Protein tilB-like

Overview
NameProtein tilB-like
Smed IDSMED30030924
Length (bp)2926
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein tilB-like (SMED30030924) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein tilB-like (SMED30030924) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein tilB-like (SMED30030924) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein tilB-like (SMED30030924) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030924

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030924SMESG000009895.1 SmedASXL_012860SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30030924SMESG000009895.1 dd_Smed_v4_14797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30030924SMESG000009895.1 dd_Smed_v6_14797_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030924SMESG000009895.1 dd_Smed_v4_14797_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein tilB-like vs. TrEMBL
Match: A0A210PGF5 (Protein tilB-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08388 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 8.404e-45
Identity = 156/569 (27.42%), Postives = 280/569 (49.21%), Query Frame = 3
Query:  165 LTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAIEREETRKFFEKSKLDKFPIRRQIKHNSFRPSTVRNLRFNGKFGPSAFDFLSTFPNNIPLNEEWDKKKIYYMSEFLENNL-----FSNMEGKKWVLNWVTQLLSHLDNIQ--NISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAVICVLLSVLSIANSKIKIQNECVIELFPAMLKILWFQI----RLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFE--DKTNKVLNDIIDYSTGQENFIKKKFL----ILNDENADSTIL----VNIVLTEIQ-------NTVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKIIN-NSESLCGGFTTFKEEMDSFKEAGKVME----IGDIVLLGSQTLSIVLAVPEKNSALVQIQRFQ-SFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVF 1769
            L L  + I ++ NL     LW LDL NN I+ ++GLS FVA+G LNL+NN L W+ L  I+ + +++L LHGN +L+ D YYR  ++D  P ++ LD   +++ ER + + FF+ S L + PIR ++    F PS ++ +  NG FG  A   +  FP N   N E D++++ Y++  ++ +L     ++N E +  VL +    L  L  I+  ++    ++L+L   ++EF L   L ++ LD+  +         + F L  +++  V+CVLL+ +     KI   +     L+  +   L++ I    +L   T+  +  IK K   +  +Y   K L+A+E   +L  V +FFE   K   V+N +I   TG +  I +K      ++ D+  +   L      ++L ++Q       N  Q I SS  ++    +   K       +SA ++ + +S+ +          M + + + +  +    +GDI+LLG QTL  ++++P+   ALV +     + G  + K   S+ +   IN +   W+ ++G W P  + GD + 
Sbjct:   44 LILRGNDIFEVANLEHCTQLWRLDLGNNCIKSLDGLSRFVALGTLNLANNALTWHELGKIRHVHVLNLSLHGNPQLEKDPYYRIHVIDCLPHVWMLDGRLVTSAERLQVKHFFQDSALTEHPIRHKLAKEWFVPSNLKKIEVNGVFGEKATHVMRRFPTNGAHNIETDRRRLKYVAYNIQEDLVIDKKYTNREYQ--VLKYRQAFLEDLLEIRPTDLERCNMLLLLLVTSLEFVLPTHLVKETLDTAKLSKLGKVYTMDLFLLPRDVRCHVVCVLLAAV-----KIDKDDREDGGLYDKLYLCLFYTISELMKLSQSTSTKQTAIKSKLNTLYSDY---KCLLASEVIQLLCIVPAFFEYISKDIGVMN-LIMTGTG-DTLIAEKIARVSSVVEDKGGELKRLYEDQAELLLQKVQEQCLNLSNRTQKIPSSDEVINSMKALPMKR-----PLSALELADFHSKGVTSPHKDAPRIMSARRPSDRGRKRFPRLGDILLLGPQTLGKIVSLPQPFVALVSMDSVPVANGAMESKLKHSDDHYTYINMDHLGWDLDLGVWKPKGAIGDSLL 595          
BLAST of Protein tilB-like vs. TrEMBL
Match: V4CSL7 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_228077 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.343e-41
Identity = 145/562 (25.80%), Postives = 259/562 (46.09%), Query Frame = 3
