Inositol polyphosphate 5-phosphatase

Overview
NameInositol polyphosphate 5-phosphatase
Smed IDSMED30030895
Length (bp)2120
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Inositol polyphosphate 5-phosphatase (SMED30030895) t-SNE clustered cells

Violin plots show distribution of expression levels for Inositol polyphosphate 5-phosphatase (SMED30030895) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Inositol polyphosphate 5-phosphatase (SMED30030895) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Inositol polyphosphate 5-phosphatase (SMED30030895) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Human
Match: INPP5E (inositol polyphosphate-5-phosphatase E [Source:HGNC Symbol;Acc:HGNC:21474])

HSP 1 Score: 103.99 bits (258), Expect = 2.019e-22
Identity = 73/241 (30.29%), Postives = 117/241 (48.55%), Query Frame = 2
Query:  794 DLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITT--ITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDY----QLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDELI 1498
            +L +  P +   + V TWNM  + + P +  EF+         DL +   QE   +R E  TR+Q  +G +YV+     +  +Y+ L   +  IW       + S +    ++TRI +   TKG   +SF FFGTS LF+ SH +    GD GK   RL DY    Q ++  +++ +     +N     + +++  FD  FW GDFNFRL+     V  ++ Q     + +  LL+HD+LI
Sbjct:  289 ELARYFPDRNVALFVATWNMQGQKELPPSLDEFLLPAEADYAQDLYVIGVQEGCSDRREWETRLQETLGPHYVLLSSAAHGVLYMSLFIRRDLIW-------FCSEVECSTVTTRIVSQIKTKGALGISFTFFGTSFLFITSHFT---SGD-GKVAERLLDYTRTVQALVLPRNVPD-----TNPYRSSAADVTTRFDEVFWFGDFNFRLSGGRTVVDALLCQ--GLVVDVPALLQHDQLI 511          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Human
Match: POGK (pogo transposable element derived with KRAB domain [Source:HGNC Symbol;Acc:HGNC:18800])

HSP 1 Score: 65.0846 bits (157), Expect = 3.154e-10
Identity = 41/163 (25.15%), Postives = 74/163 (45.40%), Query Frame = -1
Query: 1563 CYCSQWMNHETLEIWLKKVWKSRITLPPKTPWNQDPKVPSLLLFDMHRSH----------------LVSTAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYENIKHTKSGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA-----FGEDDDVL-EIE 1985
            C+   WM  + ++ WL+ VW+ R            PK   +L+ +  R H                ++   GLTS++Q LD+ V +     +R ++ +W++    N+  + +GN K        EW++ +W  ++  +I+ GF+         E+DDVL EIE
Sbjct:  435 CHRYGWMTEDLMQDWLEVVWRRRT--------GAVPKQRGMLILNGFRGHATDSVKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAG--NLALSPTGNAKKPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLEEEDDVLWEIE 587          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Human
Match: POGK (pogo transposable element derived with KRAB domain [Source:HGNC Symbol;Acc:HGNC:18800])

HSP 1 Score: 65.0846 bits (157), Expect = 3.154e-10
Identity = 41/163 (25.15%), Postives = 74/163 (45.40%), Query Frame = -1
Query: 1563 CYCSQWMNHETLEIWLKKVWKSRITLPPKTPWNQDPKVPSLLLFDMHRSH----------------LVSTAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYENIKHTKSGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA-----FGEDDDVL-EIE 1985
            C+   WM  + ++ WL+ VW+ R            PK   +L+ +  R H                ++   GLTS++Q LD+ V +     +R ++ +W++    N+  + +GN K        EW++ +W  ++  +I+ GF+         E+DDVL EIE
Sbjct:  435 CHRYGWMTEDLMQDWLEVVWRRRT--------GAVPKQRGMLILNGFRGHATDSVKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAG--NLALSPTGNAKKPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLEEEDDVLWEIE 587          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Fly
Match: INPP5E (gene:FBgn0036273 transcript:FBtr0333356)

HSP 1 Score: 84.7297 bits (208), Expect = 1.316e-16
Identity = 57/207 (27.54%), Postives = 102/207 (49.28%), Query Frame = 2
Query:  794 DLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITTI--TKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLN 1408
            +L +++P+K   + V TWNM   +  P+   +F+   N   + D+++   QE+  +R E    IQ  +G ++V++       +++ +   +  IW       + S      +S R  +   TKG  A+SF  FGTS+LF+ SHL+  +     K   R+ D + I+ + DL  +L    ++    + +++  FD  FW GD NFRL 
Sbjct:  381 ELSRVLPQKEITVFVGTWNMNGHSP-PKQLNDFVLPANVEHVPDIVVMGTQESTPDRFEWEVTIQETLGPSHVLFHATTLGTLHLAVYMRRDLIW-------YCSVPEDASMSVRTGSAFRTKGAVAISFCLFGTSMLFVTSHLTAHQQ----KVKERVSDVKRIINALDLPRNLPNQRHK----NKDVTQNFDNVFWCGDLNFRLG 571          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Fly
Match: INPP5E (gene:FBgn0036273 transcript:FBtr0076007)

HSP 1 Score: 84.7297 bits (208), Expect = 1.316e-16
Identity = 57/207 (27.54%), Postives = 102/207 (49.28%), Query Frame = 2
Query:  794 DLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITTI--TKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLN 1408
            +L +++P+K   + V TWNM   +  P+   +F+   N   + D+++   QE+  +R E    IQ  +G ++V++       +++ +   +  IW       + S      +S R  +   TKG  A+SF  FGTS+LF+ SHL+  +     K   R+ D + I+ + DL  +L    ++    + +++  FD  FW GD NFRL 
Sbjct:  381 ELSRVLPQKEITVFVGTWNMNGHSP-PKQLNDFVLPANVEHVPDIVVMGTQESTPDRFEWEVTIQETLGPSHVLFHATTLGTLHLAVYMRRDLIW-------YCSVPEDASMSVRTGSAFRTKGAVAISFCLFGTSMLFVTSHLTAHQQ----KVKERVSDVKRIINALDLPRNLPNQRHK----NKDVTQNFDNVFWCGDLNFRLG 571          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Zebrafish
Match: inpp5e (inositol polyphosphate-5-phosphatase E [Source:ZFIN;Acc:ZDB-GENE-050809-23])

HSP 1 Score: 96.2857 bits (238), Expect = 9.651e-21
Identity = 69/237 (29.11%), Postives = 114/237 (48.10%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITT--ITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            ++L +  P++   I + TWNM  +   P N  + +   +     D+ +   QE   +R E   R+Q  +G  YV+     +  +Y+ +   +  IW       + S +    ++TRI +   TKG   + F FFGTS LF+ SH +    GD  K   R+ DY  I+ +  L  +L   +N     +++++  FD  FW GDFNFRLN     V  I++Q     + +  LL+HD+L
Sbjct:   46 EELDRYFPERRLGIYIATWNMQGEKGLPYNLDDLLLPTDTDFAQDVYVIGVQEGCPDRREWEIRLQETLGPYYVMLYAAAHGVLYLTVFVRRDLIW-------FCSEVEHATVTTRIISQIKTKGAVGIGFTFFGTSFLFVTSHFT---SGD-SKVYERILDYNKIIEALALPRNLPD-TNPYRSTTSDVTTRFDEVFWFGDFNFRLNKARGDVEAILNQ--GVGVDMSPLLQHDQL 268          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Zebrafish
Match: inpp5e (inositol polyphosphate-5-phosphatase E [Source:ZFIN;Acc:ZDB-GENE-050809-23])

