inositol phosphoceramide mannosyltransferase 2-like

Overview
Nameinositol phosphoceramide mannosyltransferase 2-like
Smed IDSMED30030926
Length (bp)1175
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of inositol phosphoceramide mannosyltransferase 2-like (SMED30030926) t-SNE clustered cells

Violin plots show distribution of expression levels for inositol phosphoceramide mannosyltransferase 2-like (SMED30030926) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of inositol phosphoceramide mannosyltransferase 2-like (SMED30030926) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for inositol phosphoceramide mannosyltransferase 2-like (SMED30030926) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030926

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030926SMESG000041207.1 SmedASXL_007359SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30030926SMESG000041207.1 dd_Smed_v6_33525_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30030926SMESG000041207.1 OX_Smed_1.0.02580ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|O14084|IMT1_SCHPO (Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 3.305e-23
Identity = 59/188 (31.38%), Postives = 96/188 (51.06%), Query Frame = 3
Query:  270 CPSDKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFR------SWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPE--LLTGPIILSNTLKKYVV 809
             P + + I ++IHQ WK++NIP+ + N   S    C R       W ++ WTDE  +  + + Y WF+ V++S P  I + D +RYF ++HYGG+Y DLD  C KP + LL   + +  +   + +G S       N +  +TP+H F  + I+ +     +     P   L  GP+ LS    KY++
Sbjct:   57 APGEMEKIPRVIHQLWKDENIPERWSNTVNS----CRRQHPDENGWQFILWTDEKIMSFMNENYSWFMPVFHSYPYNIQKFDAARYFILYHYGGVYMDLDIGCKKPMDPLLSKATFILPST--EPIGYS-------NDWFAATPKHPFLYQAIHNLSKFNHRYFTKYPTVFLSAGPLFLSYQFCKYLL 231          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|P38287|CSH1_YEAST (Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.260e-21
Identity = 67/200 (33.50%), Postives = 101/200 (50.50%), Query Frame = 3
Query:  276 SDKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFR---SWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELL----TGPIILSNTLKKYVVRNQSLNDQLIKIYEP 854
            S  + I KIIHQ++K  +IP+     +    Q C      +TY+ WTDE +   I+  YPWFL+ + S    I R D  RYF + HYGGIY DLD+ C +  + LL+  + +    K    G       V N  M S PRH F+L++I  + +   KKN   P +     TGP+ +S   K+Y   + +  +  ++I +P
Sbjct:   57 SPPQLIPKIIHQTYKTNDIPEQ----WVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFL---RKTSPTG-------VSNDVMGSVPRHPFFLKVIKSLKHY--KKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAVRILQP 240          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|P33300|SUR1_YEAST (Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 7.809e-20
Identity = 71/242 (29.34%), Postives = 117/242 (48.35%), Query Frame = 3
Query:  159 MLIKPFYLIFILLISFCVFLTIFLNQFLLAHNEYQKICPSDKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFR---SWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELL----TGPIILSNTLKKYVVRNQSLNDQLIKIYEPKFF 863
            +L+   Y  F LL + C+  T+   +  +   +     P   + I KIIHQ++K ++IP+     +K   Q C      + Y+ WTDE   + I++ YPWFL+ + +    I R D  RYF + HYGG+Y DLD+ C +  + LL   + +    K   +G       V N  M S PRH F+L+ +  + +    K    P +     TGP+ LS   K+Y  R +   +  ++I +P ++