Query:  165 LTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAIEREETRKFFEKSKLDKFPIRRQIKHNSFRPSTVRNLRFNGKFGPSAFDFLSTFPNNIPLNEEWDKKKIYYMSEFLENNLFSNMEGKK---WVLNWVTQLLSHLDNIQN--ISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAVICVLLSVLSIANSKIKIQNECVIELFPAMLKILWFQIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFE--DKTNKVLNDIIDYSTGQENF-------IKKKFLILNDENADSTILVNIVLTEIQNTVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKI------INNSESLCGGFTTFKEEMDSFKEAGKVMEIGDIVLLGSQTLSIVLAVPEKNSALVQIQRFQ-SFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVST 1787
            L L  + ++D++NL    NLW ++LS N ++C++GLS F+  G L LSNN L W  L  I+ + I++L LHGN +L+ D YYR  ++D  P ++ LD   +++ ER + + FF+ S L + P+RR++  + F  S ++N+   G FG  A   L+ FP +   N E DKK++ Y++  L+ ++    +  K    +L      +  L  ++N       ++L++   ++EF L   L Q+ L+   +         + F L  +++  V+ VLLS + I +  IK       +L+  +   +    ++     VD      K       +   +SL+AAE   +L  V   F+  +K   ++N I+  +TG  +        +    L   D  +    L  I+LT+++ T  +  S+      E+  I       S + A  I      + NS+ L  G  + +           + E+GD +LLG QT+  ++++P+   AL+ I     S G  + K      +   IN N   W      W P  + GD+  +  + +
Sbjct:   69 LNLHGNNLQDVNNLQYSPNLWSVNLSCNKLQCLDGLSRFLCFGELILSNNDLSWKELVKIRHIHILNLSLHGNPQLEKDQYYRIHVIDCLPNVWMLDGRIVTSAERIQVKNFFQDSALSEHPVRRKLTRDWFITSAMKNIELTGLFGQKAASVLTKFPVSAVHNIEMDKKRLLYLAYNLQEDMTVTQKATKRKYGILKHKKDFVEELLTVRNEEREKCNMLLIILVASLEFILPTHLVQETLEVAQLQKMGKVHTMDLFFLPRDIRCKVVSVLLSAVKI-DKDIKENGGLYDKLYLCLFYTICELTKISQSKTVD----TQKPNKYHALHKEYRSLLAAEMTQLLCIVPDLFDYVEKDMGIIN-ILTIATGDSDISMILTQNLHLGTLQGRDRKSICEELSEIILTKVE-TNMMNLSNSTPRSIESDVII------SKMKALPIKEVNLALYNSDYLMKGLPSPEHSNIKQDPNQPIAELGDEILLGPQTIGKIMSLPQPGIALISIDEVPVSNGSMESKLKDQEDHYTYINMNYLHWENHSQMWKPRGTVGDKFTIQSIES 617          
BLAST of Protein tilB-like vs. TrEMBL
Match: R7U6X5 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_188526 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 5.773e-39
Identity = 156/616 (25.32%), Postives = 287/616 (46.59%), Query Frame = 3
Query:  144 NVIMSDKL----TLTNSVIKD-----IDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYY-----------------------RQQIVDIFPRLFCLDCEFISAIEREETRKFFEKSKLDKFPIRRQIKHNSFRPSTVRNLRFNGKFGPSAFDFLSTFPNNIPLNEEWDKKKIYYMSEFLENNLFSNMEGKKWV------LNWVTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLN----EFFKLDLNLKLAVICVLLSVLSIANSK---IKIQNECVIELFPAMLKILWFQIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFEDK-TNKVLNDIIDYSTGQENFIKKKFLILNDENADSTILVNIVLTEIQNTVQLIFSSKY------IMQFENSRIYKN----HNPNSSV--SAFKIINNS--ESLCGGFTTFKEEMDSFKEAGKVMEIGDIVLLGSQTLSIVLAVPEKNSALVQIQRFQSFG---LNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERD 1802
            +++  DKL     L + ++KD     I N+   + LW LDLS N +  ++GL  F+AIG L LS+N + W+ L  I+ L I++L LHGN KL++D ++                       R  +VD  P L+CLD   I++ ERE+  +FF  S L   P+R ++K  SF  +T + ++  G  G     F+  FP N PLN E DK+++ Y+++ ++  +   +E ++         N++  LL+  +  Q   ++  IL+L   ++EF +  +L  + L +  +    +   N    E F L    +  V  +LLS + + N       + N+  + L+ A+     FQ+   A+   D    K   K+ +  +  +K LIA+E   ++  V  F+E   T+  +  ++  +TG + F+ +K   LN E      +  +V   +   +  I S  +       +Q EN  +  +      P++S+  S + +I  S  E       + + E  SF       ++GD VLLG Q +  ++++PE   ALVQ+    S     ++ P+     Q    ++  ++ ++   G+W    + GDR+ + +++ +  R+