HSP 1 Score: 94.7449 bits (234), Expect = 8.859e-20
Identity = 69/237 (29.11%), Postives = 114/237 (48.10%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITT--ITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            ++L +  P++   I + TWNM  +   P N  + +   +     D+ +   QE   +R E   R+Q  +G  YV+     +  +Y+ +   +  IW       + S +    ++TRI +   TKG   + F FFGTS LF+ SH +    GD  K   R+ DY  I+ +  L  +L   +N     +++++  FD  FW GDFNFRLN     V  I++Q     + +  LL+HD+L
Sbjct:  227 EELDRYFPERRLGIYIATWNMQGEKGLPYNLDDLLLPTDTDFAQDVYVIGVQEGCPDRREWEIRLQETLGPYYVMLYAAAHGVLYLTVFVRRDLIW-------FCSEVEHATVTTRIISQIKTKGAVGIGFTFFGTSFLFVTSHFT---SGD-SKVYERILDYNKIIEALALPRNLPD-TNPYRSTTSDVTTRFDEVFWFGDFNFRLNKARGDVEAILNQ--GVGVDMSPLLQHDQL 449          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Zebrafish
Match: CR352209.1 (pep chromosome:GRCz11:24:26088143:26089609:1 gene:ENSDARG00000103972.2 transcript:ENSDART00000171129.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR352209.1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.361e-18
Identity = 52/141 (36.88%), Postives = 74/141 (52.48%), Query Frame = -1
Query: 1596 WMNHETLEIWLKKVWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVST----------------AGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYENIKHTKSGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA 1970
            WM+ E +  WL++V+  R       P       PSLL+ D  R+HL++T                 GLT ++QPLD+ VNR+FK KLR  WE W+  D E+   TK+G  + A + TI EWIV +W  V+  T++  F  A
Sbjct:  246 WMDEEKMNEWLREVYVKR-------PDGFFHTSPSLLICDSMRAHLIATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMT-DGEHT-FTKTGRQRRASYATICEWIVDAWAKVSALTVVRAFAKA 377          

HSP 2 Score: 28.1054 bits (61), Expect = 1.361e-18
Identity = 21/50 (42.00%), Postives = 24/50 (48.00%), Query Frame = -2
Query: 1970 IKTTGHEKKQFTVNL-CSQRWY*TSAFVILGTKKHPKTFIPESKFVIAAN 2116
            I+TTGHEK  FTV L C          VI   K  PK   P +  +I AN
Sbjct:  194 IRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKTLPKEKFP-AGIIIKAN 242          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Zebrafish
Match: CR354398.1 (pep chromosome:GRCz11:7:64150332:64152087:-1 gene:ENSDARG00000101994.2 transcript:ENSDART00000165234.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR354398.1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.865e-18
Identity = 52/141 (36.88%), Postives = 73/141 (51.77%), Query Frame = -1
Query: 1596 WMNHETLEIWLKKVWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVST----------------AGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYENIKHTKSGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA 1970
            WM+ E +  WL++V+  R       P       PSLL+ D  R+HL +T                 GLT ++QPLD+ VNR+FK KLR  WE W+  D E+   TK+G  + A + TI EWIV +W  V+  T++  F  A
Sbjct:  246 WMDEEKMNEWLREVYVKR-------PDGFFHTSPSLLICDSMRAHLTATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMT-DGEHT-FTKTGRQRRASYATICEWIVDAWAKVSALTVVRAFAKA 377          

HSP 2 Score: 27.7202 bits (60), Expect = 2.865e-18
Identity = 21/50 (42.00%), Postives = 24/50 (48.00%), Query Frame = -2
Query: 1970 IKTTGHEKKQFTVNL-CSQRWY*TSAFVILGTKKHPKTFIPESKFVIAAN 2116
            I+TTGHEK  FTV L C          VI   K  PK   P +  +I AN
Sbjct:  194 IRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKTLPKEKFP-AGVIIKAN 242          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Zebrafish
Match: BX914205.2 (pep chromosome:GRCz11:4:64121772:64123545:-1 gene:ENSDARG00000099590.2 transcript:ENSDART00000170040.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX914205.2)

HSP 1 Score: 84.3445 bits (207), Expect = 3.271e-18
Identity = 52/141 (36.88%), Postives = 73/141 (51.77%), Query Frame = -1
Query: 1596 WMNHETLEIWLKKVWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVST----------------AGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYENIKHTKSGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA 1970
            WM+ E +  WL++V+  R       P       PSLL+ D  R+HL +T                 GLT ++QPLD+ VNR+FK KLR  WE W+  D E+   TK+G  + A + TI EWIV +W  V+  T++  F  A
Sbjct:  246 WMDEEKMNEWLREVYVKR-------PDGFFHTSPSLLICDSMRAHLTATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMT-DGEHT-FTKTGRQRRASYATICEWIVDAWAKVSALTVVRAFAKA 377          

HSP 2 Score: 27.7202 bits (60), Expect = 3.271e-18
Identity = 21/50 (42.00%), Postives = 24/50 (48.00%), Query Frame = -2
Query: 1970 IKTTGHEKKQFTVNL-CSQRWY*TSAFVILGTKKHPKTFIPESKFVIAAN 2116
            I+TTGHEK  FTV L C          VI   K  PK   P +  +I AN
Sbjct:  194 IRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKTLPKEKFP-AGVIIKAN 242          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Xenopus
Match: adamts2 (ADAM metallopeptidase with thrombospondin type 1 motif 2 [Source:Xenbase;Acc:XB-GENE-492342])

HSP 1 Score: 117.087 bits (292), Expect = 2.854e-27
Identity = 74/237 (31.22%), Postives = 123/237 (51.90%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITTI--TKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            ++L Q +P+K  RI + TWNM EK D PE   +F+  +      DL +   QE   NR E   R+Q  +G  YV+     +  +Y+ L   +  +W       + S +    ++TR   +  TKG  A SF FFGTS LF+ +H +    GD  K   R+++Y+ I+    L +++   +N +  + ++++  FD  FW GDFNFRL+    +V  I+  E+     + +LL++D+L
Sbjct:  121 EELQQHLPQKNLRIFIATWNMNEKKDLPERLDDFLFPLGAESAQDLYVIGVQEGCPNRQEWQNRLQLTLGHRYVLLHSAAHGVLYLSLFIRRDLVW-------FCSEVECATVTTRFFPMIKTKGAVAASFTFFGTSFLFINAHFA---AGD-SKVKQRIQNYEKIIKDLQLPKNVPD-TNPVYSDPDDVTSRFDEVFWFGDFNFRLSKSRREVDSIL--ENLPENDMRSLLQYDQL 343          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Xenopus
Match: ENSXETT00000014594.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:33575681:33578222:-1 gene:ENSXETG00000003843.1 transcript:ENSXETT00000014594.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.227 bits (269), Expect = 1.046e-24
Identity = 76/237 (32.07%), Postives = 114/237 (48.10%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITTI--TKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            K+L Q +P+K  RI + TWNM EK D PE   +F+  +      DL +   QE   NR E   R+Q  +G  YV+     +  +Y+ L   +  +W       + S +    ++TR   +  TKG  A SF FFGTS LF+ +H +    GD  K   R+++Y+ I+  KDL                     FD  FW GDFNFRL+    +V  I+  E+     + +LL++D+L
Sbjct:    8 KELQQHLPQKNLRIFIATWNMNEKKDLPERLDDFLFPLGAESAQDLYVIGVQEGCPNRQEWQNRLQLTLGHRYVLLHSAAHGVLYLSLFIRRDLVW-------FCSEVECATVTTRFFPLIKTKGAVAASFTFFGTSFLFINAHFA---AGD-SKVKQRIQNYEKII--KDL-------------------HRFDEVFWFGDFNFRLSKSRSEVDSIL--ENLPENDMSSLLQYDQL 210          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Xenopus
Match: ENSXETT00000001567.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:24962963:24965748:-1 gene:ENSXETG00000000833.1 transcript:ENSXETT00000001567.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 2.833e-24
Identity = 72/237 (30.38%), Postives = 119/237 (50.21%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITTI--TKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            ++L + +P+K  RI + TWNM  K D PE   +F+  +      DL +   QE    R E   R+Q  +G  YV+     +  +Y+ L   +   W       + S +    ++TR   +  TKG  A SF FFGTS LF+ +H +    GD  K   R+++Y+ I+    L +++   +N I  + ++ +  FD  FW GDFNFRL+    +V  I+  E+     + +LL++D+L
Sbjct:   37 EELQRHLPQKNLRIFIATWNMNGKKDLPERLDDFLFPLGAESAQDLYVIGVQEGCPYRQEWQYRLQLTLGHRYVLLHSAAHGVLYLSLFIRRDLAW-------FCSEVEYATVTTRFFPMIKTKGAVAASFTFFGTSFLFINAHFA---AGD-SKVKQRIQNYEKIIKDLQLPKNVPD-TNPIYSDPDDATSRFDEVFWFGDFNFRLSKSRSEVDSIL--ENLPENDMRSLLQYDQL 259          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Xenopus
Match: clpx (caseinolytic mitochondrial matrix peptidase chaperone subunit [Source:Xenbase;Acc:XB-GENE-991453])