Sbjct:   15 LLLSIIYYTFDLL-TLCIDDTV---KDAILEEDLNPDAPPKPQLIPKIIHQTYKTEDIPE----HWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFL---RKTSPLG-------VSNDVMGSVPRHPFFLKALKSLKHY--DKYWFIPYMTIMGSTGPLFLSVIWKQY-KRWRIPKNGTVRILQPAYY 235          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|Q9UT67|IMT2_SCHPO (Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 8.299e-19
Identity = 65/184 (35.33%), Postives = 92/184 (50.00%), Query Frame = 3
Query:  276 SDKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFR---SWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNK-----ISPELLTGPIILSNTLKKY 803
            S +  I KIIHQ+WK   +P+     +K   Q C      + Y+ WTDE +   I D YPWFL  +++ P  + R DV RYF ++HYGG Y DLD+ C +  + LL  Y  V+   +   +G S       N  M S P H ++ ELI  I NL           ++  L TGP+ +S   +KY
Sbjct:   77 SGEPVIPKIIHQTWKTTEVPE----GWKGAQQSCIDLHPDYEYILWTDEMSRNFIADNYPWFLPYFDAYPFNVQRADVIRYFVLYHYGGNYIDLDDGCRQRLDSLL--YYPVW-VRRTDPVGVS-------NDVMGSVPHHPYF-ELI--IQNLEKNAKSYWLPYLTIMLSTGPLSISFLWEKY 243          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Match: sp|Q10323|IMT3_SCHPO (Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.080e-16
Identity = 59/177 (33.33%), Postives = 84/177 (47.46%), Query Frame = 3
Query:  261 QKICPSDKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKN--KISPELLTGPIILS 785
             +I  +   +I KIIHQ+WK   IP+ +    KS        + Y+ WTDE   + I   YPWFL  Y+S P  I R DV RYF ++ YGGIY DLD  C +  + LL   + V    +    G S       N+ M     H F L+++  +   A   +   ++    TGP+ LS
Sbjct:   47 HEIYSNQSAAIPKIIHQTWKTNEIPEKWVGAQKSCID-LHPDYEYVLWTDESMREFIATDYPWFLTQYDSYPYNIERADVVRYFILYKYGGIYLDLDVGCNRTLDPLLHYPAWV---RRTSPSGIS-------NNVMGFAKGHPFLLQVVRNLPRFAFNYHFPYLTVMYSTGPLFLS 212          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A267DTA4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010228g2 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 3.679e-54
Identity = 104/242 (42.98%), Postives = 139/242 (57.44%), Query Frame = 3
Query:  288 SITKIIHQSWKNKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYS-TPRHEFWLELIYEIGNLASKKNKISPELLTGPIILSNTLKKYVVRNQSLNDQLIKIYEPKFFNPISWIDRSDSQEFCKEYWKMNSHDFKRCKNFMVERGSFVVQYHAHSWS 1010
            +I KI+HQSWK + +P     +  SW + CF  W +  WTD+DNL L+RD Y WFL VYN     I R D++RYFY++H+GGIYTDLD  C+K FE LL   +LVFGAM      + +    VQNSFM S  P H FW+ L+  I    +   +  PE  TGP +L   L+ YV  N S     +K+Y  K+FNP SW  R+   + CK++ +M+    K C N   +  +FVVQ H  SW 
Sbjct:   69 NIIKILHQSWKTRQLPARAVRWSASW-KSCFPDWEWRLWTDQDNLALVRDHYAWFLPVYNGQRYNIERADLARYFYLYHFGGIYTDLDTVCMKNFEHLLHLETLVFGAMDTHPGDSVLPGQLVQNSFMASLRPGHPFWMRLLRRIERNFNAGKRGRPEDNTGPTVLMEELRLYVRSNAS----DVKVYPGKYFNPFSWTLRNS--KICKDFGQMSDSVEKICINSFPK--AFVVQLHTQSWG 301          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A267DNA2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018427g2 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 9.810e-54
Identity = 103/293 (35.15%), Postives = 152/293 (51.88%), Query Frame = 3
Query:  147 RNDKMLIKPFYLIFILLISFCVFL---TIFLNQFLLAHNEYQKICPSDKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELLTGPIILSNTLKKYVVRNQSLNDQLIKIYEPKFFNPISWIDRSDSQEFCKEYWKMNSHDFKRC-KNFMVERGSFVVQYHAHSWSA 1013