Sbjct:   28 DIVYIDKLHSCPRLRSLILKDNSLFFISNIECLHELWKLDLSCNKVTNLDGLQRFIAIGSLLLSSNDIDWSELNKIRHLHILNLSLHGNRKLESDPHFLTYHSPDERLETVRFQLCAFKSDRAHVVDCLPNLWCLDGRIITSAEREQVSQFFCDSALTDRPVRHKLKQKSFTATTFKGVQITGVHGEKTVQFMRRFPLNGPLNAEMDKRRLSYLAQNVQEEVMLELESRRLFKNLSRNSNFLEDLLASREGEQMKCNM--ILLLLIASLEFNIPTKLMHEVLTAAKLANISSHSSNVTTMELFLLKKEHRSRVASLLLSSVKVENDAGLDGGLYNQLYVALYNAV-----FQLTKLAEGASDSKEKKVN-KNALNLHDEAKCLIASEVVRLMCNVLGFYEYLFTDAGIISMVAMATG-DAFVVEKLKGLNLEKEKGEDVYQLVADSL---IAYIHSFTWKPRPWSTLQQENQVLQVSKALPRRPHTSILASDYHLIGLSCPERQAARIKSGRVERRSFIPKA---QLGDRVLLGPQNVGRIISMPEPEMALVQMDIIPSESGAMISTPRD--VEQRFTYLDMRLFSFDSSQGFWRQDGTVGDRITIQRLADKENRE 626          
BLAST of Protein tilB-like vs. TrEMBL
Match: A0A2B4RS05 (Uncharacterized protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene16452 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 4.906e-37
Identity = 146/594 (24.58%), Postives = 270/594 (45.45%), Query Frame = 3
Query:  165 LTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAIEREETRKFFEKSKLDKFPIRRQIKHNSFRPSTVRNLRFNGKFGPSAFDFLSTFPNNIPLNEEWDKKKIYYMSEFLEN--NLF--SNMEGKKWVLNWVTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAVICVLLSVLSIANSKIKIQNECVIELFPAMLKILWFQIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFE--DKTNKVLNDII-------------------DYSTGQENFIKK---KFLILNDENADSTI----------LVNIVLTEIQNTVQLIFSSKYIMQFENSR-------IYKNHNPNSSVSAFKIINNSESLCGGFTTFKEEM--DSFKEAGKVMEIGDIVLLGSQTLSIVLAVPEKNSALVQIQRFQSFGLNKPKHNIS--NQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERER 1799
            L +  + I+ + +L  ++ LW +DL+NN++  + GL    A G L L+NN L W  L+ ++ + I+ L LHGN KL+ D YYR  ++DI P ++ LD   I++ ER +  +FF+ S L   P+R ++  N F PS+++N+   G FG      +  FP    LN + DK+++ Y++  L+   NL+  SNM+GK      +  L+++ +  +   ++  +L++   ++EF +   L Q+ LD   +   +N    + F L  +++  VI +LL  + I + +  I       L+  +  ++   +RL    ++ +     +R D     +  + L+A+E   +L  V  FF+   K   VL+ II                     + G  N + +   ++L+   + A++T+          L+             + SSK +++  + R       I+      +  S  K  N + S  G  T+ K  +     K AG+   +GD V +G Q    ++A+PE +  LVQ++   +    +  + IS  +Q    +      W+C    W    S G   F+  V  +  R
Sbjct:   45 LIVRGNRIEAVPDLRCYSQLWKIDLANNVVRSLEGLFSVAAFGTLILANNDLDWIELQKMRHVHILDLSLHGNHKLEMDAYYRMHVIDILPLVWMLDGRIITSAERAQVEQFFKDSALSDRPVRHKLPKNQFVPSSLKNVSVTGVFGQKREHLMRRFPIKEKLNVDLDKRRLLYLAYSLQQEVNLYVKSNMKGKVKPSLLIENLINYRNEDKERCNM--LLLMLVASLEFAIPSLLVQQTLDITRLRKIRNVDTMDVFMLPRDVRCRVISLLLGAVKIEHDQ-HIDGGLYNRLYLCLYDLVADLVRLANGDSIAKYQATRRRLDSRKAGY--RCLLASEVVQLLCIVPVFFDFIGKDPGVLDLIIVATKDEMIGERIRSLSWKMQSAGGGINRVSREVAEYLLERVKQANATLSGKKGTDHGRLIKAEQQMRSAEPSYVISSKRLLKTSHERPQSCIGLIWSKLERYNMPSGSK--NRAMSAVGVKTSQKAGLMRKRIKSAGRKPVLGDRVEVGHQAYGRLVAIPESDMGLVQLETIAAPKFQQADYPISYLDQQFLYVGFADINWDCASETWRQSYSKG---FMESVGRKGSR 628          
BLAST of Protein tilB-like vs. TrEMBL
Match: A0A1S3INU6 (uncharacterized protein LOC106166025 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106166025 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 8.709e-37
Identity = 145/596 (24.33%), Postives = 265/596 (44.46%), Query Frame = 3
Query:  165 LTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAIEREETRKFFEKSKLDKFPIRRQIKHNSFRPSTVRNLRFNGKFGPSAFDFLSTFPNNIPLNEEWDKKKIYYMSEFLENNLF--SNMEGKKW-VLNWVTQLLSHL--DNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAVICVLLSVLSIANSKIKI---QNECV-IELFPAMLKILWFQIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFE--DKTNKVLNDIIDYSTGQENFIKKKFLILNDENADSTIL-------VNIVLTEIQ-NTVQLI---FSSKYIMQFENSRIYKNHNPNSSVSAFKIINNSESLCGGFTTFKE-EMDSFKEAG---KVMEIGDIVLLGSQTLSIVLAVPEKNSALVQI-----------------------QRFQSFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERDL 1805