HSP 1 Score: 108.227 bits (269), Expect = 4.816e-24
Identity = 75/246 (30.49%), Postives = 127/246 (51.63%), Query Frame = 2
Query:  767 VVNRG*IRKDLLQL-IPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITTI--TKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            +V +G + +D L+  +P+K  RI + TWNM  K D PE   +F+  +      DL +   QE   NR E   R++  +G  YV+     +  +Y+ L   +   W       + S +    ++TR   +  TKG  A SF FFGTS LF+ +H +    GD  K   R+++Y+ I+ +  L ++++  +N I  + ++ +  FD  FW GDFNFRL+    +V  I+  E+     + +LL++D+L
Sbjct:  175 LVGQGLLGEDELERHLPQKNLRIFIATWNMNGKKDLPERLDDFLFPLGAESAQDLYVIGVQEGCPNRQEWEYRLKLTLGHRYVLLHSAAHGVLYLSLFIRRDLAW-------FCSEVECSTVTTRFFPMIKTKGALAASFTFFGTSFLFINAHFA---AGD-SKVKQRIQNYEKIIKNLQLPKNVSD-TNPIYSDPDDATSRFDEVFWFGDFNFRLSKSRSEVDSIL--ENLPENDMRSLLQYDQL 406          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Xenopus
Match: maco1 (macoilin 1 [Source:Xenbase;Acc:XB-GENE-5804807])

HSP 1 Score: 102.064 bits (253), Expect = 1.029e-22
Identity = 68/236 (28.81%), Postives = 118/236 (50.00%), Query Frame = 2
Query:  794 DLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITTI--TKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            +L Q + +++ RI + TWNM  + D P+   +F+         DL +   QE   NR +  +R+Q  +G  YV+     +  +Y+ L   +  +        + S      ++TR   +  TKG  AVSF FFGTS LF+ SH +    GD  K   R+++Y+ I+    L + + + +N      ++++  FD  FW GDFNFRL+    ++  I+  E+     + +LL++D+L
Sbjct:   13 ELKQRLAQRSLRIFIATWNMNGQKDLPDRLDDFLFPSGAEAAQDLYVIGTQEGCPNRRQFESRLQRTLGHGYVLLHSAAHGVLYLSLFMRRDLVQ-------FCSEAESAKVTTRFFPMIKTKGALAVSFTFFGTSFLFISSHFA---AGD-SKVKKRIQNYEKIIKDLKLPKKVPL-TNPNCSHPDDVTSRFDEVFWFGDFNFRLSKSRTEMNSIL--ENIPQNDVSSLLQYDQL 234          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Mouse
Match: Inpp5e (inositol polyphosphate-5-phosphatase E [Source:MGI Symbol;Acc:MGI:1927753])

HSP 1 Score: 108.612 bits (270), Expect = 3.582e-24
Identity = 74/238 (31.09%), Postives = 115/238 (48.32%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITT--ITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDELI 1498
            ++L +  P +   + V TWNM  + + P +  EF+         DL +   QE   +R E  TR+Q  +G  YV+     +  +Y+ L   +  IW       + S +    ++TRI +   TKG   VSF FFGTS LF+ SH +    GD GK   RL DY   + +  L  ++   +N     + +++  FD  FW GDFNFRL+   V V   + Q+    + +  LL+HD+L 
Sbjct:  291 EELARYFPDRNMALFVATWNMQGQKELPASLDEFLLPTEADYTQDLYVIGIQEGCSDRREWETRLQETLGPQYVLLSSAAHGVLYMSLFIRRDLIW-------FCSEVEYSTVTTRIVSQIKTKGALGVSFTFFGTSFLFITSHFT---SGD-GKVAERLLDYSRTIQALALPRNVP-DTNPYRSSAGDVTTRFDEVFWFGDFNFRLSGGRVAVEAFLKQK--PEVDVLALLQHDQLT 514          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Mouse
Match: Inpp5e (inositol polyphosphate-5-phosphatase E [Source:MGI Symbol;Acc:MGI:1927753])

HSP 1 Score: 108.612 bits (270), Expect = 5.119e-24
Identity = 74/237 (31.22%), Postives = 115/237 (48.52%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITT--ITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            ++L +  P +   + V TWNM  + + P +  EF+         DL +   QE   +R E  TR+Q  +G  YV+     +  +Y+ L   +  IW       + S +    ++TRI +   TKG   VSF FFGTS LF+ SH +    GD GK   RL DY   + +  L  ++   +N     + +++  FD  FW GDFNFRL+   V V   + Q+    + +  LL+HD+L
Sbjct:  291 EELARYFPDRNMALFVATWNMQGQKELPASLDEFLLPTEADYTQDLYVIGIQEGCSDRREWETRLQETLGPQYVLLSSAAHGVLYMSLFIRRDLIW-------FCSEVEYSTVTTRIVSQIKTKGALGVSFTFFGTSFLFITSHFT---SGD-GKVAERLLDYSRTIQALALPRNVP-DTNPYRSSAGDVTTRFDEVFWFGDFNFRLSGGRVAVEAFLKQK--PEVDVLALLQHDQL 513          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Mouse
Match: Inpp5e (inositol polyphosphate-5-phosphatase E [Source:MGI Symbol;Acc:MGI:1927753])

HSP 1 Score: 80.1073 bits (196), Expect = 1.165e-16
Identity = 66/238 (27.73%), Postives = 99/238 (41.60%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWF-SAIGKKVISTRITT--ITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            ++L +  P +   + V TWNM  + + P +  EF+         DL +   QE   +R                                            IWF S +    ++TRI +   TKG   VSF FFGTS LF+ SH +    GD GK   RL DY   + +  L  ++   +N     + +++  FD  FW GDFNFRL+   V V   + Q+    + +  LL+HD+L
Sbjct:   12 EELARYFPDRNMALFVATWNMQGQKELPASLDEFLLPTEADYTQDLYVIGIQEGCSDR------------------------------------------DLIWFCSEVEYSTVTTRIVSQIKTKGALGVSFTFFGTSFLFITSHFTS---GD-GKVAERLLDYSRTIQALALPRNVPD-TNPYRSSAGDVTTRFDEVFWFGDFNFRLSGGRVAVEAFLKQK--PEVDVLALLQHDQL 200          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 62.7734 bits (151), Expect = 1.127e-9
Identity = 34/144 (23.61%), Postives = 65/144 (45.14%), Query Frame = -1
Query: 1602 CYCSQWMNHETLEIWLKKVWKSRITLPPKTPWNQDPKVPSLLLFDMHRSH----------------LVSTAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYENIKHTKSGNMKAADWNTIFEWIVSSWEDVNLSTILNGFR 1985
            C+   WM  + ++ WL+ VW+ R            P+   +L+ +  R H                ++   GLTS++Q LD+ V +     +R ++ +W++    N+  + +GN K        EWI+ +W  ++  +I+ GFR
Sbjct:  454 CHRYGWMTEDLMQDWLEVVWRRRT--------GAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAG--NLALSPTGNAKKPPLGLFLEWIMVAWNSISSESIVQGFR 587          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 62.7734 bits (151), Expect = 1.127e-9
Identity = 34/144 (23.61%), Postives = 65/144 (45.14%), Query Frame = -1
Query: 1602 CYCSQWMNHETLEIWLKKVWKSRITLPPKTPWNQDPKVPSLLLFDMHRSH----------------LVSTAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYENIKHTKSGNMKAADWNTIFEWIVSSWEDVNLSTILNGFR 1985
            C+   WM  + ++ WL+ VW+ R            P+   +L+ +  R H                ++   GLTS++Q LD+ V +     +R ++ +W++    N+  + +GN K        EWI+ +W  ++  +I+ GFR
Sbjct:  454 CHRYGWMTEDLMQDWLEVVWRRRT--------GAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAG--NLALSPTGNAKKPPLGLFLEWIMVAWNSISSESIVQGFR 587          
BLAST of Inositol polyphosphate 5-phosphatase vs. UniProt/SwissProt
Match: sp|Q9JII1|INP5E_MOUSE (Phosphatidylinositol polyphosphate 5-phosphatase type IV OS=Mus musculus OX=10090 GN=Inpp5e PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.581e-23
Identity = 74/237 (31.22%), Postives = 115/237 (48.52%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITT--ITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            ++L +  P +   + V TWNM  + + P +  EF+         DL +   QE   +R E  TR+Q  +G  YV+     +  +Y+ L   +  IW       + S +    ++TRI +   TKG   VSF FFGTS LF+ SH +    GD GK   RL DY   + +  L  ++   +N     + +++  FD  FW GDFNFRL+   V V   + Q+    + +  LL+HD+L
Sbjct:  291 EELARYFPDRNMALFVATWNMQGQKELPASLDEFLLPTEADYTQDLYVIGIQEGCSDRREWETRLQETLGPQYVLLSSAAHGVLYMSLFIRRDLIW-------FCSEVEYSTVTTRIVSQIKTKGALGVSFTFFGTSFLFITSHFT---SGD-GKVAERLLDYSRTIQALALPRNVP-DTNPYRSSAGDVTTRFDEVFWFGDFNFRLSGGRVAVEAFLKQK--PEVDVLALLQHDQL 513          
BLAST of Inositol polyphosphate 5-phosphatase vs. UniProt/SwissProt
Match: sp|Q9WVR1|INP5E_RAT (Phosphatidylinositol polyphosphate 5-phosphatase type IV OS=Rattus norvegicus OX=10116 GN=Inpp5e PE=1 SV=3)

