Intraflagellar transport protein 172

Overview
NameIntraflagellar transport protein 172
Smed IDSMED30030892
Uniprot Best hitIntraflagellar transport protein 172 homolog OS=Rattus norvegicus OX=10116 GN=Ift172 PE=1 SV=1 (E=0)
Length (bp)5365
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Intraflagellar transport protein 172 (SMED30030892) t-SNE clustered cells

Violin plots show distribution of expression levels for Intraflagellar transport protein 172 (SMED30030892) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Intraflagellar transport protein 172 (SMED30030892) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Intraflagellar transport protein 172 (SMED30030892) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030892

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030892SMESG000028841.1 SmedASXL_018373SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30030892SMESG000028841.1 dd_Smed_v4_10638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30030892SMESG000028841.1 dd_Smed_v4_10638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30030892SMESG000028841.1 dd_Smed_v4_10638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30030892SMESG000028841.1 dd_Smed_v4_7533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30030892SMESG000028841.1 dd_Smed_v4_7533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30030892SMESG000028841.1 dd_Smed_v4_7533_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30030892SMESG000028841.1 dd_Smed_v6_7533_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30030892SMESG000028841.1 dd_Smed_v6_10638_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30030892SMESG000028841.1 OX_Smed_1.0.00985ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030892SMESG000028841.1 dd_Smed_v4_10638_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030892SMESG000028841.1 dd_Smed_v4_7533_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30030892SMESG000028841.1 dd_Smed_v4_7533_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30030892SMESG000028841.1 dd_Smed_v4_7533_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Intraflagellar transport protein 172 vs. Ensembl Human
Match: IFT172 (intraflagellar transport 172 [Source:HGNC Symbol;Acc:HGNC:30391])

HSP 1 Score: 1918.28 bits (4968), Expect = 0.000e+0
Identity = 908/1773 (51.21%), Postives = 1287/1773 (72.59%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFN--DNEIGK--VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIIS-ADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKI--NLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQNKKCIS-ENFNKFQIASKVSRSTECADVLRFINEWCGSLPAS 5310
            M LKH++T+L PQ   AK+  + WS N  KFA C+ DRV++L+DE+GE++D+F+TK +D KYG+K+Y+V  +AFSPDS+K+A+GQ+D+I+YVYK+G+ W DKK ICNKF Q S+VTCL WP +  IV GL +GKVR+AN KTNKS T+Y  + Y VSL ++ + KG +SGH+DG+I+RYFFDDEGS +SQGK+  HP  PYALAW ++N+I+AAGCD++I  Y +EG +LQ FD+SRD  E+EFT A S+P GQSVV+GSY++LR+ NW  R+ +WEE + KEI NLYT++ L WK+DGS++C+  +CGG+  FDCCLR+ IYK+KFEL YVGPSQVIV N+ +  ++++KS++G+E+ EVKI GK++Y++AHTSETL+LGD++TN+LSEI WQ SG  EK+ F+N+NVCMI+  GELTL+EYG ++ LG VRTEF++PH ISVRINER Q   + NKKLAYLID+KTI+++DL  G +I  +S++S++DW+ELNE G  +LFRD+KLRL L +IE+ S+  +LN+CSY+QWVPGSDV+VAQ+R +LC+WYNI+ P+RVT F ++GD+  + R  GKTEV+V EG+  VAY LDEGLIEF TA++DG++ RA +FLE++E+T ETE+MW+ L+  AL      + IAERC++ALG + K  +LHET  + +    E G      Y+V ARLA+L  N+KLAE I+LE N ++EA+ MY+ L+ WDE I VA  KGH +   LR SYYQWL++T Q E+AGE +E  GD L AISLY+K+G+PA+AARL L++ ++++  +L+  I  +L+K EL+E+AG+L+E + N  +A++CYRKGN+F +AVELAR +FP +V++LEE WG++LV   QLD AI HYIE+   +KAI+AA+ A+QW+K   IL+ QD N    +KYY ++A+HY S++++E AEE + KG   + A++ Y   G WE+AH +  + +   +   +Y  QAQ++E  GK++EAE+L++T+  P  AI MYK++K+  D+IRL+ K++P+ +  T   L +E E +G +++AE +YL+  +WK+ VN+YR   +WE+AYRV++    A A K V YLWAK LGGE+AV+LLN+LGLL+ A+D+A ++ +F+FAFEL +     K  E+H KYAM+LEDEG+F EAEA FI+A KP+EAVLM+VH QDW+AAQRVAE  D DSV++VLVGQAR A   +D++K+E  L+RAQRP LA+  YKEA +W DA+R+CK+Y+P +LE LQE+Y+RE       + K   G         +   +Q R WE   EY RAV+CYLK+              + EK W+KA E+ +KFL   + ++V+  +GP+LI I K   A++ Y  +D VKEA++A IEGEEW+KAK +A+ ++P+YE YV++ YK FLK+ GK   L  +D+I AL++Y EQ  WDKC+  A      ILHKY+A+YAT LI+   S  AL +Y+++G+P   QNFNIYKRIF D+ S   TN  ++Y  W  LRD +F +  NL   S  +      F+ ML  +HYYA RSA  +  Q L+ +  ++S+SLLR+T ++P DKAFYEAG+  +   + +MAFIF NR+LDL +AIE  +G+ D LD++DF+DTDIP EVPLP K++    E  +V++WVL++SMDQ+LE  LP DER  +  SL  + TG  ++PC+I+G+P+L+N+  FK+  K  + +N+NKF +A K S S  C DVL+FI++WCG LP++
Sbjct:    1 MHLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADMKYGRKSYMVKGMAFSPDSTKIAIGQTDNIIYVYKIGEDWGDKKVICNKFIQTSAVTCLQWPAEYIIVFGLAEGKVRLANTKTNKSSTIYGTESYVVSLTTNCSGKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAW-ATNSIVAAGCDRKIVAYGKEGHMLQTFDYSRDPQEREFTTAVSSPGGQSVVLGSYDRLRVFNWIPRRSIWEEAKPKEITNLYTITALAWKRDGSRLCVGTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKNLSSGTRVVLKSHYGYEVEEVKILGKERYLVAHTSETLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVCMIFNAGELTLVEYGNNDTLGSVRTEFMNPHLISVRINERCQRGTEDNKKLAYLIDIKTIAIVDLIGGYNIGTVSHESRVDWLELNETGHKLLFRDRKLRLHLYDIESCSKTMILNFCSYMQWVPGSDVLVAQNRNSLCVWYNIEAPERVTMFTIRGDVIGLERGGGKTEVMVMEGVTTVAYTLDEGLIEFGTAIDDGNYIRATAFLETLEMTPETEAMWKTLSKLALEA--RQLHIAERCFSALGQVAKARFLHETNEIADQVSREYGGEGTDFYQVRARLAMLEKNYKLAEMIFLEQNAVEEAMGMYQELHRWDECIAVAEAKGHPALEKLRRSYYQWLMDTQQEERAGELQESQGDGLAAISLYLKAGLPAKAARLVLTREELLANTELVEHITAALIKGELYERAGDLFEKIHNPQKALECYRKGNAFMKAVELARLAFPVEVVKLEEAWGDHLVQQKQLDAAINHYIEARCSIKAIEAALGARQWKKAIYILDLQDRNTA--SKYYPLVAQHYASLQEYEIAEELYTKGDRTKDAIDMYTQAGRWEQAHKLAMKCMRPEDVSVLYITQAQEMEKQGKYREAERLYVTVQEPDLAITMYKKHKLYDDMIRLVGKHHPDLLSDTHLHLGKELEAEGRLQEAEYHYLEAQEWKATVNMYRASGLWEEAYRVARTQGGANAHKHVAYLWAKSLGGEAAVRLLNKLGLLEAAVDHAADNCSFEFAFELSRLALKHKTPEVHLKYAMFLEDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPSQLEALQEEYERE------ATKKGARG--------VEGFVEQARHWEQAGEYSRAVDCYLKVR-------DSGNSGLAEKCWMKAAELSIKFLPPQRNMEVVLAVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQHYKEFLKNQGKVDSLVGVDVIAALDLYVEQGQWDKCIETATKQNYKILHKYVALYATHLIREGSSAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNCAEAYHSWADLRDVLFNLCENLVKSSEANSPAHEEFKTMLLIAHYYATRSAAQSVKQ-LETVAARLSVSLLRHTQLLPVDKAFYEAGIAAKAVGWDNMAFIFLNRFLDLTDAIE--EGTLDGLDHSDFQDTDIPFEVPLPAKQHVPEAEREEVRDWVLTVSMDQRLEQVLPRDERGAYEASLVAASTGVRALPCLITGYPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQWCGGLPST 1744          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Human
Match: IFT172 (intraflagellar transport 172 [Source:HGNC Symbol;Acc:HGNC:30391])