            L L  + I  + NLS    LW LDLSNN I  + GL  F+A+G + L+NN L W  L  ++ + I+ L L GN +L+ D YYR  ++D  P ++ LD   I++ ER + + FF+ S L   P+R ++    F PS+ + ++ NG +G    +    FP +  +N + DKK++ Y++  L+ ++   S   GKK+ +LN+    L  L  +  ++     + L+L    +EF +  +L ++ LD   +         + F L   ++ +V+ +LLS + +   + +    Q +C    L+  +   L++ +   A                   Y   + L+A+E   +L  V +FF+  DK   V+N ++  +TG  +   K   +          L        + VL  +Q NT+ L    F  K +     S+      P SS     ++ +   + G  T  ++  + S K A    K  ++G+ +LLG Q ++ V+++P+ + ALVQ+                           + G        +  + + I+     W+    +W P  + GDR+ +  +   R+R+L
Sbjct:   44 LILQGNNIDTVSNLSNCQQLWKLDLSNNQIRNLEGLDRFIALGTVVLTNNNLTWAELGKLQHIHIIDLSLQGNPQLEKDPYYRIHVIDCLPNVWMLDGRIITSAERLQVQHFFQDSALTDHPVRHKLGSRQFVPSSHKKIQINGIYGEKTVELFRRFPVDGAINVDTDKKRLKYIAYNLQEDMILESRCCGKKYKILNYDQNFLEELLEERAKDRERGNMFLLLLVATLEFAMPTQLIKETLDVAKLSEIGKIKSLDLFLLPREVRCSVVSLLLSAVKVDKDEKEAAFPQWQCKDGGLYDRLYLCLYYTVSELARLGRSRGSSSASAAKSSDMYKDYRCLLASEVVQLLCIVPAFFDFLDKDVGVMN-LVATATGDYHICDKVTDLAESVRQRGGNLKAIYEHAADFVLNAVQENTLNLANKGFRKKKVDHVLTSKPAYPKRPQSS----PLVASEYHMRGRSTPMRQYRIQSSKPARQTEKKPKLGERILLGPQNVARVMSIPQTDIALVQMDVVAGPHWKESEKTPADMVTFTRDTMVATGAMVSGRTDAESHFSYIDMTQLIWDDGGRFWRPRGTVGDRITIQSI---RDRNL 631          
BLAST of Protein tilB-like vs. Ensembl Nematostella
Match: EDO32281 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVI3])

HSP 1 Score: 118.627 bits (296), Expect = 3.568e-27
Identity = 57/147 (38.78%), Postives = 88/147 (59.86%), Query Frame = 3
Query:  165 LTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAIEREETRKFFEKSKLDKFPIRRQIKHNSFRPSTVRNLRFNGKFG 605
            L L ++ I+ + ++     LW +DL+NN +  + GLS F A G L LSNN L W+ L+ I+ + I+ L LHGN KL+ D YYR  ++D  P ++ LD   I++ ER + R+FF+ S     P+RR++    F PST++N+   G  G
Sbjct:   44 LILRDNRIEAVPDIDCCPQLWRIDLANNRLRSLEGLSRFAAFGCLILSNNELEWDELQKIRHIHILDLALHGNPKLEMDAYYRMHVIDSLPLIWMLDGRIITSAERAQVRQFFKDSAYSDRPVRRKLPRKQFVPSTIKNITVTGVHG 190          
BLAST of Protein tilB-like vs. Planmine SMEST
Match: SMESG000009895.1 (SMESG000009895.1)

HSP 1 Score: 1241.1 bits (3210), Expect = 0.000e+0
Identity = 657/724 (90.75%), Postives = 666/724 (91.99%), Query Frame = 3
Query:  153 MSDKLTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAIEREETRKFFEKSKLDKFPIRRQIKHNSFRPSTVRNLRFNGKFGPSAFDFLSTFPNNIPLNEEWDKKKIYYMSEFLENNLFSNMEGK----KWVLNWVTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAVICVLLSVLSIANSKIKIQNECVIELFPAMLKILWFQIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFEDKTNKVLNDIIDYSTGQENFIKKKFLILNDENADSTILVNIVLTEIQNTVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKIINNSESLCGGFTTFKEEMDSFKEAGKVMEIGDIVLLGSQTLSIVLAVPEKNSALVQIQRFQSFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERDLPRSLSCNKKTTIDLSKISLCEDYLDKNLDCDYGDKELSYRNSWEKTPVEQVENPKANRHRAKTASPRRVLKSPNFAKLDFNEINNCIKTGSKHAKDNFRIQXXXXXXXXXXXXXXXXXXXTNDSRLWLGKGDNLYRNNKWNSRNPANVQKRIYTPGWIKSYEYINKQNN 2312
            MSDKLTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAIEREETRKFFEKSKLDKFPI      N  +  T+    F GK G      L   P       +   KK++  +        S+  G     +WVLNWVTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAV CVLLSVLSIANSKIKIQNECVIELFPAMLKILW QIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFEDKTNKVLNDIIDYSTGQENFIKKKFLILNDENADSTILVNIVLTEIQNTVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKIINNSESLCGGFTTFKEEMDSFKEAGKVMEIGDIVLLGSQTLS VLAVPEKNSALVQIQRFQSFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERDLPRSLSCNKK TIDLSKISLCEDYLDKN DCDYGDKELSYRNSWEKTPV+QVENPKANRHRAKTASPRRVLKSPNFAKLDFNEINNCIKTGSK AKDNFRIQSTFSYPSPSSSLCSSRPFPTNDSRLWLGKGDNLYRNNKWNSRNPANVQKRIYTPGWIKSYEYINKQNN
