A+   + N  +  GQ      E L+     +K   M  L+ KS    I I +E     +    S  GG +GL  G
Sbjct:   31 SSYQFQFPDVTICPKSPFSDNSDPNFRVNLERLSNQTKETLRKASVKITEEA------VQSGILLQML---TNKNAYAVKLYLHI--------------IYCEYNGEECSFFNFTEIVHPRYIKCFEFRPQKRNIRTGMGLNIIYYTNEIRDSFMIL-------NDLEDINFFSNKE----NDGINVIIHKPLTFP---SQEISYTPTSFSLRYGTHTSLAVTSLKYNSNSNRRKPCFEDPPAFKYKNFRGDFKFFEYNYTYEDCIANKKQLFINKTCGCYSDKMFVPYYENSSQTL----------------DNFCRYIVHKTSEK-IRRNFFCHE--IQSALSSTEILDKYVSPKDLVDYKDDPSTMKLLRLNVCSMVCFKDI---YETKLYQVSSIGDLTISARYFEYYNQKLKQGQFVNPDFEKLFQTNSELKGANMIRLVVKSEAELIDIWQEERATDIISLISGFGGVIGLCCG 451          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Asic55.896e-822.53acid-sensing (proton-gated) ion channel family mem... [more]
Asic52.313e-722.51acid-sensing (proton-gated) ion channel family mem... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9R0Y1|ASIC5_MOUSE4.124e-722.53Acid-sensing ion channel 5 OS=Mus musculus OX=1009... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J7S33.851e-2725.14Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I9S93.303e-1722.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J7I02.514e-1623.24Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IIE83.979e-1623.86RRM domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8IAE12.904e-1326.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO394136.285e-623.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013072.10.000e+099.28SMESG000013072.1[more]
SMESG000019202.16.612e-5226.85SMESG000019202.1[more]
SMESG000079503.11.307e-1823.73SMESG000079503.1[more]
SMESG000079502.12.958e-1223.31SMESG000079502.1[more]
SMESG000068441.11.178e-923.54SMESG000068441.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030944 ID=SMED30030944|Name=FMRFamide-activated amiloride-sensitive sodium channel-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1727bp
TTTTGAAATTTTTTAATAAAATAAAATAATTTTTCAATGAATCTCTTCAA
TGAAAAAGCCGAAAATCTCTCAATTCAAACCGATGAGATGAGAAAAAAGT
CATCATCAAAAATCAGCAAAAGAATTATTATTCATCAAATTTGGGAAACA
TTTTGCCTGAAAACCAATGCTCACGGGTTTTTCAAAGTGATCGAAGACAC
AAAAATAATGAGAATAATTTGGATCTGTATAATGTGCGTTACGGTTTCTG
GATTGTTGGCATTAATTGTTGTACTTTTGGAGCGTTTATTGGCGAGAAAT
CTTAATGCTGAAGTCGAAATAAAGTCAAAACACGAATTCTCAATGCCTGA
TGTAACAATCTGTCCAAAACAAAGATTTTTCTTTTACGATGAAAAACTCT
TAACAAATTACATCATTCCAGCATTTACGCCTAGTGATATTGCTGTGCTG
AATAACATTTCGTTTTATCAATATTTTATTCAGTCTTCTCTAATTTGGAA
AATTCTAGGATTTGAGGTGGACGCGAATAAGTTGGGGCGATATTCCATTC
TTCAGATTTCACAGAACTTAAATCTTTTAAGAGGACCGAATGACATCTTA
GTTAAAACAAATTATTTAACTCGAAATGTTTCATCCAATGAATTTCATTT