HSP 1 Score: 682.945 bits (1761), Expect = 0.000e+0
Identity = 300/518 (57.92%), Postives = 414/518 (79.92%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETG 1569
            M LKH++T+L PQ   AK+  + WS N  KFA C+ DRV++L+DE+GE++D+F+TK +D KYG+K+Y+V  +AFSPDS+K+A+GQ+D+I+YVYK+G+ W DKK ICNKF Q S+VTCL WP +  IV GL +GKVR+AN KTNKS T+Y  + Y VSL ++ + KG +SGH+DG+I+RYFFDDEGS +SQGK+  HP  PYALAW ++N+I+AAGCD++I  Y +EG +LQ FD+SRD  E+EFT A S+P GQSVV+GSY++LR+ NW  R+ +WEE + KEI NLYT++ L WK+DGS++C+  +CGG+  FDCCLR+ IYK+KFEL YVGPSQVIV N+ +  ++++KS++G+E+ EVKI GK++Y++AHTSETL+LGD++TN+LSEI WQ SG  EK+ F+N+NVCMI+  GELTL+EYG ++ LG VRTEF++PH ISVRINER Q   + NKKLAYLID+KTI+++DL  G +I  +S++S++DW+ELNE G  +LFRD+KLR++ +    G
Sbjct:    1 MHLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADMKYGRKSYMVKGMAFSPDSTKIAIGQTDNIIYVYKIGEDWGDKKVICNKFIQTSAVTCLQWPAEYIIVFGLAEGKVRLANTKTNKSSTIYGTESYVVSLTTNCSGKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAW-ATNSIVAAGCDRKIVAYGKEGHMLQTFDYSRDPQEREFTTAVSSPGGQSVVLGSYDRLRVFNWIPRRSIWEEAKPKEITNLYTITALAWKRDGSRLCVGTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKNLSSGTRVVLKSHYGYEVEEVKILGKERYLVAHTSETLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVCMIFNAGELTLVEYGNNDTLGSVRTEFMNPHLISVRINERCQRGTEDNKKLAYLIDIKTIAIVDLIGGYNIGTVSHESRVDWLELNETGHKLLFRDRKLRVRRATKALG 517          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Human
Match: IFT172 (intraflagellar transport 172 [Source:HGNC Symbol;Acc:HGNC:30391])

HSP 1 Score: 659.448 bits (1700), Expect = 0.000e+0
Identity = 290/497 (58.35%), Postives = 400/497 (80.48%), Query Frame = 1
Query:   82 IDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETG 1569
            + WS N  KFA C+ DRV++L+DE+GE++D+F+TK +D KYG+K+Y+V  +AFSPDS+K+A+GQ+D+I+YVYK+G+ W DKK ICNKF Q S+VTCL WP +  IV GL +GKVR+AN KTNKS T+Y  + Y VSL ++ + KG +SGH+DG+I+RYFFDDEGS +SQGK+  HP  PYALAW ++N+I+AAGCD++I  Y +EG +LQ FD+SRD  E+EFT A S+P GQSVV+GSY++LR+ NW  R+ +WEE + KEI NLYT++ L WK+DGS++C+  +CGG+  FDCCLR+ IYK+KFEL YVGPSQVIV N+ +  ++++KS++G+E+ EVKI GK++Y++AHTSETL+LGD++TN+LSEI WQ SG  EK+ F+N+NVCMI+  GELTL+EYG ++ LG VRTEF++PH ISVRINER Q   + NKKLAYLID+KTI+++DL  G +I  +S++S++DW+ELNE G  +LFRD+KLR++ +    G
Sbjct:    1 MAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADMKYGRKSYMVKGMAFSPDSTKIAIGQTDNIIYVYKIGEDWGDKKVICNKFIQTSAVTCLQWPAEYIIVFGLAEGKVRLANTKTNKSSTIYGTESYVVSLTTNCSGKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAW-ATNSIVAAGCDRKIVAYGKEGHMLQTFDYSRDPQEREFTTAVSSPGGQSVVLGSYDRLRVFNWIPRRSIWEEAKPKEITNLYTITALAWKRDGSRLCVGTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKNLSSGTRVVLKSHYGYEVEEVKILGKERYLVAHTSETLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVCMIFNAGELTLVEYGNNDTLGSVRTEFMNPHLISVRINERCQRGTEDNKKLAYLIDIKTIAIVDLIGGYNIGTVSHESRVDWLELNETGHKLLFRDRKLRVRRATKALG 496          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Human
Match: IFT172 (intraflagellar transport 172 [Source:HGNC Symbol;Acc:HGNC:30391])