HSP 1 Score: 107.842 bits (268), Expect = 5.246e-23
Identity = 74/236 (31.36%), Postives = 114/236 (48.31%), Query Frame = 2
Query:  794 DLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITT--ITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            +L +  P +   + V TWNM  + + P +  EF+         DL +   QE   +R E  TR+Q  +G  YV+     +  +Y+ L   +  IW       + S +    ++TRI +   TKG   VSF FFGTS LF+ SH +    GD GK   RL DY   + +  L  ++   +N     + +++  FD  FW GDFNFRL+   V V   + Q+    + +  LL+HD+L
Sbjct:  293 ELARYFPDRNMALFVATWNMQGQKELPASLDEFLLPTEADYTQDLYVIGVQEGCSDRREWETRLQETLGPQYVLLSSAAHGVLYMSLFIRRDLIW-------FCSEVEYSTVTTRIVSQIKTKGALGVSFTFFGTSFLFITSHFT---SGD-GKVAERLLDYNRTIQALALPRNVP-DTNPYRSSAGDVTTRFDEVFWFGDFNFRLSGGRVAVEAFLKQD--PEVDVLALLQHDQL 514          
BLAST of Inositol polyphosphate 5-phosphatase vs. UniProt/SwissProt
Match: sp|A0FI79|INP5E_PANTR (Phosphatidylinositol polyphosphate 5-phosphatase type IV OS=Pan troglodytes OX=9598 GN=INPP5E PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 5.774e-22
Identity = 73/237 (30.80%), Postives = 115/237 (48.52%), Query Frame = 2
Query:  794 DLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITT--ITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDELI 1498
            +L +  P +   + V TWNM  + + P +  EF+         DL +   QE   +R E  TR+Q  +G +YV+     +  +Y+ L   +  IW       + S +    ++TRI +   TKG   +SF FFGTS LF+ SH +    GD GK   RL DY   + +  L  ++   +N     + +++  FD  FW GDFNFRL+     V  ++ Q     + +  LL+HD+LI
Sbjct:  289 ELARYFPDRNVALFVATWNMQGQKELPPSLDEFLLPAEADYAQDLYVIGVQEGCSDRREWETRLQETLGPHYVLLSSAAHGVLYMSLFIRRDLIW-------FCSEVECSTVTTRIVSQIKTKGALGISFTFFGTSFLFITSHFT---SGD-GKVAERLLDYTRTVQALALPRNVPD-TNPYRSSAADVTTRFDEVFWFGDFNFRLSGGRTVVDALLCQ--GLVVDVPALLQHDQLI 511          
BLAST of Inositol polyphosphate 5-phosphatase vs. UniProt/SwissProt
Match: sp|Q9NRR6|INP5E_HUMAN (Phosphatidylinositol polyphosphate 5-phosphatase type IV OS=Homo sapiens OX=9606 GN=INPP5E PE=1 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 9.697e-22
Identity = 73/241 (30.29%), Postives = 117/241 (48.55%), Query Frame = 2
Query:  794 DLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITT--ITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDY----QLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDELI 1498
            +L +  P +   + V TWNM  + + P +  EF+         DL +   QE   +R E  TR+Q  +G +YV+     +  +Y+ L   +  IW       + S +    ++TRI +   TKG   +SF FFGTS LF+ SH +    GD GK   RL DY    Q ++  +++ +     +N     + +++  FD  FW GDFNFRL+     V  ++ Q     + +  LL+HD+LI
Sbjct:  289 ELARYFPDRNVALFVATWNMQGQKELPPSLDEFLLPAEADYAQDLYVIGVQEGCSDRREWETRLQETLGPHYVLLSSAAHGVLYMSLFIRRDLIW-------FCSEVECSTVTTRIVSQIKTKGALGISFTFFGTSFLFITSHFT---SGD-GKVAERLLDYTRTVQALVLPRNVPD-----TNPYRSSAADVTTRFDEVFWFGDFNFRLSGGRTVVDALLCQ--GLVVDVPALLQHDQLI 511          
BLAST of Inositol polyphosphate 5-phosphatase vs. UniProt/SwissProt
Match: sp|Q9VTW2|INP5E_DROME (Inositol polyphosphate 5-phosphatase E OS=Drosophila melanogaster OX=7227 GN=INPP5E PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.319e-15
Identity = 57/207 (27.54%), Postives = 102/207 (49.28%), Query Frame = 2
Query:  794 DLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITTI--TKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLN 1408
            +L +++P+K   + V TWNM   +  P+   +F+   N   + D+++   QE+  +R E    IQ  +G ++V++       +++ +   +  IW       + S      +S R  +   TKG  A+SF  FGTS+LF+ SHL+  +     K   R+ D + I+ + DL  +L    ++    + +++  FD  FW GD NFRL 
Sbjct:  381 ELSRVLPQKEITVFVGTWNMNGHSP-PKQLNDFVLPANVEHVPDIVVMGTQESTPDRFEWEVTIQETLGPSHVLFHATTLGTLHLAVYMRRDLIW-------YCSVPEDASMSVRTGSAFRTKGAVAISFCLFGTSMLFVTSHLTAHQQ----KVKERVSDVKRIINALDLPRNLPNQRHK----NKDVTQNFDNVFWCGDLNFRLG 571          
BLAST of Inositol polyphosphate 5-phosphatase vs. TrEMBL
Match: A0A4S2L402 (IPPc domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010484 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.400e-24
Identity = 71/243 (29.22%), Postives = 124/243 (51.03%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTD--FPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKV-ISTRITTITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDELINGQI 1510
            K+L ++ P K   + ++TWNMA +    +P++  +  + I   E   +   C QE + +++ELL R+Q+++G  +V++             G    +  +    IW++++ +   I+TR    TKG AA+ F  FGTS+LF+ SH       + G  DLR+ DY+ ++ S +L +           +  +  D FD  FWAGD NFR+     +V  ++  E   S+  E+LL  DEL++ Q+
Sbjct:    5 KELTRIFPAKMVGVHIVTWNMASQKSQKYPDDLTDLCYPIPTCESAGIFAICIQEVSPDKNELLIRLQASLGPRHVLFS--------YAFQGTLGLLIFLSRDLIWYTSVPQSTGITTRANIRTKGAAAICFILFGTSLLFVSSHFK----ANAGNLDLRINDYKEVVRSLNLPK--VGLERGYHQKDKSTLDRFDAVFWAGDLNFRIRKTRRQVESMLRTERKSSV-FEHLLNFDELVSTQL 232          
BLAST of Inositol polyphosphate 5-phosphatase vs. TrEMBL
Match: A0A4S2KY43 (IPPc domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010484 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.943e-24
Identity = 71/243 (29.22%), Postives = 124/243 (51.03%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTD--FPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKV-ISTRITTITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDELINGQI 1510
            K+L ++ P K   + ++TWNMA +    +P++  +  + I   E   +   C QE + +++ELL R+Q+++G  +V++             G    +  +    IW++++ +   I+TR    TKG AA+ F  FGTS+LF+ SH       + G  DLR+ DY+ ++ S +L +           +  +  D FD  FWAGD NFR+     +V  ++  E   S+  E+LL  DEL++ Q+
Sbjct:   74 KELTRIFPAKMVGVHIVTWNMASQKSQKYPDDLTDLCYPIPTCESAGIFAICIQEVSPDKNELLIRLQASLGPRHVLFS--------YAFQGTLGLLIFLSRDLIWYTSVPQSTGITTRANIRTKGAAAICFILFGTSLLFVSSHFK----ANAGNLDLRINDYKEVVRSLNLPK--VGLERGYHQKDKSTLDRFDAVFWAGDLNFRIRKTRRQVESMLRTERKSSV-FEHLLNFDELVSTQL 301          
BLAST of Inositol polyphosphate 5-phosphatase vs. TrEMBL
Match: A0A5G3HGV0 (ADAM metallopeptidase with thrombospondin type 1 motif 2 OS=Xenopus tropicalis OX=8364 GN=adamts2 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 4.481e-24
Identity = 74/237 (31.22%), Postives = 123/237 (51.90%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITTI--TKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            ++L Q +P+K  RI + TWNM EK D PE   +F+  +      DL +   QE   NR E   R+Q  +G  YV+     +  +Y+ L   +  +W       + S +    ++TR   +  TKG  A SF FFGTS LF+ +H +    GD  K   R+++Y+ I+    L +++   +N +  + ++++  FD  FW GDFNFRL+    +V  I+  E+     + +LL++D+L
Sbjct:  121 EELQQHLPQKNLRIFIATWNMNEKKDLPERLDDFLFPLGAESAQDLYVIGVQEGCPNRQEWQNRLQLTLGHRYVLLHSAAHGVLYLSLFIRRDLVW-------FCSEVECATVTTRFFPMIKTKGAVAASFTFFGTSFLFINAHFA---AGD-SKVKQRIQNYEKIIKDLQLPKNVPD-TNPVYSDPDDVTSRFDEVFWFGDFNFRLSKSRREVDSIL--ENLPENDMRSLLQYDQL 343          
BLAST of Inositol polyphosphate 5-phosphatase vs. TrEMBL
Match: A0A4S2KZD0 (IPPc domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010484 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 5.182e-24
Identity = 71/243 (29.22%), Postives = 124/243 (51.03%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTD--FPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKV-ISTRITTITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDELINGQI 1510
            K+L ++ P K   + ++TWNMA +    +P++  +  + I   E   +   C QE + +++ELL R+Q+++G  +V++             G    +  +    IW++++ +   I+TR    TKG AA+ F  FGTS+LF+ SH       + G  DLR+ DY+ ++ S +L +           +  +  D FD  FWAGD NFR+     +V  ++  E   S+  E+LL  DEL++ Q+
Sbjct:   74 KELTRIFPAKMVGVHIVTWNMASQKSQKYPDDLTDLCYPIPTCESAGIFAICIQEVSPDKNELLIRLQASLGPRHVLFS--------YAFQGTLGLLIFLSRDLIWYTSVPQSTGITTRANIRTKGAAAICFILFGTSLLFVSSHFK----ANAGNLDLRINDYKEVVRSLNLPK--VGLERGYHQKDKSTLDRFDAVFWAGDLNFRIRKTRRQVESMLRTERKSSV-FEHLLNFDELVSTQL 301          
BLAST of Inositol polyphosphate 5-phosphatase vs. TrEMBL
Match: A0A5K4FEW4 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 2.288e-23
Identity = 77/255 (30.20%), Postives = 132/255 (51.76%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNM-AEKTDF-PENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKV-ISTRITTITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDELINGQID-IILQCLDQTR 1543
            ++L ++IP     I V+TWNM + K+ F PE+  +   + +  E   +   C QE + +++ELL R+Q+A+G+ +V++    +  + +++         +    IW++++ + V ++T     TKG  A+ F  FGTSILF+ SH   +        D R++DY  ++ + +L +    ++     E +N  D FD  FWAGD NFR+      V  +I  ++ K    E LL  DEL+N Q   II Q  D+ R
Sbjct:   76 RELNKIIPSSNIDIQVVTWNMLSMKSQFYPEDLSDLFFSGSSEEAASIYAICIQECSSDKNELLVRLQAAIGIKHVLFTYATHGTLALMIF--------LNRDLIWYTSVPQSVGVTTSAAVQTKGAVAICFILFGTSILFLSSHFKANHT----NFDRRVQDYLQVVNNINLPK--VGFNKGYKYEESNPLDRFDVVFWAGDLNFRIQRPRHIVENVIKGKY-KQRTFEELLSVDELLNAQSQGIIFQNFDEGR 315          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Cavefish
Match: inpp5e (inositol polyphosphate-5-phosphatase E [Source:NCBI gene;Acc:103038809])