CCTCATGCGGCCCGATGGATTTCGATGTTTAATATTCCGACCAAATGATA
GAAATATTAAAACTTTAAATGAAATCCCGGATTTATTTTTAATTATTTTG
ATTCCAATGATCGGAAACGATGACATCTATGAAAGCATATTTCAATCAAG
CTCAGAAGTGGAACAAATGCGATCGGGTAGCTCGATTTTTATTCATCCTC
CAATGACCCTACCGGAGTTCGAAACTCAAGAGTTAATAGTGCCCAGGGAT
AATCTTTTGCAACTCGCCATCGAAAGAAATGAATATTATCTTTATGAAAT
TAATAATAAATGTCAAAATAATAATAGCCCTCTTCGAATTCGTCAAAGTG
AAAAAATTTCAGAATTTCTTTATACACAAAGTGGATGTCTAAATTTAAGA
AAACAGTTATATATTTACAGGAATTGCAATTGTGTCAGTGAGATATTGTT
CTTGCCGGAAGAAATTCCGGAAACAGTAATTCCATGCCATCAAATATCCG
TAGAATTAATAAGTAATTCATTCAAAGACAATTACACAGCATGGCTAGTG
CAGCAACCTTCTGCCAGATCATTGCAACTGAACCATCAATGCCATGATAA
ATTTTTGTTGAGTTTTAATTCAGATAATGAAATTAACAATTGCCCGGTTC
CGTGTGACTCTGTCACTTTTACGTATGATGTCTCCTTGTTAAACATAAAA
GATATCGTTCCACAATTTCAACCGTTGATTTTTGAGGCGGCGTCGGAAGT
AATTGCGAAATTTGCAAATTCAACTGTACCAACTGGACAAGTGGAAAATC
TCTATAACATTGAATTTTCCATGAAATTAGGATTCATGTCTTTACTTCCG
AAATCATTTAAGATTACAATAATGAAAGAAACCCTTGTGTATCAACTTGG
ACAATTTTTCTCTGATGTAGGAGGTTCAATGGGGTTATTTGTTGGATTCA
CCATCATTACTTTATTTGATTTAACGGAATTGTTGATTTTCATACTAGAA
TTTTTAATTTTCGATTTTCGAAGAAAAAGACATCTAAATTCTACAGATGT
AAAATAAATTTTATTCAGAGAATCGAA
back to top

protein sequence of SMED30030944-orf-1

>SMED30030944-orf-1 ID=SMED30030944-orf-1|Name=SMED30030944-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=557bp
MNLFNEKAENLSIQTDEMRKKSSSKISKRIIIHQIWETFCLKTNAHGFFK
VIEDTKIMRIIWICIMCVTVSGLLALIVVLLERLLARNLNAEVEIKSKHE
FSMPDVTICPKQRFFFYDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQS
SLIWKILGFEVDANKLGRYSILQISQNLNLLRGPNDILVKTNYLTRNVSS
NEFHFLMRPDGFRCLIFRPNDRNIKTLNEIPDLFLIILIPMIGNDDIYES
IFQSSSEVEQMRSGSSIFIHPPMTLPEFETQELIVPRDNLLQLAIERNEY
YLYEINNKCQNNNSPLRIRQSEKISEFLYTQSGCLNLRKQLYIYRNCNCV
SEILFLPEEIPETVIPCHQISVELISNSFKDNYTAWLVQQPSARSLQLNH
QCHDKFLLSFNSDNEINNCPVPCDSVTFTYDVSLLNIKDIVPQFQPLIFE
AASEVIAKFANSTVPTGQVENLYNIEFSMKLGFMSLLPKSFKITIMKETL
VYQLGQFFSDVGGSMGLFVGFTIITLFDLTELLIFILEFLIFDFRRKRHL
NSTDVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
GO:0006814sodium ion transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 39..532
e-value: 4.4E-45
score: 154.5
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 39..542
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 302..423
e-value: 7.7E-35
score: 122.6
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 112..264
e-value: 7.7E-35
score: 122.6
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 89..500
e-value: 7.7E-35
score: 122.6
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 59..530
e-value: 7.7E-35
score: 122.6
NoneNo IPR availableTMHMMTMhelixcoord: 59..81
NoneNo IPR availableTMHMMTMhelixcoord: 515..537