HSP 1 Score: 298.13 bits (762), Expect = 3.108e-90
Identity = 150/339 (44.25%), Postives = 214/339 (63.13%), Query Frame = 1
Query: 3622 LVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKINLDTDSN 4638
            LVGQAR A   +D++K+E  L+RAQRP LA+  YKEA +W DA+R+CK+Y+P +LE LQE+Y+RE       + K   G         +   +Q R WE   EY RAV+CYLK+              + EK W+KA E+ +KFL   + ++V+  +GP+LI I K   A++ Y  +D VKEA++A IEGEEW+KAK +A+ ++P+YE YV++ YK FLK+ GK   L  +D+I AL++Y EQ  WDKC+  A      ILHKY+A+YAT LI+   S  AL +Y+++G+P   QNFNIYKRIF D+ S   TN  ++Y  W  LRD +F + + + S+
Sbjct:    2 LVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPSQLEALQEEYERE------ATKKGARG--------VEGFVEQARHWEQAGEYSRAVDCYLKVR-------DSGNSGLAEKCWMKAAELSIKFLPPQRNMEVVLAVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQHYKEFLKNQGKVDSLVGVDVIAALDLYVEQGQWDKCIETATKQNYKILHKYVALYATHLIREGSSAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNCAEAYHSWADLRDVLFNLAVLSPSS 319          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Human
Match: IFT172 (intraflagellar transport 172 [Source:HGNC Symbol;Acc:HGNC:30391])

HSP 1 Score: 200.675 bits (509), Expect = 4.556e-58
Identity = 100/203 (49.26%), Postives = 130/203 (64.04%), Query Frame = 1
Query: 3433 KMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEI 4041
            K  E+H KYAM+LEDEG+F EAEA FI+A KP+EAVLM+VH QDW+AAQRVAE  D DSV++VLVGQAR A   +D++K+E  L+RAQRP LA+  YKEA +W DA+R+CK+Y+P +LE LQE+Y+RE +                     +   +Q R WE   EY RAV+CYLK+              + EK W+K   I
Sbjct:    9 KTPEVHLKYAMFLEDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPSQLEALQEEYEREAT--------------KKGARGVEGFVEQARHWEQAGEYSRAVDCYLKVR-------DSGNSGLAEKCWMKVAGI 190          

HSP 2 Score: 62.3882 bits (150), Expect = 4.812e-10
Identity = 43/147 (29.25%), Postives = 75/147 (51.02%), Query Frame = 1
Query: 2794 KFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEK------DGNIKQAEQYYLQIGDWKSAVNLYRK 3216
            KFE+AE  FI+    ++AV  +++N  WE A  +   + D     ++   QA+    +  F++AE L L   RP  A+N YK   +  D +R+   Y P +++    +   EA K      +G ++QA +++ Q G++  AV+ Y K
Sbjct:   26 KFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAH-DPDSVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPSQLEALQEEYEREATKKGARGVEGFVEQA-RHWEQAGEYSRAVDCYLK 170          

HSP 3 Score: 54.299 bits (129), Expect = 2.937e-7
Identity = 29/99 (29.29%), Postives = 55/99 (55.56%), Query Frame = 1
Query: 2956 LEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQ 3252
            LE +GKF+EAE  F+   +P+EA+ M+  N+  +   R+   ++P+ +   L   A  A ++ + ++AE   L+      A+N Y++  +W DA R+ +
Sbjct:   21 LEDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICK 119          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Celegans
Match: osm-1 (Intraflagellar transport protein osm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q22830])