HSP 1 Score: 94.3597 bits (233), Expect = 1.242e-19
Identity = 70/237 (29.54%), Postives = 113/237 (47.68%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITT--ITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            ++L +  P +   I + TWNM  +  FP N  + +   +     D  +   QE   +R E   R+Q  +G  YV+     +  +Y+ +   +  IW       + S +    ++TRI +   TKG   + F FFGTS LF+ SH +    GD  K   R+ DY  I+ +  L   L   +N     +++++  FD  FW GDFNFRL+ +   V  I++Q   K +    LL+HD+L
Sbjct:  286 EELDRYFPDRHVGIYIATWNMQGEKGFPNNLDDLLLPTDTEFAQDFYIIGVQEGCPDRREWEIRLQETLGPYYVMLYAAAHGVLYLTIFIRRDLIW-------FCSEVEHATVTTRIISQIKTKGAVGIGFTFFGTSFLFITSHFT---SGD-SKVYERILDYNKIVEALALPRGLPD-TNPYRSIASDVTTRFDEVFWFGDFNFRLSKDRGGVEAILNQHIGKDMG--PLLQHDQL 508          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Cavefish
Match: inppl1a (inositol polyphosphate phosphatase-like 1a [Source:NCBI gene;Acc:325179])

HSP 1 Score: 53.1434 bits (126), Expect = 9.612e-7
Identity = 54/199 (27.14%), Postives = 96/199 (48.24%), Query Frame = 2
Query:  923 DLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNI-------GDHFIWFSAIGKKVISTRIT-TITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            D+ +F  QE ++   E +  +++A+      Y EI+ K + V      + +WNI        +H    S +G   + T I  T+ KG   VSF F GTS  F+  HL+          + ++   Q  L   D++  L++   ++S  S +IS  F + FW GD N+RL+++  ++   I+++     + E LL+ D+L
Sbjct:  150 DIYVFGTQENSVCDKEWVENLRAAL----KDYTEIDYKPVAV------QTLWNIKIVVLVKPEHENRISHVGMSSVKTGIANTLNKGAVGVSFMFNGTSFGFVNCHLT--------SGNEKIHRNQNYL---DILRQLSLGDKQLS--SFDISLRFTHLFWFGDLNYRLDMDIQEILNYINRK-----EFEPLLKVDQL 320          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Nematostella
Match: EDO43425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYV8])

HSP 1 Score: 109.383 bits (272), Expect = 7.626e-26
Identity = 72/244 (29.51%), Postives = 129/244 (52.87%), Query Frame = 2
Query:  773 NRG*IRKDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITTI--TKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQ-EHSKSIKIENLLEHDEL 1495
            N+  +R+++ +  P     + V TWNM E+ + P    +F+   N   + D+ +   QE+  +RSE   R+Q  +G ++V+        +++ +   ++ +W       + SA+ ++ I+TR   +  TKG  AV F+ FGTS LF+ SHL+ D+    GK   R+ DY  I  S +L      + +     S +++D FD  FW GDFNFR+++E  +V ++I+  +  +S   + LL+ D+L
Sbjct:    3 NKNFLREEMEKYFPDHKVGVFVATWNMHEEKEVPGFLDDFLLPENVDFLQDIYVIGLQESTSSRSEWEIRLQETLGPSHVLMHSCSFGVLHLAIFVRRELVW-------FCSAVTQESIATRPGHMIKTKGGLAVGFSLFGTSFLFINSHLTSDE----GKARDRVNDYNKIRKSLNLQGEEKPWVD----NSPDVTDRFDRVFWLGDFNFRVDMERTEVDKLIATYQEQESPDYKELLKKDQL 231          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Medaka
Match: inpp5e (inositol polyphosphate-5-phosphatase E [Source:NCBI gene;Acc:101161245])