Sbjct:    1 MSDKLTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAIEREETRKFFEKSKLDKFPI-----ENKSKICTLFRKLFQGKEG-----MLFGNPG------KGTSKKLFIWTA------VSDYRGPNGIIRWVLNWVTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAVFCVLLSVLSIANSKIKIQNECVIELFPAMLKILWVQIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFEDKTNKVLNDIIDYSTGQENFIKKKFLILNDENADSTILVNIVLTEIQNTVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKIINNSESLCGGFTTFKEEMDSFKEAGKVMEIGDIVLLGSQTLSNVLAVPEKNSALVQIQRFQSFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERDLPRSLSCNKKATIDLSKISLCEDYLDKNFDCDYGDKELSYRNSWEKTPVKQVENPKANRHRAKTASPRRVLKSPNFAKLDFNEINNCIKTGSKPAKDNFRIQSTFSYPSPSSSLCSSRPFPTNDSRLWLGKGDNLYRNNKWNSRNPANVQKRIYTPGWIKSYEYINKQNN 702          
BLAST of Protein tilB-like vs. Planmine SMEST
Match: SMESG000009895.1 (SMESG000009895.1)

HSP 1 Score: 1192.56 bits (3084), Expect = 0.000e+0
Identity = 637/720 (88.47%), Postives = 644/720 (89.44%), Query Frame = 3
Query:  153 MSDKLTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAIEREETRKFFEKSKLDKFPIRRQIKHNSFRPSTVRNLRFNGKFGPSAFDFLSTFPNNIPLNEEWDKKKIYYMSEFLENNLFSNMEGKKWVLNWVTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAVICVLLSVLSIANSKIKIQNECVIELFPAMLKILWFQIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFEDKTNKVLNDIIDYSTGQENFIKKKFLILNDENADSTILVNIVLTEIQNTVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKIINNSESLCGGFTTFKEEMDSFKEAGKVMEIGDIVLLGSQTLSIVLAVPEKNSALVQIQRFQSFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERDLPRSLSCNKKTTIDLSKISLCEDYLDKNLDCDYGDKELSYRNSWEKTPVEQVENPKANRHRAKTASPRRVLKSPNFAKLDFNEINNCIKTGSKHAKDNFRIQXXXXXXXXXXXXXXXXXXXTNDSRLWLGKGDNLYRNNKWNSRNPANVQKRIYTPGWIKSYEYINKQNN 2312
            MSDKLTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAI         E+ +  KF                        F  S  D    FP  +          IY +  F        +   +WVLNWVTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAV CVLLSVLSIANSKIKIQNECVIELFPAMLKILW QIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFEDKTNKVLNDIIDYSTGQENFIKKKFLILNDENADSTILVNIVLTEIQNTVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKIINNSESLCGGFTTFKEEMDSFKEAGKVMEIGDIVLLGSQTLS VLAVPEKNSALVQIQRFQSFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERDLPRSLSCNKK TIDLSKISLCEDYLDKN DCDYGDKELSYRNSWEKTPV+QVENPKANRHRAKTASPRRVLKSPNFAKLDFNEINNCIKTGSK AKDNFRIQSTFSYPSPSSSLCSSRPFPTNDSRLWLGKGDNLYRNNKWNSRNPANVQKRIYTPGWIKSYEYINKQNN
Sbjct:    1 MSDKLTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAI---------EREETRKF------------------------FEKSKLD---KFPIGV----------IYLIGIFC-----LILYCFRWVLNWVTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAVFCVLLSVLSIANSKIKIQNECVIELFPAMLKILWVQIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFEDKTNKVLNDIIDYSTGQENFIKKKFLILNDENADSTILVNIVLTEIQNTVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKIINNSESLCGGFTTFKEEMDSFKEAGKVMEIGDIVLLGSQTLSNVLAVPEKNSALVQIQRFQSFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERDLPRSLSCNKKATIDLSKISLCEDYLDKNFDCDYGDKELSYRNSWEKTPVKQVENPKANRHRAKTASPRRVLKSPNFAKLDFNEINNCIKTGSKPAKDNFRIQSTFSYPSPSSSLCSSRPFPTNDSRLWLGKGDNLYRNNKWNSRNPANVQKRIYTPGWIKSYEYINKQNN 669          
BLAST of Protein tilB-like vs. Planmine SMEST
Match: SMESG000009895.1 (SMESG000009895.1)