HSP 1 Score: 1270.37 bits (3286), Expect = 0.000e+0
Identity = 693/1778 (38.98%), Postives = 1073/1778 (60.35%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASIQ-ISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIG----KVKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIISAD--LINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILEN-QDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFIL---ASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMA--QDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKINLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDE---LITQISISLLRYTDIIPADKAFYEAGLLCRN--KSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQNKKCISENFNKFQIASKVSRSTECADVLRFINEWCGS 5298
            MKLK++ TILP Q  EAKI  I  SPNG + A    DR + L DENG +KDRF  K  D KYGKK++ V  + FSPDSS++A+GQSD+++++YK+G  W++KK I NKF QPS+VTCL WP D  I++G LDGKVR+  IKTNK  ++Y  D+  VS+ +      F+S H DGSII Y F    S+ +Q K+ T    PY L + +++ ++ A  D+R+  Y   G + QQFD++ D +EKEF+  S +P+ Q+VV+ SY++LR+ +W+ R+G W+EG   EI N YT+  L WK DGS I    +CGG+   DCCLR+ + K +FE  YV PS VI+ +V    +  + S  G  I+E+KI GKD+Y+I +TS ++++ D  + + SE+ WQS G  EKF FD +N C+I   GE+T++EYG+   LG VRTE  SPH +SV+++        K KKLAYL+D  TIS+++L  G     I++   +DWIELNE  + +L+RDK+ ++ L +I +  R  LL++C+YVQWVP SDVIVAQS +NL IWYN   P++VT+  +KG++  ++R   +TEV+V E   +VAY LD   IEF  ALE  DF RAV+FLES     +  SMW  +A+ AL  G  ++ +A+RCYAA+ D+ K   LH+ + + ++  I         YKV A LA++   FK AE I+LE N  + AI MY SL+ WDEA+E+A +  +     L+ SY + L +T Q  KA E K  +GD L AI LYIKS  P  A   A +   ++S D  ++ +IA SL+K +L++KAG++YE + +  +A++ ++KG+++ +A++LAR +FP  V+ LE+EWG +L  I Q D A+ H++E+    KA++AAI A++W K  +I+EN QD   K  T YY  +A+HY +   FE+AE  F++   +  A+  Y  N  W  A  +   +  +   +  Y A+A+ L+  G+F EAE+L++TI  P +AI MY R     DV+RL+ +Y+ E +  T  + A + E+ G++K AE+ +L+ GD++SAVN+Y+   MW DAYR+++        KQV ++WAK +GG++AVKLLN+ G+L + ID+ACE  AFD AF+L +     +M  +H + A  LE+EGR  +A   +++ NKP  AV M++   DW  A+RVA++     + DV  GQAR A    D+ ++E++L+RA +P++ ++ + E  MW DA+R+ + YLPH+   +QE+Y+        KS+  N  +  D+         Q ++WE   ++ +AV   LKI+ D  +        +++ S  KA ++ +KFL  D+     E IG  L  + +      A++      + ++A+NAL   ++W KAK +A+   P+    +E+ YK  LKS G+  EL ++D+I A+++  E + WDK L  A  Q+  P +L KY+A YA  L+  N     L +  +YG+     NF+IYK + ++  +    +    Y    ++R+    +  +    +S E    F + L   H  A+R+A+     ++ E   L  + S+SLLRYTDI+ AD+ FYEAG   ++    Y S+ F+  N YLDLV+AIE  +G+ +L+D + FE++DIP EV LP +++  + +H ++KEWVL+ S+D     +L  D+R +F  SL D     +  PC+++G+PV+++  +   +     +N NKF +  K +++    +V  F+ +W GS
Sbjct:    1 MKLKYLSTILPAQDGEAKISNISCSPNGSRAAIACSDRSVALLDENGVQKDRFTCKPIDAKYGKKSFTVLCMTFSPDSSRIAIGQSDNVLFIYKVGTSWNEKKVIVNKFVQPSAVTCLSWPFDDKILVGQLDGKVRIGLIKTNKCSSLYKTDETVVSIQTHPKRTSFVSAHQDGSIILYNF----SSRTQSKICTLQVPPYNLVF-TNHGLVVATSDRRVLSYTENGVVQQQFDYN-DQSEKEFSSISCDPTAQNVVVASYDRLRLFSWSARRGAWDEGAPLEIQNAYTIGALGWKMDGSTIYAGTVCGGVFSVDCCLRRGMLKSRFETTYVAPSHVILRDVTNDTRTNVISNKGLAIDELKIMGKDRYVIGYTSSSIIIADTESQRFSELEWQSGG-HEKFYFDFNNCCLIINAGEVTVVEYGVDGSLGWVRTELTSPHLLSVQVSGPDVEEHKKVKKLAYLVDPTTISIINLINGQQESFINHTGAVDWIELNERASKLLYRDKRSKVTLVDISSDQRSVLLSFCTYVQWVPMSDVIVAQSGDNLSIWYNPDLPEQVTNMKIKGEVEAVLRDADRTEVIVQEPTAKVAYELDNTQIEFGAALEKRDFDRAVAFLESNTSGTDAYSMWIRVAEMALEHG--NLFVAQRCYAAINDVAKVRKLHDILEIADEASISIGGDGTHFYKVRAMLAIMGRKFKEAERIFLEQNDTESAIGMYTSLHKWDEALELAKVLNYPEYEQLKTSYLRALSDTGQDSKAAELKVSDGDTLSAIQLYIKSNKPLSALSAA-NNDSVLSQDENILRQIADSLVKSQLYDKAGDVYEKLKDFDKAVEYFKKGDAYGKAIQLARFAFPEKVVTLEQEWGLHLEYIGQYDAAVNHFVEANDLKKAVEAAIRAKEWPKALSIVENIQD--QKVRTGYYGEIADHYSNKGDFERAERLFVEAGLFNDAIMMYGKNNKWIDAFRLSEEFHGREATISSYLAKAEDLDEHGRFAEAEQLYITIGMPHKAIQMYDRVGRDDDVLRLVERYHGEHMHETRKRFATQYEERGDLKAAEEQFLKAGDFRSAVNMYKDSEMWSDAYRIAKTEGGENMEKQVLFMWAKSIGGDAAVKLLNKHGMLMEGIDFACETGAFDLAFDLARIGAKDRMGTVHVRLATQLEEEGRLEDASKHYVEGNKPELAVEMFIRDNDWADAERVAKDHCESLLPDVYTGQARRAIEEGDHLRAETFLLRANKPDIILRYFIENEMWPDALRIAQNYLPHQAALIQEEYE--------KSELRNGARGVDS------FVAQAKEWEQQGDWRKAVSALLKINRDSTDNDA-----LIKHSTEKAADLVMKFLMGDE-----EYIGAALGALDEANCNEKAAELLLLFGQSRQAINALCRAKQWAKAKQVAQEYLPEMVPEIEKIYKESLKSEGRLGELIDVDVITAIDMMIENDQWDKALDTAKSQNYRP-LLDKYVAQYAAILVHRNDLSRVLAVLERYGASANPANFSIYKLLMEETLAKPRFD----YTEIARVRNVHLDV-YNALQKESSEHFEEFSRALWALHLIAMRTALEEIGDSVPEVQKLCLKQSLSLLRYTDILVADRIFYEAGAAAKDYGSEYESLGFLLLNHYLDLVDAIE--EGNGELVDYSPFENSDIPTEVSLPTRQWLESAKHEEMKEWVLASSVDDAHAKELVYDKRGVFEASLKDKRGTAE--PCLVTGYPVIES-TVRIGSMVAEKDNLNKFLVVIKSNQTENLLNVQNFVAKWAGS 1731          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Fly
Match: Oseg2 (gene:FBgn0035317 transcript:FBtr0332661)