            R  ++L     L  I L++  +      +F    L    E     PS +  I  IIHQSWK + +P      ++S    C  +  +  WTD DN  L++  Y W LN Y+ L S + R D+ RY Y+ H+GGIY DLD  CLK F  LL    L FG M GQ + +S+   YVQNSFM S P+H FW+ L++ I      + +   E  TGP+I+   LK+Y+    +     ++I+ P +FNP SWI  ++ +  CK +  M+  +   C K+F    G++VVQ H+ SW+ 
Sbjct:    4 RRSQLLKMVLALAAICLVAIAMARYRNLLFSCSTLSTAEESDAESPSGEAGIPCIIHQSWKTRTLPSPRATRWRSTWLKCLPNCRHYLWTDADNRDLVKRHYSWLLNFYDKLKSGVQRADLVRYLYLLHFGGIYADLDTVCLKDFRPLLNGLGLAFGGMDGQWI-SSVNGSYVQNSFMASRPKHPFWIGLLHRIVRRLDSRKQGGAEESTGPLIMMAELKQYLADGHT----DVRIFPPIYFNPFSWI--TNRRPDCKTHGAMSDSEEATCIKSFA---GAYVVQMHSKSWAG 286          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A267H9I3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018427g1 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.151e-53
Identity = 103/293 (35.15%), Postives = 152/293 (51.88%), Query Frame = 3
Query:  147 RNDKMLIKPFYLIFILLISFCVFL---TIFLNQFLLAHNEYQKICPSDKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELLTGPIILSNTLKKYVVRNQSLNDQLIKIYEPKFFNPISWIDRSDSQEFCKEYWKMNSHDFKRC-KNFMVERGSFVVQYHAHSWSA 1013
            R  ++L     L  I L++  +      +F    L    E     PS +  I  IIHQSWK + +P      ++S    C  +  +  WTD DN  L++  Y W LN Y+ L S + R D+ RY Y+ H+GGIY DLD  CLK F  LL    L FG M GQ + +S+   YVQNSFM S P+H FW+ L++ I      + +   E  TGP+I+   LK+Y+    +     ++I+ P +FNP SWI  ++ +  CK +  M+  +   C K+F    G++VVQ H+ SW+ 
Sbjct:    4 RRSQLLKMVLALAAICLVAIAMARYRNLLFSCSTLSTAEESGAESPSGEAGIPCIIHQSWKTRTLPSPRATRWRSTWLKCLPNCRHYLWTDADNRDLVKRHYSWLLNFYDKLKSGVQRADLVRYLYLLHFGGIYADLDTVCLKDFRPLLNGLGLAFGGMDGQWI-SSVNGSYVQNSFMASRPKHPFWIGLLHRIVRRLDSRKQGGAEESTGPLIMMAELKQYLADGHT----DVRIFPPIYFNPFSWI--TNRRPDCKTHGAMSDSEEATCVKSFA---GAYVVQMHSKSWAG 286          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A1I8FXP5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 3.729e-48
Identity = 96/255 (37.65%), Postives = 144/255 (56.47%), Query Frame = 3
Query:  276 SDKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSM-----GTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELLTGPIILSNTLKKYVVRNQSLN----DQL--IKIYEPKFFNPISWIDRSDSQEFCKEYWKMNSHDFKRCKNFMVERGSFVVQYHAHSW 1007
            S  + + +++HQSW N  +P LF  +  S+ + CF ++ Y  WTDEDN +LI + YPWFL  ++S    + + DVSR FYM+HYGG+Y DLD ECL  FE +L N SL FGAM G+ +      + + EG ++NSFMYS P+H F+ ELI     + +   +  P + +GP ++   +  +  R + L+    D L  + IY P  FNP SWI  +     C+ +   +     RC+N    + S+V+QYH   W
Sbjct:   83 SRDQPVIRLVHQSWVNATLPPLFARWAGSFGR-CFPTYRYALWTDEDNRRLIAEHYPWFLARFDSYGVGVQKADVSRLFYMYHYGGLYCDLDCECLANFEHMLANTSLAFGAMDGKMIYSSSDSSYVDEGQIENSFMYSRPKHPFFWELI----RVLNTTTEGLPIMTSGPYLIMRGI--HSARKRGLDKTKFDGLPYLTIYPPHLFNPYSWIRHNAPS--CRLFGDFSEESLARCRNSF--KTSYVIQYHTQVW 326          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Match: A0A1I8GI25 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008668g1 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 4.145e-48
Identity = 96/255 (37.65%), Postives = 144/255 (56.47%), Query Frame = 3
Query:  276 SDKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSM-----GTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELLTGPIILSNTLKKYVVRNQSLN----DQL--IKIYEPKFFNPISWIDRSDSQEFCKEYWKMNSHDFKRCKNFMVERGSFVVQYHAHSW 1007