HSP 1 Score: 92.0485 bits (227), Expect = 5.603e-19
Identity = 70/237 (29.54%), Postives = 115/237 (48.52%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITT--ITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            ++L +  P +T  I ++TWNM  +   P N  + +   +     D  +   QE   ++ E    IQ  +G +YV+     +  +Y+ +   +  IW       + S      ++TRI +   TKG   ++  FFGTS LF+ SH +    GD  K   R+ DY  I+ +  L +SL   +N    E ++++  FD  FW GDFNFRLN +   V  I+++  +    +  LLEHD+L
Sbjct:  260 EELERYFPNRTLGIYIVTWNMQGERFLPANLNDLLLPTDSEFAQDFYVVGVQEGCQDKREWEICIQETLGPHYVMLYAASHGVLYLNVFTRRDLIW-------FCSVPEHSTVTTRIISQIKTKGALGIALTFFGTSFLFITSHFT---SGD-AKVYERVLDYNKIIEALTLPKSLP-DTNPYRSELSDVTTRFDQVFWFGDFNFRLNKDRADVEAIMAR--TVGGDMSTLLEHDQL 482          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Medaka
Match: inpp5e (inositol polyphosphate-5-phosphatase E [Source:NCBI gene;Acc:101161245])

HSP 1 Score: 91.6633 bits (226), Expect = 8.267e-19
Identity = 70/237 (29.54%), Postives = 115/237 (48.52%), Query Frame = 2
Query:  791 KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITT--ITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDEL 1495
            ++L +  P +T  I ++TWNM  +   P N  + +   +     D  +   QE   ++ E    IQ  +G +YV+     +  +Y+ +   +  IW       + S      ++TRI +   TKG   ++  FFGTS LF+ SH +    GD  K   R+ DY  I+ +  L +SL   +N    E ++++  FD  FW GDFNFRLN +   V  I+++  +    +  LLEHD+L
Sbjct:  260 EELERYFPNRTLGIYIVTWNMQGERFLPANLNDLLLPTDSEFAQDFYVVGVQEGCQDKREWEICIQETLGPHYVMLYAASHGVLYLNVFTRRDLIW-------FCSVPEHSTVTTRIISQIKTKGALGIALTFFGTSFLFITSHFT---SGD-AKVYERVLDYNKIIEALTLPKSLP-DTNPYRSELSDVTTRFDQVFWFGDFNFRLNKDRADVEAIMAR--TVGGDMSTLLEHDQL 482          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Medaka
Match: ENSORLT00000030675.1 (zinc finger protein 37 [Source:NCBI gene;Acc:101161026])

HSP 1 Score: 54.299 bits (129), Expect = 9.010e-8
Identity = 41/127 (32.28%), Postives = 60/127 (47.24%), Query Frame = -1
Query: 1602 WMNHETLEIWLKKVWKSRITLPPKTPWNQD----PKVPSLLLFDMHRSHLVSTAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYENIKHTKSGNMKAADWNTIFEWIVSSWEDVNLSTILNGFR 1970
            WMN E  E+W +KV            W+ D     K     L   + S  V   G T  VQP D+   + FK KLR+ +  W++ D E+ + T  GN+KA     +  WI+S+W+D+   TI   F+
Sbjct:  258 WMNQELTEMWCQKVCSGFGLRKSLLVWDADHCHISKETKEELKKYNVSMTVIPNGCTKYVQPADI-WGKPFKDKLRELYAKWMVGD-EDKEWTSGGNLKAPALRLLVTWIISAWQDIPPETIRKSFK 382          

HSP 2 Score: 22.3274 bits (46), Expect = 9.010e-8
Identity = 8/18 (44.44%), Postives = 12/18 (66.67%), Query Frame = -2
Query: 2063 IKTTGHEKKQFTVNLCSQ 2116
            +  +GHEK  FTV L ++
Sbjct:  204 MNASGHEKSHFTVTLAAK 221          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Medaka
Match: synj1 (synaptojanin 1 [Source:NCBI gene;Acc:101172098])

HSP 1 Score: 51.2174 bits (121), Expect = 4.022e-6
Identity = 44/164 (26.83%), Postives = 72/164 (43.90%), Query Frame = 2
Query: 1052 LVGHKKFIWNIGDHFIWFSAIGKKVISTRI--TTITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKI-ENLLEHDE-------LINGQID 1513
            LVG   F++    H  +   +    + T +   T  KG   +   F  TSI F+ SH +  +     +ND    DY  I             + R+S    ++    DY FW GDFN+R+NL + +V+ +I Q++ +++   + LLE           I G+ID
Sbjct:  638 LVGVCLFVFIRPQHAPYIRDVAVDTVKTGMGGATGNKGGVGIRLLFHTTSICFVCSHFAAGQSQVKERND----DYNEI-------------TRRLSFPMGHLLYSHDYVFWCGDFNYRINLPNEEVKELIRQQNWEALTAGDQLLEQKNAGAIFRGFIEGKID 784          
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Medaka
Match: synj1 (synaptojanin 1 [Source:NCBI gene;Acc:101172098])

HSP 1 Score: 51.2174 bits (121), Expect = 4.028e-6
Identity = 44/164 (26.83%), Postives = 72/164 (43.90%), Query Frame = 2
Query: 1052 LVGHKKFIWNIGDHFIWFSAIGKKVISTRI--TTITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKI-ENLLEHDE-------LINGQID 1513
            LVG   F++    H  +   +    + T +   T  KG   +   F  TSI F+ SH +  +     +ND    DY  I             + R+S    ++    DY FW GDFN+R+NL + +V+ +I Q++ +++   + LLE           I G+ID
Sbjct:  630 LVGVCLFVFIRPQHAPYIRDVAVDTVKTGMGGATGNKGGVGIRLLFHTTSICFVCSHFAAGQSQVKERND----DYNEI-------------TRRLSFPMGHLLYSHDYVFWCGDFNYRINLPNEEVKELIRQQNWEALTAGDQLLEQKNAGAIFRGFIEGKID 776          
BLAST of Inositol polyphosphate 5-phosphatase vs. Planmine SMEST
Match: SMESG000008580.1 (SMESG000008580.1)

HSP 1 Score: 465.692 bits (1197), Expect = 3.285e-156
Identity = 234/266 (87.97%), Postives = 237/266 (89.10%), Query Frame = 2
Query:  785 IRKDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITTITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDELINGQIDIILQCLDQTRSHSFHFLQFQEHR 1582
            + KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIG       AIGKKVISTRITTITKGVAAVSFNFFGTSILFMGSHLS     DLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDELINGQID ++            F  FQE R
Sbjct:  252 LEKDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIG-------AIGKKVISTRITTITKGVAAVSFNFFGTSILFMGSHLS----SDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDELINGQIDSVI------------FQDFQEGR 494          

HSP 2 Score: 421.779 bits (1083), Expect = 3.866e-139
Identity = 245/252 (97.22%), Postives = 246/252 (97.62%), Query Frame = 3
Query:   66 YSNQXXXXXXXXXXLETNNSSYVESNLDVENVIKEISNSSISVQNNMLPNSINVNEIISDNLFSVANENKTAFRESYNQVTDNDIKESNLSEDFQIFKSREDQKSNESLEQNHFKEQKGLSDLELHDKSNNLELIETSDQPNRIHXXXXXXXXXXXXXLSNSFTTPVEYLERPVSNPSLYFSNDLLQPEICDEEFLDSPNQNLQIQNSFSLQSLNDRNASWSDQQVTNSIENEESLIEDKLEKIYFN*FPRK 821
            YSNQKKRKKHRHRKLETNNSSYVESNLDVENVIKEISNSSISVQNNMLPNSINVNEIISDNLFSVANENKTAFRESYNQVTDNDIKESNLSEDFQIFKSREDQKSNESLEQNHFKEQKGLSDLELHDKSNNLELIETSDQPNRIHRKIKKKVRNQRKKLSNSFTTPVEYLERPVSNPSLYFSNDLLQPEICDEEFLDSPNQNLQIQNSFSLQSLNDRNASWSDQQVTNSIENEESLIEDKLEK      P+K
Sbjct:   12 YSNQKKRKKHRHRKLETNNSSYVESNLDVENVIKEISNSSISVQNNMLPNSINVNEIISDNLFSVANENKTAFRESYNQVTDNDIKESNLSEDFQIFKSREDQKSNESLEQNHFKEQKGLSDLELHDKSNNLELIETSDQPNRIHRKIKKKVRNQRKKLSNSFTTPVEYLERPVSNPSLYFSNDLLQPEICDEEFLDSPNQNLQIQNSFSLQSLNDRNASWSDQQVTNSIENEESLIEDKLEKDLLQLIPKK 263          
BLAST of Inositol polyphosphate 5-phosphatase vs. Planmine SMEST
Match: SMESG000008580.1 (SMESG000008580.1)