HSP 1 Score: 1447.95 bits (3747), Expect = 0.000e+0
Identity = 746/1778 (41.96%), Postives = 1137/1778 (63.95%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNV-KTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTG-ASIQISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIGK----VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIISAD-LINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYE--TYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRD--TNNGKSYPLWGKLRDFMFKI--NLDTDSNQSDETL-ISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRY--TNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQI-FKQNKKCISEN-FNKFQIASKVSRSTECADVLRFINEWCGS 5298
            M+LK+++T+L  Q    +I  + WSPN ++ A  + DR I+L+D+ GE++D+F+TK ++   GK +YV+  +AFSPDS+KLAVGQSDSIVYVYKLG+ W+DKK ICNKF Q S+VT LIW     I+ GL DGKVR  + K+NKS ++Y  D   +SL +++   GF+SGH+DG+IIRYF  DE + +  G+V  HP  P+ALAW       A GCD+RI  Y+  GR L+ FD SR   E+EFTVA+ +P+GQ+V  GS++++RI  W+ R+G W E   KE+  LYT+S L W++DG+++ + ++ G + LF+  LR+ +++DKFEL +V PSQ++V ++ + S  + I+S  G EI++V+I G+D Y++A T E+L+L D++ N  SE+PW +SG  E+F F+N  VC+I+  GEL+L+EYG + ILG VRTEF++PH ISVR+NER   N  +NKKLA+L+D KTI V+DL +   S QIS+++KIDW+EL+E    +LFRDKKLRL L +  TG +  LL+  S+VQWVP SDV+VAQS  NL IWYNI  P+ VT   ++G+   ++R +G+T V   +G  +  Y LDEGL+EF TA+ D DFGRAV FLES+      ++MW NLA  AL  G  ++ +A+RCYAALG++ K +YL   I+  ++ E       +   +V A+LALL ++ + AE IYLE   I+ A++MY+ L MWDEA+ +A  +G++  A L+  +  +LL++ Q EKAG+  E  GD   A+SLY+K+  PARAARLAL    I+  + ++ ++ + L++ EL+E AG++   ++    A+  YRKG ++ RA+E+ R   P +V  LEEEWG++LVS  QLD +I HYIE+G+  KA++AA+ A+QW+K   I +  D   +   +Y   LA+H       + AE+  ++ + ++ A+E    +G WERA+ IG ++L   +  +++   A  LE  GKF++AEK+ + ++ P  AI MYKR ++   +IRL+ +Y+ + +D T   LA + E  G +K AE +++  GDWKSAV++Y     WED YRV++      AS+QV Y+WAK +  E AV+LL++LGLLD A+ +AC+   F+FA EL K        E+H K AM LEDEG+F  AEA F+KANKPREA+LM+ H  DW AA  VAEN   D+V +VL+GQA  A  + +YK  E+ L+RA RP+L ++ YK+ S+++DA+R+ +E+ P  L DL     R L     +          D  +I ++   +  ++   +++ +A EC ++I     E     +   +E++ ++A EIC +FL    A ++ + +GPRL+ IK+   A+  Y A D  K+A++  I+ E+W KA+ LA+ ++P  +   YVE++ K  LK  G   +L ++D++ AL++ AE   W +CL  A+   P +L KY+A+YA QLI+      AL +YL YG+P  E +FNIY RI  D  ++R+  T  G +   W +LRDF+F++  +L     QS      S ++ L  +HYYA R+A     Q L  +  ++S++LLR+TD++P DK FYEAG+  R     + AF+  N YLD+ EAIE  +GS  L+D++D   TD P  VPLP+  +   +   H +V+EWVL++SMDQ+++ +LPTD+R ++  SL     G + +PC++SGFPV   + + F+ +   ++ + ++KF +A K+S  +  AD++ F  +W G+
Sbjct:    1 MQLKYLRTLLEGQEQIQRIAGLAWSPNQQRLAIATADRHILLYDDAGERRDKFSTKPANPANGKNSYVIRGLAFSPDSTKLAVGQSDSIVYVYKLGESWNDKKVICNKFPQASAVTALIWLTSGSIIAGLEDGKVRALHSKSNKSQSLYGGDSICISLAANTKGTGFLSGHNDGTIIRYFMTDEAT-EPLGRVVQHPVPPFALAW-PQGGFCAGGCDQRIVFYDSMGRQLRTFDHSRTEGEREFTVAACSPNGQAVAFGSFDRIRIFAWSPRQGAWSESATKEVACLYTLSSLLWRRDGARLALGSVSGAVLLFESVLRRTVWQDKFELIFVAPSQLLVRSLTEPSQALTIESQLGLEIDDVRIMGRDNYLVARTEESLILCDLTRNLSSEVPWTASGHHERFYFENPTVCLIFNVGELSLVEYGENSILGSVRTEFVNPHVISVRLNERG--NAKENKKLAFLLDAKTICVVDLISRMTSGQISHETKIDWLELSETAHKLLFRDKKLRLILVDNYTGKKQTLLSNISFVQWVPQSDVVVAQSNSNLAIWYNIDLPEHVTMQSVRGEAIEVLRENGRTVVRSQDGPSEHNYQLDEGLVEFGTAVNDSDFGRAVHFLESLGDKPAAKAMWHNLALIALEDG--NLRVAQRCYAALGNVSKAYYLAGMIQQADEFEESSGSPGILCPEVRAKLALLGSDLRTAERIYLEQGDIESALKMYQQLGMWDEAVALAERRGYNRIAELKQQHMDYLLSSEQQEKAGQVLEEQGDLQQAMSLYMKANKPARAARLALKTPHILQDEQVMLQVTEGLVRSELYELAGDIAHRLSRPEAALALYRKGGAYARALEIGRVVAPQEVTALEEEWGDWLVSRKQLDASINHYIEAGATQKALEAAVGAKQWRKAVQIAKVLD-EPELIQRYAVDLAKHLAFAGDLDGAEDMLVRANLHKDAIELLNRHGKWERAYLIGEKHLKAEQVRELFVQLAGTLEEQGKFRDAEKVLIAVNEPDLAIAMYKRRELYDSMIRLVERYHKDLLDSTHLHLARQLESRGKLKNAEMHFVASGDWKSAVHMYCSSGRWEDGYRVAKLKGTEGASQQVAYMWAKSMPTEGAVRLLSKLGLLDTAVGFACDSGQFEFAMELCKFAG-KPTDEVHLKIAMSLEDEGKFEAAEAEFLKANKPREAILMYQHAGDWQAALNVAENHLPDAVGEVLIGQASAALETSNYKDYEALLLRAHRPDLIIEHYKQESLYEDALRIAEEHYPSALNDL-----RRLQAQLQRGQAQAQAG-EDAASISRSYLQKAAEFAKKEQFRKAAECLMQIDSSNAE-----DASTLERALLRAAEICNQFLEGQDAQELAQSLGPRLLAIKQIGPAAQLYLAADMPKQAVDVFIKTEQWSKARRLAKEIDPDLQLLAYVEQQQKASLKHEGNIEQLADIDIVSALDLLAEHGEWQRCLEKAKGLNPALLQKYVAVYAAQLIREGNCTTALGLYLSYGAPPIEAHFNIYTRIALDCLALREEQTERGTT---WRQLRDFLFRLLQSLKATPAQSQTKFAASMEQFLLIAHYYATRAA-CKEVQALQPVALRLSLALLRHTDLLPVDKGFYEAGMDLRQAGREAEAFVMLNHYLDVCEAIE--EGSGQLVDHSDLASTDFPSSVPLPEDIHLKNDPSLHEEVREWVLAVSMDQQVDQQLPTDDRGLYESSL-----GPNDLPCMLSGFPVRGRQPVTFQGSSNQVNRDVWSKFSVALKMSPGSGIADIISFTEKWQGA 1748          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Fly
Match: Oseg1 (gene:FBgn0265102 transcript:FBtr0345038)