            S  + + +++HQSW N  +P LF  +  S+ + CF ++ Y  WTDEDN +LI + YPWFL  ++S    + + DVSR FYM+HYGG+Y DLD ECL  FE +L N SL FGAM G+ +      + + EG ++NSFMYS P+H F+ ELI     + +   +  P + +GP ++   +  +  R + L+    D L  + IY P  FNP SWI  +     C+ +   +     RC+N    + S+V+QYH   W
Sbjct:   83 SRDQPVIRLVHQSWVNATLPPLFARWAGSFGR-CFPTYRYALWTDEDNRRLIAEHYPWFLARFDSYGVGVQKADVSRLFYMYHYGGLYCDLDCECLANFEHMLANTSLAFGAMDGKMIYSSSDSSYVDEGQIENSFMYSRPKHPFFWELI----RVLNTTTEGLPIMTSGPYLIMRGI--HSARKRGLDKTKFDGLPYLTIYPPHLFNPYSWIRHNAPS--CRLFGDFSEESLARCRNSF--KTSYVIQYHTQVW 326          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Match: CSH1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Sur1p; CSH1 has a paralog, SUR1, that arose from the whole genome duplication [Source:SGD;Acc:S000000365])

HSP 1 Score: 98.2117 bits (243), Expect = 3.255e-23
Identity = 67/200 (33.50%), Postives = 101/200 (50.50%), Query Frame = 3
Query:  276 SDKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFR---SWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELL----TGPIILSNTLKKYVVRNQSLNDQLIKIYEP 854
            S  + I KIIHQ++K  +IP+     +    Q C      +TY+ WTDE +   I+  YPWFL+ + S    I R D  RYF + HYGGIY DLD+ C +  + LL+  + +    K    G       V N  M S PRH F+L++I  + +   KKN   P +     TGP+ +S   K+Y   + +  +  ++I +P
Sbjct:   57 SPPQLIPKIIHQTYKTNDIPEQ----WVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFL---RKTSPTG-------VSNDVMGSVPRHPFFLKVIKSLKHY--KKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAVRILQP 240          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Match: SUR1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Csh1p; SUR1 has a paralog, CSH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005978])

HSP 1 Score: 93.5893 bits (231), Expect = 1.125e-21
Identity = 71/242 (29.34%), Postives = 117/242 (48.35%), Query Frame = 3
Query:  159 MLIKPFYLIFILLISFCVFLTIFLNQFLLAHNEYQKICPSDKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFR---SWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELL----TGPIILSNTLKKYVVRNQSLNDQLIKIYEPKFF 863
            +L+   Y  F LL + C+  T+   +  +   +     P   + I KIIHQ++K ++IP+     +K   Q C      + Y+ WTDE   + I++ YPWFL+ + +    I R D  RYF + HYGG+Y DLD+ C +  + LL   + +    K   +G       V N  M S PRH F+L+ +  + +    K    P +     TGP+ LS   K+Y  R +   +  ++I +P ++
Sbjct:   15 LLLSIIYYTFDLL-TLCIDDTV---KDAILEEDLNPDAPPKPQLIPKIIHQTYKTEDIPE----HWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFL---RKTSPLG-------VSNDVMGSVPRHPFFLKALKSLKHY--DKYWFIPYMTIMGSTGPLFLSVIWKQY-KRWRIPKNGTVRILQPAYY 235          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Match: OCH1 (Mannosyltransferase of the cis-Golgi apparatus; initiates the polymannose outer chain elongation of N-linked oligosaccharides of glycoproteins [Source:SGD;Acc:S000003006])

HSP 1 Score: 56.6102 bits (135), Expect = 3.006e-9
Identity = 29/102 (28.43%), Postives = 50/102 (49.02%), Query Frame = 3
Query:  291 ITKIIHQSWK----NKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFY---PWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFE 575
            I + + Q+WK    +KN P  F  + K+W+      + Y   +D+  +  + + Y   P  +  +  +P  I + D  RY  +F  GGIY+D+D   LKP +