HSP 1 Score: 1148.27 bits (2969), Expect = 0.000e+0
Identity = 589/656 (89.79%), Postives = 598/656 (91.16%), Query Frame = 3
Query:  153 MSDKLTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAIEREETRKFFEKSKLDKFPIRRQIKHNSFRPSTVRNLRFNGKFGPSAFDFLSTFPNNIPLNEEWDKKKIYYMSEFLENNLFSNMEGK----KWVLNWVTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAVICVLLSVLSIANSKIKIQNECVIELFPAMLKILWFQIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFEDKTNKVLNDIIDYSTGQENFIKKKFLILNDENADSTILVNIVLTEIQNTVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKIINNSESLCGGFTTFKEEMDSFKEAGKVMEIGDIVLLGSQTLSIVLAVPEKNSALVQIQRFQSFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERDLPRSLSCNKKTTIDLSKISLCEDYLDKNLDCDYGDKELSYRNSWEKTPVEQVENPKANRHRAKTASPRRVLKSPNFAKLDFNEINNCIKTGSKHAKDNFRIQ 2108
            MSDKLTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAIEREETRKFFEKSKLDKFPI      N  +  T+    F GK G      L   P       +   KK++  +        S+  G     +WVLNWVTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAV CVLLSVLSIANSKIKIQNECVIELFPAMLKILW QIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFEDKTNKVLNDIIDYSTGQENFIKKKFLILNDENADSTILVNIVLTEIQNTVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKIINNSESLCGGFTTFKEEMDSFKEAGKVMEIGDIVLLGSQTLS VLAVPEKNSALVQIQRFQSFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERDLPRSLSCNKK TIDLSKISLCEDYLDKN DCDYGDKELSYRNSWEKTPV+QVENPKANRHRAKTASPRRVLKSPNFAKLDFNEINNCIKTGSK AKDNFRIQ
Sbjct:    1 MSDKLTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAIEREETRKFFEKSKLDKFPI-----ENKSKICTLFRKLFQGKEG-----MLFGNPG------KGTSKKLFIWTA------VSDYRGPNGIIRWVLNWVTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAVFCVLLSVLSIANSKIKIQNECVIELFPAMLKILWVQIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFEDKTNKVLNDIIDYSTGQENFIKKKFLILNDENADSTILVNIVLTEIQNTVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKIINNSESLCGGFTTFKEEMDSFKEAGKVMEIGDIVLLGSQTLSNVLAVPEKNSALVQIQRFQSFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERDLPRSLSCNKKATIDLSKISLCEDYLDKNFDCDYGDKELSYRNSWEKTPVKQVENPKANRHRAKTASPRRVLKSPNFAKLDFNEINNCIKTGSKPAKDNFRIQ 634          
BLAST of Protein tilB-like vs. Planmine SMEST
Match: SMESG000009895.1 (SMESG000009895.1)

HSP 1 Score: 1099.35 bits (2842), Expect = 0.000e+0
Identity = 569/652 (87.27%), Postives = 576/652 (88.34%), Query Frame = 3
Query:  153 MSDKLTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAIEREETRKFFEKSKLDKFPIRRQIKHNSFRPSTVRNLRFNGKFGPSAFDFLSTFPNNIPLNEEWDKKKIYYMSEFLENNLFSNMEGKKWVLNWVTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAVICVLLSVLSIANSKIKIQNECVIELFPAMLKILWFQIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFEDKTNKVLNDIIDYSTGQENFIKKKFLILNDENADSTILVNIVLTEIQNTVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKIINNSESLCGGFTTFKEEMDSFKEAGKVMEIGDIVLLGSQTLSIVLAVPEKNSALVQIQRFQSFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERDLPRSLSCNKKTTIDLSKISLCEDYLDKNLDCDYGDKELSYRNSWEKTPVEQVENPKANRHRAKTASPRRVLKSPNFAKLDFNEINNCIKTGSKHAKDNFRIQ 2108
            MSDKLTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAI         E+ +  KF                        F  S  D    FP  +          IY +  F        +   +WVLNWVTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAV CVLLSVLSIANSKIKIQNECVIELFPAMLKILW QIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFEDKTNKVLNDIIDYSTGQENFIKKKFLILNDENADSTILVNIVLTEIQNTVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKIINNSESLCGGFTTFKEEMDSFKEAGKVMEIGDIVLLGSQTLS VLAVPEKNSALVQIQRFQSFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERDLPRSLSCNKK TIDLSKISLCEDYLDKN DCDYGDKELSYRNSWEKTPV+QVENPKANRHRAKTASPRRVLKSPNFAKLDFNEINNCIKTGSK AKDNFRIQ
