MULE domain-containing protein
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30030935 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 2
Homology
BLAST of MULE domain-containing protein vs. TrEMBL
Match: A0A1D2M6Z4 (Uncharacterized protein OS=Orchesella cincta OX=48709 GN=Ocin01_17935 PE=4 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 5.619e-13 Identity = 40/86 (46.51%), Postives = 47/86 (54.65%), Query Frame = 3 Query: 132 ITIMVDLELAKIRAL----PTATTTGCMFHFGQCVWWKFQA-KGFSEHYINEPDFAFFVKRLLTLAFVPPQYVTDLFEHCTKAPFY 374 +++ D E A A P AT +GC+FHFGQC W K Q K S Y+ +PDFA VK L LAFVPP V D FE FY Sbjct: 444 VSVTTDYEKAAKNAFKSVFPNATQSGCLFHFGQCFWRKIQQLKDVSSKYVTDPDFALQVKCLTALAFVPPPSVKDAFEILIADEFY 529
BLAST of MULE domain-containing protein vs. TrEMBL
Match: J9KNP2 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2) HSP 1 Score: 69.707 bits (169), Expect = 8.511e-12 Identity = 30/88 (34.09%), Postives = 47/88 (53.41%), Query Frame = 3 Query: 126 NQITIMVDLELAKIRA----LPTATTTGCMFHFGQCVWWKFQAKGFSEHYINEPDFAFFVKRLLTLAFVPPQYVTDLFEHCTKAPFYR 377 N + IM D E A + A P GC FH GQ +W + Q G S Y +P+F+ ++++L LA++P V D FE+ + F++ Sbjct: 13 NPLMIMADFEKAAMNAALFVYPNTKIQGCFFHLGQSIWRQIQNIGLSNKYSTDPEFSLNIRKILALAYLPENLVEDSFENILQTEFFK 100
BLAST of MULE domain-containing protein vs. TrEMBL
Match: A0A0C2N2Y4 (MULE domain-containing protein OS=Thelohanellus kitauei OX=669202 GN=RF11_09034 PE=4 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 2.141e-11 Identity = 33/89 (37.08%), Postives = 49/89 (55.06%), Query Frame = 3 Query: 135 TIMVDLELAKIRA----LPTATTTGCMFHFGQCVWWKFQAKGFS-EHYINEPDFAFFVKRLLTLAFVPPQYVTDLFEHCTKAPFYRDKV 386 +I++D E++ + A P ++ GC FH GQC+W K Q Y +EPDF +K L+ LAF+PP V FE +PF+ D + Sbjct: 173 SILIDFEMSMMNAARNIFPDSSIKGCFFHLGQCIWRKIQESALVLRRYKDEPDFCLNIKTLMALAFLPPSDVIVGFETLVTSPFFADNI 261
BLAST of MULE domain-containing protein vs. TrEMBL
Match: X1XNU4 (MULE domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 2.188e-11 Identity = 34/87 (39.08%), Postives = 49/87 (56.32%), Query Frame = 3 Query: 135 TIMVDLELAKIRAL----PTATTTGCMFHFGQCVWWKFQAKGF-SEHYINEPDFAFFVKRLLTLAFVPPQYVTDLFEHCTKAPFYRD 380 +IM D E+A I A P GC FHF QC+W K Q + ++ YI++ F+ ++ LL LA+VP +V D FE +P+Y D Sbjct: 301 SIMSDFEMASINAFKEVFPNVKQKGCHFHFSQCIWRKIQQIQYMAQKYISDSTFSIQIRLLLALAYVPENHVIDAFEELIDSPYYTD 387
BLAST of MULE domain-containing protein vs. TrEMBL
Match: J9LH89 (MULE domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2) HSP 1 Score: 71.2478 bits (173), Expect = 4.471e-11 Identity = 35/86 (40.70%), Postives = 46/86 (53.49%), Query Frame = 3 Query: 135 TIMVDLELAKIRALPTA----TTTGCMFHFGQCVWWKFQAKGFSEHYINEPDFAFFVKRLLTLAFVPPQYVTDLFEHCTKAPFYRD 380 T+M+D E+ + AL GC FHF Q VW Q G S+ Y + FAF +K+L LA+VP YV FE+ PFYR+ Sbjct: 267 TVMLDFEIGAMTALKKEFSDIKIRGCHFHFAQSVWRHIQECGLSKQYKEDSTFAFEIKKLNALAYVPVDYVVRYFEYLVDTPFYRE 352 HSP 2 Score: 24.6386 bits (52), Expect = 4.471e-11 Identity = 12/35 (34.29%), Postives = 20/35 (57.14%), Query Frame = 2 Query: 20 LHGFINGEISPVV*AVISSKTEKAYQNLLQKILML 124 +HG + + P V A++ +K +K Y LLQ + L Sbjct: 225 IHGIQSSNVLPSVYALLPNKKKKTYIRLLQSLKTL 259
BLAST of MULE domain-containing protein vs. Planmine SMEST
Match: SMESG000070712.1 (SMESG000070712.1) HSP 1 Score: 50.447 bits (119), Expect = 2.465e-7 Identity = 28/81 (34.57%), Postives = 39/81 (48.15%), Query Frame = 3 Query: 135 TIMVDLELAKIRA----LPTATTTGCMFHFGQCVWWKFQAKGFSEHYINEPDFAFFVKRLLTLAFVPPQYVTDLFEHCTKA 365 TI D E A I A GC FH Q ++ KFQ+ G + Y N+ DFA ++ + AF P + V + FE K+ Sbjct: 137 TITTDFERAAINAATECFANIKIHGCFFHNAQKIFKKFQSVGLQDRYQNDEDFALSIRMIAASAFFPIEKVIESFETLQKS 217
BLAST of MULE domain-containing protein vs. Planmine SMEST
Match: SMESG000014782.1 (SMESG000014782.1) HSP 1 Score: 50.447 bits (119), Expect = 2.601e-7 Identity = 26/76 (34.21%), Postives = 37/76 (48.68%), Query Frame = 3 Query: 135 TIMVDLELAKIRA----LPTATTTGCMFHFGQCVWWKFQAKGFSEHYINEPDFAFFVKRLLTLAFVPPQYVTDLFE 350 TI D E A I + GC FH Q ++ K Q+ G Y N+ DFA ++++ LAFV + V + FE Sbjct: 258 TITTDFERAAINSATECFANVEIHGCFFHLAQNIFRKVQSVGLQGRYQNDEDFALSIQKIAVLAFVLSENVIESFE 333
BLAST of MULE domain-containing protein vs. Planmine SMEST
Match: SMESG000014782.1 (SMESG000014782.1) HSP 1 Score: 50.447 bits (119), Expect = 2.692e-7 Identity = 26/76 (34.21%), Postives = 37/76 (48.68%), Query Frame = 3 Query: 135 TIMVDLELAKIRA----LPTATTTGCMFHFGQCVWWKFQAKGFSEHYINEPDFAFFVKRLLTLAFVPPQYVTDLFE 350 TI D E A I + GC FH Q ++ K Q+ G Y N+ DFA ++++ LAFV + V + FE Sbjct: 256 TITTDFERAAINSATECFANVEIHGCFFHLAQNIFRKVQSVGLQGRYQNDEDFALSIQKIAVLAFVLSENVIESFE 331 The following BLAST results are available for this feature:
BLAST of MULE domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of MULE domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of MULE domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 3
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30030935 ID=SMED30030935|Name=MULE domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=632bpback to top Annotated Terms
The following terms have been associated with this transcript:
|