Sbjct:   96 IPQRVWQTWKVGADDKNFPSSFRTYQKTWSGSYSPDYQYSLISDDSIIPFLENLYAPVPIVIQAFKLMPGNILKADFLRYLLLFARGGIYSDMDTMLLKPID 197          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000041207.1 (SMESG000041207.1)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 285/285 (100.00%), Postives = 285/285 (100.00%), Query Frame = 3
Query:  159 MLIKPFYLIFILLISFCVFLTIFLNQFLLAHNEYQKICPSDKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELLTGPIILSNTLKKYVVRNQSLNDQLIKIYEPKFFNPISWIDRSDSQEFCKEYWKMNSHDFKRCKNFMVERGSFVVQYHAHSWSA 1013
            MLIKPFYLIFILLISFCVFLTIFLNQFLLAHNEYQKICPSDKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELLTGPIILSNTLKKYVVRNQSLNDQLIKIYEPKFFNPISWIDRSDSQEFCKEYWKMNSHDFKRCKNFMVERGSFVVQYHAHSWSA
Sbjct:    1 MLIKPFYLIFILLISFCVFLTIFLNQFLLAHNEYQKICPSDKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELLTGPIILSNTLKKYVVRNQSLNDQLIKIYEPKFFNPISWIDRSDSQEFCKEYWKMNSHDFKRCKNFMVERGSFVVQYHAHSWSA 285          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000028419.1 (SMESG000028419.1)

HSP 1 Score: 313.153 bits (801), Expect = 1.106e-105
Identity = 146/254 (57.48%), Postives = 187/254 (73.62%), Query Frame = 3
Query:  258 YQKICPSDKKS--ITKIIHQSWKNKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELLTGPIILSNTLKKYVVRNQSLNDQL-IKIYEPKFFNPISWIDRSDSQEFCKEYWKMNSHDFKRCKNFMVERGSFVVQYHAHSWS 1010
            + K  P D  +  +TKIIHQSWK+  +P  F N+ KSWT+ CF+ WTYMFWTDEDN   I  +YPWFL+ YN+LP  I++ D +RYFYMFH+GGIYTDLDNECLKPFE LL NYS+VFGAM GQ   TS+ EGYVQNSFMYSTPRHEFW+E+I+ I       ++  PEL+TGPI+LSNTL+ Y  R  S  D++ +KIY  ++FNP SW+ R D+  FCK++ KM+  +++ CK F   +GSFV+QYHAH+W 
Sbjct:   27 FHKPKPEDNPNFKVTKIIHQSWKSSRVPIRFRNYSKSWTEECFKDWTYMFWTDEDNFNFISKYYPWFLSTYNNLPEPIFKADATRYFYMFHFGGIYTDLDNECLKPFEHLLNNYSMVFGAMDGQYDDTSLPEGYVQNSFMYSTPRHEFWMEMIFNIMKKKISSSEFVPELVTGPILLSNTLRDYRERFSSKIDEISLKIYPSQYFNPFSWLVRKDNISFCKDFNKMSYKNWQLCKKFFKTKGSFVIQYHAHTWG 280          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000045292.1 (SMESG000045292.1)

HSP 1 Score: 297.36 bits (760), Expect = 1.696e-99
Identity = 146/280 (52.14%), Postives = 189/280 (67.50%), Query Frame = 3
Query:  186 FILLISFCVFLTIFL----NQFLLAHNEYQKICPS-DKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELLTGPIILSNTLKKYVVRNQSLNDQLIKIYEPKFFNPISWIDRSDSQEFCKEYWKMNSHDFKRCKNFMVERGSFVVQYHAHSWS 1010
             +L +   +F+  F      +F +     Q +  + +K+ +TKIIH SWK  +IP +F  + KSWT  C++ W +MFWTD+DN  LI+ FYPWFL  YN  P  I+R DVSRYFY+FHYGGIYTDLDNECL+PFE LLQNYSLVFGAMKGQ +GT++KEGYVQNSFMYS PR  FW+EL+ +I  L SK    S E+ TGP++LS  +  Y  R  S +D +  IY P +FNP SWID S     CK + KM   +  +C++ M+ +GS+VVQYHAHSW 
Sbjct:   10 LVLALGNAIFIGTFFIKNYERFYIVEQPIQTLLKNCEKEKVTKIIHVSWKTNDIPVVFQKYLKSWTDFCYKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPWNIFRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSLVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDI--LMSKGTG-SVEVQTGPVLLSKRIALYRERLNSSDDMM--IYSPNYFNPFSWIDNSKVDPNCKSHNKMTLENLNKCRSSMISKGSYVVQYHAHSWG 284          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000045480.1 (SMESG000045480.1)

HSP 1 Score: 296.59 bits (758), Expect = 3.630e-99
Identity = 146/287 (50.87%), Postives = 192/287 (66.90%), Query Frame = 3