HSP 1 Score: 53.5286 bits (127), Expect = 2.044e-6
Identity = 73/330 (22.12%), Postives = 134/330 (40.61%), Query Frame = 1
Query: 1687 RVTSFPLKG--DIHNIVRSDGKTEVLVNEG--MHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIGKVKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSG----VPARAARLALSKRDIISADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESG 2652
            RV + P +   ++H +V            G  MH    AL   + +F   +E G F  A         T +    W  LA  AL     HI+IA   Y  + ++    +L     + +  +   V +  + A        FK A  ++L+  +   A+EMY  L M+D A E         +  L     +W  +  +   A E     G+   AI +  + G    +     RL+L++RD + +     +AQ+L   +    A E+++ + ++++ ++ + +   +  A  LA +S P  +  +  + G +L    Q   A Q YI++G
Sbjct:  531 RVGNLPPRAPQNMHGVVVGLCGATAFCLRGNIMHNTPLALGSTMWQF---IEAGLFDEAYQVACLGVTTSD----WEGLAQSALEA--LHINIARDAYVKVRNL---PWLKLIGELRDQQQRSAVPKEVLLAENCAFAGKFKEAARLFLKCGQSSRALEMYTDLRMFDLAQEYIKDGTDQEKKELVRKRAEWAYSVKEPRAAAELLLSAGENQKAIDIVAEQGWADVLYDIGRRLSLTERDSLES-----VAQNLKTLKALPLAAEIFKKLGDEAQVVQLHIEVRDWPEAFRLA-ESLPELLPTVHYQHGQWLAETDQFIEAHQAYIKAG 842          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Fly
Match: Oseg1 (gene:FBgn0265102 transcript:FBtr0076663)

HSP 1 Score: 53.5286 bits (127), Expect = 2.044e-6
Identity = 73/330 (22.12%), Postives = 134/330 (40.61%), Query Frame = 1
Query: 1687 RVTSFPLKG--DIHNIVRSDGKTEVLVNEG--MHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIGKVKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSG----VPARAARLALSKRDIISADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESG 2652
            RV + P +   ++H +V            G  MH    AL   + +F   +E G F  A         T +    W  LA  AL     HI+IA   Y  + ++    +L     + +  +   V +  + A        FK A  ++L+  +   A+EMY  L M+D A E         +  L     +W  +  +   A E     G+   AI +  + G    +     RL+L++RD + +     +AQ+L   +    A E+++ + ++++ ++ + +   +  A  LA +S P  +  +  + G +L    Q   A Q YI++G
Sbjct:  531 RVGNLPPRAPQNMHGVVVGLCGATAFCLRGNIMHNTPLALGSTMWQF---IEAGLFDEAYQVACLGVTTSD----WEGLAQSALEA--LHINIARDAYVKVRNL---PWLKLIGELRDQQQRSAVPKEVLLAENCAFAGKFKEAARLFLKCGQSSRALEMYTDLRMFDLAQEYIKDGTDQEKKELVRKRAEWAYSVKEPRAAAELLLSAGENQKAIDIVAEQGWADVLYDIGRRLSLTERDSLES-----VAQNLKTLKALPLAAEIFKKLGDEAQVVQLHIEVRDWPEAFRLA-ESLPELLPTVHYQHGQWLAETDQFIEAHQAYIKAG 842          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Fly
Match: Gbeta5 (gene:FBgn0030011 transcript:FBtr0071189)

HSP 1 Score: 51.9878 bits (123), Expect = 3.792e-6
Identity = 64/280 (22.86%), Postives = 120/280 (42.86%), Query Frame = 1
Query:   55 QANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFF--QPSSVTCLIWP-IDQPIVLGLLDGKVRVANIKTN---KSHTVYNADKYTVSLCSSSTSKGFISGHSD----------GSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNT---IIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRK 837
            + ++AK+   DWSP+ +   + S D  ++++D     K+   T  +          + A A++P  + +A G  D+ V VY +    D++ A   +      S ++C I+P  DQ I+ G  D    + ++++    +S   ++ D   + L  + T   F+SG  D          G +++ F   EG       V  HP    A+A GS ++   +     D+ + V+ +E  I         +N  +F+V     SG+ +  G YN   +  W+  K
Sbjct:   67 KGHQAKVLCTDWSPDKRHIISSSQDGRLIIWDAFTTNKEHAVTMPTTW--------IMACAYAPSGNFVACGGLDNKVTVYPITS--DEEMAAKKRTVGTHTSYMSCCIYPNSDQQILTGSGDSTCALWDVESGQLLQSFHGHSGDVMAIDLAPNETGNTFVSGSCDRMAFIWDMRSGHVVQSF---EGHQSDVNSVKFHPCGD-AIATGSDDSSCRLYDMRADREVAVFAKESIIF-------GVNSVDFSV-----SGRLLFAG-YNDYTVNLWDTLK 319          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Zebrafish
Match: ift172 (intraflagellar transport 172 [Source:NCBI gene;Acc:432389])