Sbjct:    1 MSDKLTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLNLSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCLDCEFISAI---------EREETRKF------------------------FEKSKLD---KFPIGV----------IYLIGIFC-----LILYCFRWVLNWVTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICKNFGLNEFFKLDLNLKLAVFCVLLSVLSIANSKIKIQNECVIELFPAMLKILWVQIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSFFEDKTNKVLNDIIDYSTGQENFIKKKFLILNDENADSTILVNIVLTEIQNTVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKIINNSESLCGGFTTFKEEMDSFKEAGKVMEIGDIVLLGSQTLSNVLAVPEKNSALVQIQRFQSFGLNKPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERDLPRSLSCNKKATIDLSKISLCEDYLDKNFDCDYGDKELSYRNSWEKTPVKQVENPKANRHRAKTASPRRVLKSPNFAKLDFNEINNCIKTGSKPAKDNFRIQ 601          
The following BLAST results are available for this feature:
BLAST of Protein tilB-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tilB-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tilB-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tilB-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tilB-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tilB-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tilB-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tilB-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PGF58.404e-4527.42Protein tilB-like OS=Mizuhopecten yessoensis OX=65... [more]
V4CSL71.343e-4125.80Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
R7U6X55.773e-3925.32Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2B4RS054.906e-3724.58Uncharacterized protein OS=Stylophora pistillata O... [more]
A0A1S3INU68.709e-3724.33uncharacterized protein LOC106166025 isoform X1 OS... [more]
back to top
BLAST of Protein tilB-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tilB-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tilB-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tilB-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO322813.568e-2738.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein tilB-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tilB-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000009895.10.000e+090.75SMESG000009895.1[more]
SMESG000009895.10.000e+088.47SMESG000009895.1[more]
SMESG000009895.10.000e+089.79SMESG000009895.1[more]
SMESG000009895.10.000e+087.27SMESG000009895.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030924 ID=SMED30030924|Name=Protein tilB-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2926bp
CACTCAATCAAATTTTTATTAGTTAATATTTTTCATGATAGTCAAATTTA
AATTAAATTTTCTACTTTTCTGACTTTACTTTTTGATTTGTAAGTAACAT
GGTTTGATTAAGTTGAAATTGATTTAATTATAATCATTTAACTAATGTTA
TTATGTCTGACAAATTAACGTTAACGAATTCGGTTATTAAAGATATTGAT
AATCTTTCAAAATTCAATAATTTATGGATATTAGATTTATCAAATAATAT
GATTGAGTGTGTAAACGGTTTAAGCTGTTTTGTTGCAATCGGATATTTAA
ATTTAAGCAACAATCGACTTTGTTGGAATTCTTTAGAAAGTATTAAAGCT
CTATTTATTGTTCATCTCGAATTGCATGGCAATTTAAAATTAGATAATGA
TAATTATTATCGCCAGCAAATTGTTGATATTTTCCCCAGACTGTTTTGTT
TGGATTGTGAATTTATTAGTGCAATCGAACGAGAAGAAACAAGAAAATTT
TTTGAAAAAAGCAAATTGGATAAATTTCCAATAAGGCGCCAAATTAAACA
TAATTCCTTTCGACCTTCAACTGTCAGAAATTTGAGATTTAACGGTAAAT
TTGGTCCGTCAGCGTTTGACTTTTTGTCAACTTTTCCAAATAATATTCCA