Query:  165 IKPFYLIFILLISFCVFLTIFL----NQFLLAHNEYQKICPS-DKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELLTGPIILSNTLKKYVVRNQSLNDQLIKIYEPKFFNPISWIDRSDSQEFCKEYWKMNSHDFKRCKNFMVERGSFVVQYHAHSWS 1010
            +K  + +F+ L +  +F+ IF      +F +     Q +  + +K+ +TKIIH SWK  +IP +F  + KSWT  C++ W +MFWTD+DN  LI+ FYPWFL  YN  P  IYR DVSRYFY+FHYGGIYTDLDNECL+PFE LLQNYS+VFGAMKGQ +GT++KEGYVQNSFMYS PR  FW+EL+ +I      K   S E+ TGP++LS  +  Y  R  S +D +  IY P +FNP SWID S     CK   +M   +  +C++ M+ +GS+VVQYHAHSW 
Sbjct:    4 VKKIFFLFLALGN-AIFIGIFFIENYERFYIVEQPIQTLLKNCEKEKVTKIIHVSWKTNDIPVVFQKYLKSWTDFCYKDWKFMFWTDKDNYNLIKTFYPWFLKTYNEFPRNIYRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSIVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMF---KGTDSVEVQTGPVLLSKRIALYRERLNSSDDMM--IYSPNYFNPFSWIDNSKVDPNCKSPNQMTRENLNKCRSSMLSKGSYVVQYHAHSWG 284          
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Match: SMESG000045267.1 (SMESG000045267.1)

HSP 1 Score: 295.819 bits (756), Expect = 9.244e-99
Identity = 138/244 (56.56%), Postives = 174/244 (71.31%), Query Frame = 3
Query:  279 DKKSITKIIHQSWKNKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFYPWFLNVYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFGAMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPELLTGPIILSNTLKKYVVRNQSLNDQLIKIYEPKFFNPISWIDRSDSQEFCKEYWKMNSHDFKRCKNFMVERGSFVVQYHAHSWS 1010
            +K+ +TKIIH SWK  +IP +F  + KSWT  C++ W +MFWTD+DN  LI+ FYPWFL  YN  P  IYR DVSRYFY+FHYGGIYTDLDNECL+PFE LLQNYS+VFGAMKGQ +GT++KEGYVQNSFMYS PR  FW+EL+ +I      K   S E+ TGP++LS  +  Y  R  S +D +  IY P +FNP SWID S     CK + +M   +  +C++ M+ +GS+VVQYHAHSW 
Sbjct:   46 EKEKVTKIIHVSWKTNDIPVVFQKYLKSWTDFCYKDWNFMFWTDKDNYNLIKTFYPWFLKTYNKFPRNIYRADVSRYFYLFHYGGIYTDLDNECLRPFEHLLQNYSIVFGAMKGQYLGTNLKEGYVQNSFMYSRPRQTFWMELLNDILMF---KGTDSVEVQTGPVLLSKRIALYRERLNSSDDMM--IYSPNYFNPFSWIDNSKVDLNCKSHNQMTRENLNKCRSSMISKGSYVVQYHAHSWG 284          
The following BLAST results are available for this feature:
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O14084|IMT1_SCHPO3.305e-2331.38Inositol phosphoceramide mannosyltransferase 1 OS=... [more]
sp|P38287|CSH1_YEAST2.260e-2133.50Mannosyl phosphorylinositol ceramide synthase CSH1... [more]
sp|P33300|SUR1_YEAST7.809e-2029.34Mannosyl phosphorylinositol ceramide synthase SUR1... [more]
sp|Q9UT67|IMT2_SCHPO8.299e-1935.33Inositol phosphoceramide mannosyltransferase 2 OS=... [more]
sp|Q10323|IMT3_SCHPO1.080e-1633.33Inositol phosphoceramide mannosyltransferase 3 OS=... [more]
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DTA43.679e-5442.98Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DNA29.810e-5435.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H9I31.151e-5335.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FXP53.729e-4837.65Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GI254.145e-4837.65Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
CSH13.255e-2333.50Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
SUR11.125e-2129.34Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
OCH13.006e-928.43Mannosyltransferase of the cis-Golgi apparatus; in... [more]
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of inositol phosphoceramide mannosyltransferase 2-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041207.10.000e+0100.00SMESG000041207.1[more]