HSP 1 Score: 1908.26 bits (4942), Expect = 0.000e+0
Identity = 904/1774 (50.96%), Postives = 1305/1774 (73.56%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFN----DNEIGKVKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIISA-DLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKI--NLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQNKKCIS-ENFNKFQIASKVSRSTECADVLRFINEWCGSLPASG 5313
            M+LK++KT+L PQ   AK+  + W+PN  KFA C+ DRV++L+DE GEK+DRF TK +D KYGKK YVV ++AFSPDS+K+AV Q+D+I++VYK+G+ W DKK ICNKF Q S+VT L+WP +  I+ GL +GKVR AN KT+KS T+Y  D Y VSL S+ + KG +SGH+DG+++RYF DDEGS +SQGK+ TH   PYALAWG+ N+II AGCDK+I  Y +EG ++Q FD+SRD  EKEFTVA+S+PSGQS+V+GS+++LR+ NW+ RKG W+E   KEI NLYT++ L WKKDGS++ +  +CGG+ +FDCCLR+ IYK+KFE+ YVG SQVIV N+ T  ++++KS +G+EI+EVK+ GKD+Y++AHTS+TL+LGD+ +NKLSE+ WQ SG  EKF F+N+ VCMI+  GEL L+EYG ++ILG VRTEF++PH ISVR+NER+Q  ++ NKKLAYLID+KTI+++DL  G ++  IS+DSKIDW+ELNE G  +LFRDKKLRL L +IE+  +  +L++C YVQWVPGSDV+VAQ+R NLC+WY I  P+RVT FPLKGDI ++ RS+GKTEV+VNEG++ ++Y LDEGLIEF TA++DGD+ RA +FLE++E++ ETE+MW+ L+  +L    + + IAERC+AALGD+ K  +L+ET ++ +    + +      Y+V ARLA+L  NFKLAE  Y+E N +DE +EMY+ L+MWDE I VA  KGH    +LR SYY +L+ TNQ+EKA E KE  GD+  A++LY+K+G+PA+AA LA+SK +++S+ D+++RI  +L+K E +E+AG+L+E   N   A++CYRKGN+F++AV+LAR +FP++V++LEE WG+YLV   Q+D AI HYIE+G  +KAI+AAI+A+QW+K   ILE Q+  ++   KYY  +A++Y S+++FE AE  F+KG   + A++ Y   G WE+AH +  + + + +   +Y ++AQ+LE +GK+KEAE+LF T+D P  AI MYK+NKM  D+IRL+  ++ + +  T   LA+E E +   ++AE +YL+  DWK+AVN+YR  +MWE+AYR+++    A A KQV YLWAK LGGE+AVKLLN+ GLL+ AID+A ++  FDFAFEL +     K+ +IH K AM+LED+G+F+EAE  FIKA KP+EAVLM VH +DW  AQRVAE  D +SV+D+LV QA+F F+ ++++K+E++L+RAQRPELA+K YK+A MW DA+R+CK+YLP KL  LQ++Y+ E           N G         + + +Q ++WE   EY RAV+CYLK+            + ++ K W+KA E+ +KFL++D+A+ V +I+GPRLI+++K+  A++ Y  +D +K A++A IEGEEW+KAK +A+ ++P+ E YV+++YK  LK+ GK   L  +D++ AL++YAE+  W+KC+  A      +LHKY+A+YAT LIK  +    L +Y+++G P + QNFNIYKR+F+++ ++RD +  +++ +W  LRD +  +  NL   S  +      F++ML  +HYYA RSA    +Q L  +  ++SISLLR+T++IPADKAFYEAGL  +   + +MAFIF NR+LDL + I+  +G+ D LD+TDF+DTDIP EVP+P + +   ++  +++EWVL++SMDQ++E  LP DER  +  SL  + TG  S+PCVI+G+PVL+N+  FK+     + +++NKF +A+K + S EC DVL+FI +WCG LP++G
Sbjct:    1 MQLKYMKTLLTPQDGAAKVTCMAWAPNNAKFAVCTIDRVVILYDEQGEKRDRFTTKPADPKYGKKTYVVKSMAFSPDSTKIAVAQTDNIIFVYKIGEEWGDKKVICNKFIQTSAVTSLVWPSEHAIIFGLAEGKVRQANTKTSKSSTIYGTDSYVVSLTSNVSGKGILSGHADGTVVRYFIDDEGSGESQGKLLTHACPPYALAWGT-NSIIVAGCDKKIVAYGKEGNVIQTFDYSRDRAEKEFTVAASSPSGQSIVVGSFDRLRVFNWSPRKGTWDESSPKEIPNLYTITALSWKKDGSRLSVGTLCGGVEMFDCCLRRSIYKNKFEMTYVGLSQVIVRNLSTGTRVVLKSQYGYEIDEVKVMGKDQYLVAHTSDTLLLGDLVSNKLSEVAWQGSGGNEKFFFENETVCMIFNAGELALVEYGSNDILGSVRTEFMNPHLISVRLNERRQRGVEDNKKLAYLIDIKTIAIVDLVGGYNLGTISHDSKIDWLELNETGRKLLFRDKKLRLHLYDIESSVKSTMLSFCPYVQWVPGSDVVVAQNRGNLCVWYTIDSPERVTMFPLKGDIVDLERSNGKTEVIVNEGVNSISYTLDEGLIEFGTAIDDGDYYRATAFLETLEMSAETEAMWKTLSKLSLEA--QQLHIAERCFAALGDVSKARFLNETNKIADAVAKEYDGDGTDHYQVKARLAMLDKNFKLAEMYYMEQNAVDEVMEMYQELHMWDECIAVAEGKGHPELDNLRRSYYSYLMETNQNEKAAEVKENEGDFTGAVNLYLKAGLPAKAAWLAMSKDELLSSQDIVSRITAALIKGEFYERAGDLFERTRNNQRALECYRKGNAFKKAVDLARVAFPAEVVKLEEVWGDYLVQQKQMDAAINHYIEAGRSIKAIEAAIAARQWKKALHILELQE--DRTAAKYYLKIAQYYASVQEFEVAERLFVKGDHIKDAIDMYTQAGRWEQAHKLAVKCMTQEDVSVLYVSRAQELEKEGKYKEAERLFTTVDEPDLAITMYKKNKMYDDMIRLVAVHHKDLLQETHIHLAKELEAESRFQEAEYHYLEGQDWKAAVNMYRVNDMWEEAYRIAKTHGGANAHKQVAYLWAKSLGGEAAVKLLNKFGLLETAIDFAADNYTFDFAFELARLSMKQKIPDIHLKNAMFLEDQGKFNEAEIEFIKAGKPKEAVLMHVHNKDWSNAQRVAEAHDPESVADILVSQAKFCFDQKEFQKAEAFLLRAQRPELAIKYYKDAGMWTDAMRICKDYLPSKLSVLQKEYESE----------GNWG--------VEGMIEQAQEWEQTGEYSRAVDCYLKVK-------DSSNLDLLLKCWMKAAELAIKFLSHDKAVDVSQIVGPRLIQLRKYNEAAELYLNLDLIKNAIDAFIEGEEWNKAKRVAKELDPRLEEYVDKRYKEHLKNQGKVDSLVGVDVVAALDMYAERGQWEKCIDTASKQNFKVLHKYIALYATHLIKEGEVEKVLSLYIQHGVPAYSQNFNIYKRMFQELVNLRDRDCAEAFRMWSDLRDVLLLLCENLTKSSEANSPAHEEFEQMLLVAHYYATRSAAKGIDQ-LSSVAAKLSISLLRHTELIPADKAFYEAGLAAKAVGWENMAFIFLNRFLDLADGID--EGTLDALDHTDFQDTDIPFEVPVPSRLHVTVEKREEIREWVLTVSMDQRVEQVLPKDERGTYEASLVAASTGIRSLPCVITGYPVLRNKIEFKRPGMAANKDDWNKFLMATKTTHSPECQDVLKFITQWCGGLPSAG 1741          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Xenopus
Match: cdk8 (cyclin-dependent kinase 8 [Source:Xenbase;Acc:XB-GENE-962267])