HSP 1 Score: 464.922 bits (1195), Expect = 4.077e-154
Identity = 232/254 (91.34%), Postives = 235/254 (92.52%), Query Frame = 2
Query:  785 IRKDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVISTRITTITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDELINGQID-IILQCLDQTR 1543
            + KDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIG       AIGKKVISTRITTITKGVAAVSFNFFGTSILFMGSHLS     DLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDELINGQID +I Q   + R
Sbjct:  252 LEKDLLQLIPKKTARIMVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTRIQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIG-------AIGKKVISTRITTITKGVAAVSFNFFGTSILFMGSHLS----SDLGKNDLRLEDYQLILYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRRIISQEHSKSIKIENLLEHDELINGQIDSVIFQDFQEGR 494          

HSP 2 Score: 421.779 bits (1083), Expect = 2.089e-137
Identity = 245/252 (97.22%), Postives = 246/252 (97.62%), Query Frame = 3
Query:   66 YSNQXXXXXXXXXXLETNNSSYVESNLDVENVIKEISNSSISVQNNMLPNSINVNEIISDNLFSVANENKTAFRESYNQVTDNDIKESNLSEDFQIFKSREDQKSNESLEQNHFKEQKGLSDLELHDKSNNLELIETSDQPNRIHXXXXXXXXXXXXXLSNSFTTPVEYLERPVSNPSLYFSNDLLQPEICDEEFLDSPNQNLQIQNSFSLQSLNDRNASWSDQQVTNSIENEESLIEDKLEKIYFN*FPRK 821
            YSNQKKRKKHRHRKLETNNSSYVESNLDVENVIKEISNSSISVQNNMLPNSINVNEIISDNLFSVANENKTAFRESYNQVTDNDIKESNLSEDFQIFKSREDQKSNESLEQNHFKEQKGLSDLELHDKSNNLELIETSDQPNRIHRKIKKKVRNQRKKLSNSFTTPVEYLERPVSNPSLYFSNDLLQPEICDEEFLDSPNQNLQIQNSFSLQSLNDRNASWSDQQVTNSIENEESLIEDKLEK      P+K
Sbjct:   12 YSNQKKRKKHRHRKLETNNSSYVESNLDVENVIKEISNSSISVQNNMLPNSINVNEIISDNLFSVANENKTAFRESYNQVTDNDIKESNLSEDFQIFKSREDQKSNESLEQNHFKEQKGLSDLELHDKSNNLELIETSDQPNRIHRKIKKKVRNQRKKLSNSFTTPVEYLERPVSNPSLYFSNDLLQPEICDEEFLDSPNQNLQIQNSFSLQSLNDRNASWSDQQVTNSIENEESLIEDKLEKDLLQLIPKK 263          
BLAST of Inositol polyphosphate 5-phosphatase vs. Planmine SMEST
Match: SMESG000040582.1 (SMESG000040582.1)

HSP 1 Score: 69.3218 bits (168), Expect = 8.298e-14
Identity = 37/52 (71.15%), Postives = 39/52 (75.00%), Query Frame = -2
Query: 1967 RIKTTGHEKKQFTVNLCS-QRWY*TSAFVILGTKKHPKTFIPESKFVIAANG 2119
            RIKT GHEKK+FTVNLC  +       FVILGTKKH  TFIPESK VIAANG
Sbjct:  183 RIKTKGHEKKRFTVNLCVLKDGTKLPPFVILGTKKHTNTFIPESKLVIAANG 234          

HSP 2 Score: 27.335 bits (59), Expect = 8.298e-14
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = -1
Query: 1938 WMNHETLEIWL 1970
            WMNHETLEI+L
Sbjct:  237 WMNHETLEIFL 247          
BLAST of Inositol polyphosphate 5-phosphatase vs. Planmine SMEST
Match: SMESG000052069.1 (SMESG000052069.1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.009e-11
Identity = 30/44 (68.18%), Postives = 36/44 (81.82%), Query Frame = -3
Query: 1966 RKNNLLSICVLKDGTKLPPLLFWAQRNIQRLSFLNQSLLLQPMD 2097
            +K   +++CVLKDGTKLPP +    RNIQRLSFLNQSLLLQPM+
Sbjct:  142 KKRFTVNLCVLKDGTKLPPFVILGTRNIQRLSFLNQSLLLQPME 185          
BLAST of Inositol polyphosphate 5-phosphatase vs. Planmine SMEST
Match: SMESG000028550.1 (SMESG000028550.1)

