SMED30030912
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30030912 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 1
Homology
BLAST of SMED30030912 vs. TrEMBL
Match: T1G6Q9 (Dimer_Tnp_hAT domain-containing protein OS=Helobdella robusta OX=6412 GN=20216756 PE=4 SV=1) HSP 1 Score: 51.6026 bits (122), Expect = 1.866e-9 Identity = 32/59 (54.24%), Postives = 38/59 (64.41%), Query Frame = -3 Query: 345 NDTVFKRIFNKKEQSEF*IFLSSR-------EIVLLLTFKSSYLYEQGFSAPTETK*KK 500 ND VFKR+F +KE SEF ++L+S+ I LL F SSYL EQGFS TE K KK Sbjct: 10 NDLVFKRLFTEKELSEFWLYLNSKFPKLSNAAIESLLPFGSSYLCEQGFSTLTEMKSKK 68 HSP 2 Score: 38.5058 bits (88), Expect = 1.866e-9 Identity = 19/37 (51.35%), Postives = 26/37 (70.27%), Query Frame = -2 Query: 241 KKSVRLQIVDKEMRICL*KLEPCIFLICVDNQA*ISH 351 KK RLQ++D+EMR+CL ++ P I LIC Q+ SH Sbjct: 67 KKRERLQMIDEEMRVCLSQVHPRIDLICSQKQSQCSH 103
BLAST of SMED30030912 vs. TrEMBL
Match: T1G894 (Dimer_Tnp_hAT domain-containing protein OS=Helobdella robusta OX=6412 GN=20217291 PE=4 SV=1) HSP 1 Score: 49.2914 bits (116), Expect = 9.260e-9 Identity = 31/59 (52.54%), Postives = 37/59 (62.71%), Query Frame = -3 Query: 345 NDTVFKRIFNKKEQSEF*IFLSSR-------EIVLLLTFKSSYLYEQGFSAPTETK*KK 500 ND VFKR+F ++E SEF + L+S+ I LL F SSYL EQGFS TE K KK Sbjct: 10 NDLVFKRLFTEQELSEFWLCLNSKFPKLSNAAIESLLPFGSSYLCEQGFSTLTEMKSKK 68 HSP 2 Score: 38.5058 bits (88), Expect = 9.260e-9 Identity = 19/37 (51.35%), Postives = 26/37 (70.27%), Query Frame = -2 Query: 241 KKSVRLQIVDKEMRICL*KLEPCIFLICVDNQA*ISH 351 KK RLQ++D+EMR+CL ++ P I LIC Q+ SH Sbjct: 67 KKRERLQMIDEEMRVCLSQVHPRIDLICSQKQSQCSH 103
BLAST of SMED30030912 vs. TrEMBL
Match: T1G0N2 (Dimer_Tnp_hAT domain-containing protein OS=Helobdella robusta OX=6412 GN=20214630 PE=4 SV=1) HSP 1 Score: 50.447 bits (119), Expect = 7.679e-8 Identity = 32/59 (54.24%), Postives = 37/59 (62.71%), Query Frame = -3 Query: 345 NDTVFKRIFNKKEQSEF*IFLSSR-------EIVLLLTFKSSYLYEQGFSAPTETK*KK 500 ND VFKR+F +KE SEF + L+S+ I LL F SSYL EQGFS TE K KK Sbjct: 10 NDLVFKRLFTEKELSEFWLCLNSKFPKLSNAAIESLLPFGSSYLCEQGFSTLTEMKSKK 68 HSP 2 Score: 34.2686 bits (77), Expect = 7.679e-8 Identity = 16/28 (57.14%), Postives = 22/28 (78.57%), Query Frame = -2 Query: 268 KKSVRLQIVDKEMRICL*KLEPCIFLIC 351 KK RLQ++D+EMR+CL ++ P I LIC Sbjct: 67 KKRERLQMIDEEMRVCLSQVHPRIDLIC 94
BLAST of SMED30030912 vs. TrEMBL
Match: A0A0P4VJ40 (Putative transposase (Fragment) OS=Rhodnius neglectus OX=72488 PE=2 SV=1) HSP 1 Score: 41.5874 bits (96), Expect = 2.741e-6 Identity = 20/37 (54.05%), Postives = 26/37 (70.27%), Query Frame = -2 Query: 241 KKSVRLQIVDKEMRICL*KLEPCIFLICVDNQA*ISH 351 KK RLQ++D+EMR+CL KL+P I IC Q+ SH Sbjct: 53 KKRERLQMIDEEMRVCLSKLDPLIDFICSQKQSQCSH 89 HSP 2 Score: 38.1206 bits (87), Expect = 2.741e-6 Identity = 25/54 (46.30%), Postives = 33/54 (61.11%), Query Frame = -3 Query: 345 KRIFNKKEQSEF*IFL-------SSREIVLLLTFKSSYLYEQGFSAPTETK*KK 485 +++F +KE SEF + L S++ + LL F SSYL EQGFS TE K KK Sbjct: 1 RKLFAEKELSEFWLCLNTKFPKLSNKAVESLLPFGSSYLCEQGFSTLTEMKSKK 54