CTGAATGAAGAATGGGATAAAAAGAAGATTTATTACATGTCAGAATTTTT
AGAAAACAATCTCTTCTCAAATATGGAAGGAAAAAAATGGGTCTTGAATT
GGGTTACGCAATTATTATCTCACTTGGATAATATTCAAAACATTTCTGAC
TTATATGTCATTCTTGTTCTTTATTGTGTTAATATCGAGTTTGGGTTGGA
GGAGGAACTATTTCAGAAAGCATTAGACAGTAATCATATGGGCATATGCA
AGAATTTTGGTTTAAATGAATTTTTTAAACTCGATTTAAATTTAAAATTG
GCGGTTATCTGTGTTCTTTTATCTGTCTTATCAATTGCAAATTCTAAAAT
AAAAATACAAAATGAATGTGTCATTGAGCTTTTTCCTGCAATGCTTAAGA
TTCTTTGGTTTCAAATTCGATTGAAAGCTGACACGAATGTTGATGAATTA
TTAATAAAATATAAAAGAAAAGACATTATAATTAATTACTGGCTATCCAA
AAGTCTCATTGCAGCAGAAACCTTTATGATATTATCAAAAGTCCAATCAT
TTTTCGAAGACAAAACAAATAAAGTTCTAAATGATATAATTGATTATTCT
ACTGGTCAAGAAAATTTTATCAAAAAAAAATTTTTGATTTTGAACGACGA
AAATGCTGACTCTACAATTTTGGTAAATATTGTGCTTACCGAAATTCAAA
ATACTGTCCAACTTATCTTTTCTTCCAAATATATTATGCAATTTGAAAAT
AGTAGAATTTATAAGAATCATAATCCAAATTCTTCAGTTTCGGCTTTTAA
AATTATAAATAACAGTGAAAGTCTTTGTGGTGGTTTTACTACATTTAAAG
AGGAAATGGATTCTTTCAAAGAGGCTGGAAAAGTTATGGAAATTGGGGAT
ATTGTTTTGCTTGGTTCCCAGACTTTGTCGATTGTTCTTGCAGTCCCTGA
AAAGAATTCGGCACTAGTACAAATACAACGGTTTCAAAGCTTTGGATTAA
ATAAACCAAAACACAATATATCAAATCAAAATATTGCAAAAATCAACCCA
AACATTTATCAATGGAATTGTGAAATGGGCTATTGGATGCCCTTGAACTC
CTTTGGAGATCGAGTTTTTCTTTCGAAAGTAAGCACTGAAAGAGAAAGAG
ATCTGCCTAGATCATTGTCTTGTAATAAAAAAACAACGATAGACTTATCC
AAAATCAGTCTTTGTGAAGATTATCTTGACAAGAATCTTGATTGTGATTA
TGGTGATAAAGAACTGAGTTATCGAAATAGTTGGGAAAAAACTCCCGTAG
AACAAGTGGAAAATCCAAAAGCTAATCGTCATAGAGCAAAAACTGCCAGT
CCACGAAGAGTATTAAAATCACCGAATTTCGCAAAATTAGATTTTAATGA
AATAAATAATTGTATCAAAACTGGCTCTAAGCATGCGAAGGATAATTTCA
GAATTCAATCAACATTTTCCTATCCATCGCCTTCTTCATCTTTGTGTTCG
TCACGGCCCTTCCCTACCAATGACTCAAGATTATGGCTGGGAAAGGGTGA
TAATCTCTATAGGAATAATAAATGGAATTCTAGAAATCCTGCCAATGTCC
AGAAGCGAATTTATACTCCTGGCTGGATAAAAAGCTATGAATATATAAAT
AAACAAAATAATTAGATTCCCCTCTAAGTATTTGCCTTTGATCAGCCAGT
GATTTCATTTTATATTATGTTTTCATAAATGATTATAAATATTATTATAT
ATTATTATATAACAAATAATTTCAACAAAATTAAATCAATTAAAGTTTTC
CCTAGTGAATTAAAATAATGCAGCAAATAAAACGTTGATGAAAATAAATT
AGAATCAAGGTTTTAATGAAAATATATTCATCAGCAATCGGAATTTCCAT
TTTCATGATGCCTTTGAAAAATTTGGAAATTTATTTATTTTCAGTAATAA
AACAAAAAAAATCAGTTTCAGGTTGATAAAAGACTTTTTTCAAAGGATCT
GAAATATAACATATTATTCAAAGCGCAGTACAAGTTGGAGTAAAGACATG
TCATAAAACAGTTTTTCTTCTGCTATAATAAATTCCCCCTGGTCACTTTG
AATTTTTCGAAAATGCCAATCATTTACAGTTAGAGAGGTTAAATCTCTTT
GTGATTCTTTTATTGTGGAAGATGATCAATTTAGTCTTTTCTACCATCTT
AGAGAGAAACACTTAACCAAGATCTCTTTAAATTTTTATTTTCAGCTTTA
CTCAGATTTATTCTTAGTTTCTCGAA
back to top

protein sequence of SMED30030924-orf-1

>SMED30030924-orf-1 ID=SMED30030924-orf-1|Name=SMED30030924-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=721bp
MSDKLTLTNSVIKDIDNLSKFNNLWILDLSNNMIECVNGLSCFVAIGYLN
LSNNRLCWNSLESIKALFIVHLELHGNLKLDNDNYYRQQIVDIFPRLFCL
DCEFISAIEREETRKFFEKSKLDKFPIRRQIKHNSFRPSTVRNLRFNGKF
GPSAFDFLSTFPNNIPLNEEWDKKKIYYMSEFLENNLFSNMEGKKWVLNW
VTQLLSHLDNIQNISDLYVILVLYCVNIEFGLEEELFQKALDSNHMGICK
NFGLNEFFKLDLNLKLAVICVLLSVLSIANSKIKIQNECVIELFPAMLKI
LWFQIRLKADTNVDELLIKYKRKDIIINYWLSKSLIAAETFMILSKVQSF
FEDKTNKVLNDIIDYSTGQENFIKKKFLILNDENADSTILVNIVLTEIQN
TVQLIFSSKYIMQFENSRIYKNHNPNSSVSAFKIINNSESLCGGFTTFKE
EMDSFKEAGKVMEIGDIVLLGSQTLSIVLAVPEKNSALVQIQRFQSFGLN
KPKHNISNQNIAKINPNIYQWNCEMGYWMPLNSFGDRVFLSKVSTERERD
LPRSLSCNKKTTIDLSKISLCEDYLDKNLDCDYGDKELSYRNSWEKTPVE
QVENPKANRHRAKTASPRRVLKSPNFAKLDFNEINNCIKTGSKHAKDNFR
IQSTFSYPSPSSSLCSSRPFPTNDSRLWLGKGDNLYRNNKWNSRNPANVQ
KRIYTPGWIKSYEYINKQNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005930axoneme
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 354..373