HSP 1 Score: 49.6766 bits (117), Expect = 8.018e-7
Identity = 40/112 (35.71%), Postives = 53/112 (47.32%), Query Frame = -1
Query: 1644 WLKKVWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVS----TAGLTSKV--------QPLDLTVNRSFKSKLRKKWEDWIIKDYENIKHTKSGNMKAADWNTIFEWIVSS 1943
            WL KVW  R         N      S L+FD  RS++      TA   SKV        + LDLTVN+SF+SK+  KW  W++  +     TKSG  + A +  I   +VSS
Sbjct:    5 WLNKVWCERA--------NAFFNSTSFLIFDSARSYITDKMKKTAKQYSKVAVIPSGLAKKLDLTVNKSFRSKMLYKWNKWMMDGF--YTFTKSGKTRRASYIQIVLKMVSS 106          
The following BLAST results are available for this feature:
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
INPP5E2.019e-2230.29inositol polyphosphate-5-phosphatase E [Source:HGN... [more]
POGK3.154e-1025.15pogo transposable element derived with KRAB domain... [more]
POGK3.154e-1025.15pogo transposable element derived with KRAB domain... [more]
back to top
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
INPP5E1.316e-1627.54gene:FBgn0036273 transcript:FBtr0333356[more]
INPP5E1.316e-1627.54gene:FBgn0036273 transcript:FBtr0076007[more]
back to top
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inpp5e9.651e-2129.11inositol polyphosphate-5-phosphatase E [Source:ZFI... [more]
inpp5e8.859e-2029.11inositol polyphosphate-5-phosphatase E [Source:ZFI... [more]
CR352209.11.361e-1836.88pep chromosome:GRCz11:24:26088143:26089609:1 gene:... [more]
CR354398.12.865e-1836.88pep chromosome:GRCz11:7:64150332:64152087:-1 gene:... [more]
BX914205.23.271e-1836.88pep chromosome:GRCz11:4:64121772:64123545:-1 gene:... [more]
back to top
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamts22.854e-2731.22ADAM metallopeptidase with thrombospondin type 1 m... [more]
ENSXETT00000014594.11.046e-2432.07pep primary_assembly:Xenopus_tropicalis_v9.1:5:335... [more]
ENSXETT00000001567.12.833e-2430.38pep primary_assembly:Xenopus_tropicalis_v9.1:5:249... [more]
clpx4.816e-2430.49caseinolytic mitochondrial matrix peptidase chaper... [more]
maco11.029e-2228.81macoilin 1 [Source:Xenbase;Acc:XB-GENE-5804807][more]
back to top
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inpp5e3.582e-2431.09inositol polyphosphate-5-phosphatase E [Source:MGI... [more]
Inpp5e5.119e-2431.22inositol polyphosphate-5-phosphatase E [Source:MGI... [more]
Inpp5e1.165e-1627.73inositol polyphosphate-5-phosphatase E [Source:MGI... [more]
Pogk1.127e-923.61pogo transposable element with KRAB domain [Source... [more]
Pogk1.127e-923.61pogo transposable element with KRAB domain [Source... [more]
back to top
BLAST of Inositol polyphosphate 5-phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JII1|INP5E_MOUSE3.581e-2331.22Phosphatidylinositol polyphosphate 5-phosphatase t... [more]
sp|Q9WVR1|INP5E_RAT5.246e-2331.36Phosphatidylinositol polyphosphate 5-phosphatase t... [more]
sp|A0FI79|INP5E_PANTR5.774e-2230.80Phosphatidylinositol polyphosphate 5-phosphatase t... [more]
sp|Q9NRR6|INP5E_HUMAN9.697e-2230.29Phosphatidylinositol polyphosphate 5-phosphatase t... [more]
sp|Q9VTW2|INP5E_DROME1.319e-1527.54Inositol polyphosphate 5-phosphatase E OS=Drosophi... [more]
back to top
BLAST of Inositol polyphosphate 5-phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2L4021.400e-2429.22IPPc domain-containing protein OS=Opisthorchis fel... [more]
A0A4S2KY431.943e-2429.22IPPc domain-containing protein OS=Opisthorchis fel... [more]
A0A5G3HGV04.481e-2431.22ADAM metallopeptidase with thrombospondin type 1 m... [more]
A0A4S2KZD05.182e-2429.22IPPc domain-containing protein OS=Opisthorchis fel... [more]
A0A5K4FEW42.288e-2330.20Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
inpp5e1.242e-1929.54inositol polyphosphate-5-phosphatase E [Source:NCB... [more]
inppl1a9.612e-727.14inositol polyphosphate phosphatase-like 1a [Source... [more]
back to top
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO434257.626e-2629.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Inositol polyphosphate 5-phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inpp5e5.603e-1929.54inositol polyphosphate-5-phosphatase E [Source:NCB... [more]
inpp5e8.267e-1929.54inositol polyphosphate-5-phosphatase E [Source:NCB... [more]
ENSORLT00000030675.19.010e-832.28zinc finger protein 37 [Source:NCBI gene;Acc:10116... [more]
synj14.022e-626.83synaptojanin 1 [Source:NCBI gene;Acc:101172098][more]
synj14.028e-626.83synaptojanin 1 [Source:NCBI gene;Acc:101172098][more]
back to top
BLAST of Inositol polyphosphate 5-phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008580.13.285e-15687.97SMESG000008580.1[more]
SMESG000008580.14.077e-15491.34SMESG000008580.1[more]
SMESG000040582.18.298e-1471.15SMESG000040582.1[more]
SMESG000052069.11.009e-1168.18SMESG000052069.1[more]
SMESG000028550.18.018e-735.71SMESG000028550.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030895 ID=SMED30030895|Name=Inositol polyphosphate 5-phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=2120bp
GCAATTATTTGAGATACATTTTAATAGAATTAATGAATGAAGAATCAAAT
CTTTTAAATGAGAATTATTCCAATCAAAAGAAAAGAAAAAAACATCGTCA
CCGTAAACTTGAAACTAATAATTCTTCGTATGTAGAATCCAACCTAGATG
TTGAAAATGTAATTAAAGAAATTTCGAATTCAAGCATTTCGGTTCAAAAT
AATATGCTACCAAATTCTATCAATGTCAATGAAATAATATCAGATAATTT
ATTTAGTGTCGCAAATGAGAATAAAACTGCATTTCGAGAAAGTTATAATC
AAGTGACTGATAATGACATTAAGGAAAGTAATCTTTCTGAGGATTTTCAA
ATATTTAAGTCTCGTGAAGATCAAAAATCAAATGAATCTTTAGAACAAAA
TCATTTTAAAGAACAAAAAGGTTTATCGGATCTCGAATTGCATGATAAAT
CAAATAATTTGGAATTAATCGAAACCTCAGACCAACCAAACAGAATTCAT
AGAAAAATTAAAAAAAAAGTTCGTAATCAACGTAAAAAACTCTCTAATAG
TTTCACTACTCCAGTCGAATATCTGGAGAGACCTGTCAGTAATCCTTCTT
TATATTTCAGCAATGACCTTTTGCAACCTGAAATTTGCGATGAGGAATTT
TTAGATAGTCCAAATCAAAATTTGCAAATTCAAAATTCATTCTCACTTCA
ATCGCTCAATGATCGCAATGCCAGTTGGTCTGATCAACAAGTCACGAATT
CTATTGAAAATGAGGAGTCGTTAATAGAGGATAAATTAGAAAAGATTTAC
TTCAATTAATTCCCAAGAAAACTGCTAGAATAATGGTATTAACGTGGAAT
ATGGCTGAAAAAACAGACTTTCCCGAAAATTCATTTGAATTTATTCATAA
TATAAACTGCAGAGAAATGTGTGATTTGTTGTTATTTTGTTTTCAAGAGA
CAGCAATTAACAGGTCCGAACTATTGACTCGAATCCAATCAGCTGTTGGC
CTTAACTATGTGATTTATGACGAAATTGAAAATAAAAAAATTTATGTTGT
CCTAGTTGGTCATAAGAAATTTATATGGAACATTGGAGATCATTTTATAT
GGTTTTCAGCTATAGGCAAAAAAGTCATTTCAACAAGAATTACAACTATT
ACCAAAGGAGTAGCTGCTGTTAGTTTTAATTTCTTTGGTACCTCAATACT
TTTTATGGGATCTCATTTGAGTAGAGACAAGATGGGTGATTTGGGTAAAA
ATGACTTACGTTTGGAAGACTATCAACTAATTCTCTATTCTAAAGATCTT
ATTGAAAGCTTAACAATGTACTCTAACAGAATTTCTTGTGAGAGCAATAA
TATATCAGATTATTTTGATTATACATTTTGGGCTGGGGATTTCAATTTTC
GGCTTAATCTAGAAGATGTGAAGGTGAGGCGCATTATAAGTCAAGAGCAC
AGCAAATCCATCAAAATTGAAAACCTTCTAGAACATGATGAATTGATCAA
CGGTCAAATTGACATAATTCTACAATGTTTGGATCAGACTCGTTCACATT
CATTTCATTTTCTTCAATTTCAAGAACATCGTCGTCTTCACCGAATGCAA
CACGAAAACCATTCAAAATGGTGGAAAGGTTAACATCTTCCCAAGAGGAA
ACAATCCATTCGAAAATAGTATTCCAGTCAGCTGCTTTCATATTTCCGGA
CTTAGTATGTTTGATGTTTTCATAATCTTTAATGATCCAATCCTCCCACT
TCTTGCGCAATTTTGACTTGAACGAACGGTTAACAGTAAGATCTAATGGC
TGCACCTTTGATGTCAATCCGGCAGTACTGACAAGATGTGAGCGATGCAT
ATCAAATAAAAGCAATGATGGTACTTTTGGATCCTGGTTCCATGGTGTCT
TTGGAGGCAATGTAATTCGACTCTTCCATACTTTCTTGAGCCATATCTCA
AGAGTTTCATGATTCATCCATTGGCTGCAATAACAAACTTTGATTCAGGA
ATGAAAGTCTTTGGATGTTTCTTTGTGCCCAAAATAACAAAGGCGGAAGT
TTAGTACCATCTTTGAGAACACAGATTGACAGTAAATTGTTTTTTCTCAT
GTCCTGTAGTTTTAATTCGG
back to top

protein sequence of SMED30030895-orf-1

>SMED30030895-orf-1 ID=SMED30030895-orf-1|Name=SMED30030895-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=157bp
MNHETLEIWLKKVWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTAG
LTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYENIKHTKSGNMKAADWNT
IFEWIVSSWEDVNLSTILNGFRVAFGEDDDVLEIEENEMNVNESDPNIVE
LCQFDR*
back to top

protein sequence of SMED30030895-orf-2

>SMED30030895-orf-2 ID=SMED30030895-orf-2|Name=SMED30030895-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=267bp
MVLTWNMAEKTDFPENSFEFIHNINCREMCDLLLFCFQETAINRSELLTR
IQSAVGLNYVIYDEIENKKIYVVLVGHKKFIWNIGDHFIWFSAIGKKVIS
TRITTITKGVAAVSFNFFGTSILFMGSHLSRDKMGDLGKNDLRLEDYQLI
LYSKDLIESLTMYSNRISCESNNISDYFDYTFWAGDFNFRLNLEDVKVRR
IISQEHSKSIKIENLLEHDELINGQIDIILQCLDQTRSHSFHFLQFQEHR
RLHRMQHENHSKWWKG*
back to top

protein sequence of SMED30030895-orf-3

>SMED30030895-orf-3 ID=SMED30030895-orf-3|Name=SMED30030895-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=269bp
NYLRYILIELMNEESNLLNENYSNQKKRKKHRHRKLETNNSSYVESNLDV
ENVIKEISNSSISVQNNMLPNSINVNEIISDNLFSVANENKTAFRESYNQ
VTDNDIKESNLSEDFQIFKSREDQKSNESLEQNHFKEQKGLSDLELHDKS
NNLELIETSDQPNRIHRKIKKKVRNQRKKLSNSFTTPVEYLERPVSNPSL
YFSNDLLQPEICDEEFLDSPNQNLQIQNSFSLQSLNDRNASWSDQQVTNS
IENEESLIEDKLEKIYFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR005135Endo/exonuclease/phosphatase
IPR004875DDE_SF_endonuclease_dom
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0004439phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0001726ruffle
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005929cilium
GO:0005930axoneme
GO:0016020membrane
GO:0032580Golgi cisterna membrane
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0046488phosphatidylinositol metabolic process
GO:0046855inositol phosphate dephosphorylation
GO:0046856phosphatidylinositol dephosphorylation