SMESG000028419.11.106e-10557.48SMESG000028419.1[more]
SMESG000045292.11.696e-9952.14SMESG000045292.1[more]
SMESG000045480.13.630e-9950.87SMESG000045480.1[more]
SMESG000045267.19.244e-9956.56SMESG000045267.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030926 ID=SMED30030926|Name=inositol phosphoceramide mannosyltransferase 2-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1175bp
AGAAATTTTCTGATATTTTGTCCGGGTACTCTCAACTGAAAAGGATCTTC
TAATTATTTTCTTGCCTGGATTTCAATCGCAAGGAAAATATTCTCTACTC
GAATTCTCGCATAATAGGAAAACAAAATTATTTTGTAGATTTCACTCGTA
ATGACAAAATGTTAATCAAACCGTTTTATTTGATTTTTATTTTATTAATT
AGTTTTTGCGTATTTTTAACGATTTTTCTTAATCAGTTTCTTCTTGCACA
TAACGAGTATCAGAAAATCTGTCCATCGGATAAGAAGTCAATCACGAAAA
TTATTCATCAGTCATGGAAAAATAAAAATATCCCGAAACTTTTTCATAAC
TTCTACAAATCATGGACACAACATTGCTTTCGGTCTTGGACTTACATGTT
TTGGACGGATGAGGACAATTTGCAGTTGATCAGAGATTTTTATCCTTGGT
TTCTAAACGTGTACAACAGTTTGCCATCTGCGATTTATCGGGTGGATGTT
AGCAGATATTTCTACATGTTTCATTACGGAGGTATTTATACAGACCTAGA
CAATGAATGCCTGAAGCCGTTTGAGGATTTGCTGCAAAATTATTCATTGG
TATTTGGAGCCATGAAGGGTCAATCTATGGGAACCAGTATTAAAGAAGGA
TACGTTCAGAATTCTTTTATGTATTCAACACCGAGGCATGAATTTTGGCT
GGAACTTATCTATGAAATTGGCAATTTGGCGAGTAAGAAAAATAAAATTT
CTCCAGAACTTCTCACTGGACCGATTATTCTGTCAAACACGTTGAAAAAA
TACGTTGTCCGTAACCAGTCTCTTAATGATCAATTAATAAAAATTTATGA
ACCAAAATTTTTTAATCCCATCAGTTGGATTGACCGATCAGACTCGCAAG
AGTTCTGTAAGGAATATTGGAAAATGAATTCACATGATTTTAAACGTTGC
AAAAATTTCATGGTTGAAAGGGGTTCATTTGTCGTTCAATACCATGCACA
TTCCTGGAGTGCTTGAGGGATAAAGTGTCGCTCATATTATAAATTTCTTT
TATTTTGATGCATATCGCAAATTTTCACGTCACATGAAAAACAATGTACA
GCAATCTAAAGAAAGATTTTAATGATTCACTTTTTTTATTATGGTTATAC
ATTTTCAATGAAATTTGATGGACTT
back to top

protein sequence of SMED30030926-orf-1

>SMED30030926-orf-1 ID=SMED30030926-orf-1|Name=SMED30030926-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=286bp
MLIKPFYLIFILLISFCVFLTIFLNQFLLAHNEYQKICPSDKKSITKIIH
QSWKNKNIPKLFHNFYKSWTQHCFRSWTYMFWTDEDNLQLIRDFYPWFLN
VYNSLPSAIYRVDVSRYFYMFHYGGIYTDLDNECLKPFEDLLQNYSLVFG
AMKGQSMGTSIKEGYVQNSFMYSTPRHEFWLELIYEIGNLASKKNKISPE
LLTGPIILSNTLKKYVVRNQSLNDQLIKIYEPKFFNPISWIDRSDSQEFC
KEYWKMNSHDFKRCKNFMVERGSFVVQYHAHSWSA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000419prepharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR007577GlycoTrfase_DXD_sugar-bd_CS
IPR029044Nucleotide-diphossugar_trans
Vocabulary: molecular function
TermDefinition
GO:0000030mannosyltransferase activity
GO:0005537mannose binding
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: cellular component
TermDefinition
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
GO:0032588trans-Golgi network membrane
GO:0033106cis-Golgi network membrane
Vocabulary: biological process
TermDefinition
GO:0051999mannosyl-inositol phosphorylceramide biosynthetic process
GO:0097502mannosylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.550.20coord: 45..285
e-value: 8.6E-13
score: 51.0
NoneNo IPR availablePANTHERPTHR32385FAMILY NOT NAMEDcoord: 39..283
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR007577Glycosyltransferase, DXD sugar-binding motifPFAMPF04488Gly_transf_sugcoord: 61..145
e-value: 1.7E-15
score: 57.4
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 30..243