BLAST of SMED30030912 vs. Planmine SMEST
Match: SMESG000024543.1 (SMESG000024543.1) HSP 1 Score: 40.817 bits (94), Expect = 5.818e-9 Identity = 27/60 (45.00%), Postives = 35/60 (58.33%), Query Frame = -3 Query: 342 NDTVFKRIFNKKEQSEF*IFL-------SSREIVLLLTFKSSYLYEQGFSAPTETK*KKA 500 ND +FKR+ ++ + SEF + L S++ I LL F SSYL E GFSA E K KK Sbjct: 292 NDLIFKRMCSEMKLSEFLLSLNNKSFQLSNKAIEPLLPFGSSYLCEHGFSALKEMKSKKP 351 HSP 2 Score: 36.5798 bits (83), Expect = 5.818e-9 Identity = 17/28 (60.71%), Postives = 23/28 (82.14%), Query Frame = -2 Query: 268 KKSVRLQIVDKEMRICL*KLEPCIFLIC 351 KK RL+++D+EMR+CL K+EP I LIC Sbjct: 349 KKPERLRMIDEEMRVCLSKIEPRINLIC 376
BLAST of SMED30030912 vs. Planmine SMEST
Match: SMESG000023009.1 (SMESG000023009.1) HSP 1 Score: 51.2174 bits (121), Expect = 2.776e-8 Identity = 41/97 (42.27%), Postives = 56/97 (57.73%), Query Frame = -3 Query: 345 KIFQKLDDTEME*IVNHFF------XXXXXXXXXXXXKNDTVFKRIFNKKEQSEF*IFL-------SSREIVLLLTFKSSYLYEQGFSAPTETK*KK 596 K F LD +++E I+N F + ++ LKND +FKR+F++ E SEF + L S++ I LLL F+SSYL E GFSA TE K KK Sbjct: 52 KYFTHLDVSDIEMILNPFMNFNVTNLEEEEEEQLIDLKNDLIFKRMFSEMELSEFWLSLNNKYPQLSNKAIELLLPFRSSYLCEHGFSALTEMKSKK 148
BLAST of SMED30030912 vs. Planmine SMEST
Match: SMESG000030482.1 (SMESG000030482.1) HSP 1 Score: 44.669 bits (104), Expect = 8.553e-6 Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = -2 Query: 241 FLPL-RARIFGTHRNEVKKSVRLQIVDKEMRICL*KLEPCIFLICVDNQA*ISH 399 LP RA IF ++ KK RL+++++EMR+CL K+EPCI LIC Q+ SH Sbjct: 117 LLPFERAWIFTKMKS--KKRERLRMIEEEMRVCLSKIEPCINLICDTKQSQRSH 168 The following BLAST results are available for this feature:
BLAST of SMED30030912 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30030912 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30030912 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30030912 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30030912 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30030912 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30030912 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30030912 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 4
BLAST of SMED30030912 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30030912 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30030912 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30030912 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30030912 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30030912 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 3
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30030912 ID=SMED30030912|Name=SMED30030912|organism=Schmidtea mediterranea sexual|type=transcript|length=604bpback to top Annotated Terms
The following terms have been associated with this transcript:
|