HSP 1 Score: 53.5286 bits (127), Expect = 4.684e-6
Identity = 83/367 (22.62%), Postives = 150/367 (40.87%), Query Frame = 1
Query: 1900 WRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIGKVKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIK--------------SGVPARAARLALSKRDIISADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVE--------------LARDSFPSDVL---RLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAI---------DAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWE 2880
            W  LA +A L  +E ++ A R Y  +G++     L E I+   D+ +       +   LA+   +F LA+++YL ++    A+EM + L  WD A+++A     +  + +   Y   L             E  GDY++A++ Y K              +GV   + R+   +R +  A  +   ++SL K       G + E +   +EA + Y KG  F +A                L   S P   L   + +E  G Y  ++   +NA + +   G Y  AI         D A    Q      I  +  G+    T+ Y+ +A ++   KK  +A ++F+    Y +A++ ++   + E
Sbjct:  623 WNELA-RACLHHME-VEFAIRVYRTIGNVGMVMSL-EQIKGIEDHNL-------LAGHLAMFAGDFNLAQDLYLASSSPAAALEMRRDLQHWDSALQLAKRLAPNQISFISKEYAMQL-------------EFTGDYVNALAHYEKGITGDNKEHDETCLAGVARMSIRMGDIRRGVNQA--LKHPSRSLKK-----DCGAILESMKQLTEAAQLYEKGQYFDKAASVYIRCKNWAKVGELLPHVSSPKIHLQYAKAKEADGKYKEAVLAYENA-KDWDNLGDYGSAIQFLVLSKCNDEAFQLAQQHNQMEIYADIIGSENTSTEDYQSIALYFEGEKKHFQAGKFFLLCGQYERALKHFIKCPITE 958          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Xenopus
Match: cdk8 (cyclin-dependent kinase 8 [Source:Xenbase;Acc:XB-GENE-962267])

HSP 1 Score: 53.1434 bits (126), Expect = 5.192e-6
Identity = 83/367 (22.62%), Postives = 150/367 (40.87%), Query Frame = 1
Query: 1900 WRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIGKVKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIK--------------SGVPARAARLALSKRDIISADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVE--------------LARDSFPSDVL---RLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAI---------DAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWE 2880
            W  LA +A L  +E ++ A R Y  +G++     L E I+   D+ +       +   LA+   +F LA+++YL ++    A+EM + L  WD A+++A     +  + +   Y   L             E  GDY++A++ Y K              +GV   + R+   +R +  A  +   ++SL K       G + E +   +EA + Y KG  F +A                L   S P   L   + +E  G Y  ++   +NA + +   G Y  AI         D A    Q      I  +  G+    T+ Y+ +A ++   KK  +A ++F+    Y +A++ ++   + E
Sbjct:  637 WNELA-RACLHHME-VEFAIRVYRTIGNVGMVMSL-EQIKGIEDHNL-------LAGHLAMFAGDFNLAQDLYLASSSPAAALEMRRDLQHWDSALQLAKRLAPNQISFISKEYAMQL-------------EFTGDYVNALAHYEKGITGDNKEHDETCLAGVARMSIRMGDIRRGVNQA--LKHPSRSLKK-----DCGAILESMKQLTEAAQLYEKGQYFDKAASVYIRCKNWAKVGELLPHVSSPKIHLQYAKAKEADGKYKEAVLAYENA-KDWDNLGDYGSAIQFLVLSKCNDEAFQLAQQHNQMEIYADIIGSENTSTEDYQSIALYFEGEKKHFQAGKFFLLCGQYERALKHFIKCPITE 972          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Mouse
Match: Ift172 (intraflagellar transport 172 [Source:MGI Symbol;Acc:MGI:2682064])

HSP 1 Score: 1927.91 bits (4993), Expect = 0.000e+0
Identity = 909/1773 (51.27%), Postives = 1292/1773 (72.87%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFN--DNEIGK--VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIIS-ADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKI--NLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQNKKCIS-ENFNKFQIASKVSRSTECADVLRFINEWCGSLPAS 5310
            M+LKH++T+L PQ   AK+  + WS N  KFA C+ DRV++L+DE+GE++D+F+TK +D KYG+K+Y+V  +AFSPDS+K+A+GQ+D+I+YVYK+G+ W DKK ICNKF Q S+VTCL WP +  IV GL +GKVR+AN KTNKS T+Y  + Y V+L ++ + KG +SGH+DG+I+RYFFDDEGS +SQGK+  HP  PYALAW ++N+I+AAGCD+RI  Y +EG +LQ FD+SRD  E+EFT A+++P GQSVV+GSY++LR+ NW+ R+ +WEE + KEI NLYTV+ L WK+DGS++C   +CGG+  FDCCLR+ IYK+KFEL YVGPSQVIV N+ +  ++++KS++G+E+ EVKI GK++Y++AHTS+TL+LGD++TN+LSEI WQ SG  EK+ F+N+NVCMI+  GELTL+EYG ++ LG VRTEF++PH ISVRINER Q  ++ NKKLAYL+D+KTI+++DL  G +I  IS++S++DW+ELNE G  +LFRD+KLRL L +IE+ S+  +LN+CSYVQWVPGSDV+VAQ+R +LC+WYNI+ P+RVT   ++GD+  + R  GKTEV+V EG+  VAY LDEGLIEF TA++DG++ RA +FLE++E+T ETE+MW+ L+  AL      +  AERC++ALG + K  +LHET  + +    E G      Y+V ARLA+L  N+KLAE I+LE N ++EA++MY+ L+ W+E I VA  KGH +   LR  YYQWL++T Q E+AGE +E  GD L AISLY+K+G+PA+AARL L++ ++++  +L+  I  +L+K EL+E+AG+L+E + N   A++CY KGN+F +AVELAR +FP +V+RLEE WG++LV   QLD AI HYIE+   +KAI+AA+ A+QW+K   IL+ QD N    +KYY  +A+HY S++++E AEE + KG   + A++ Y   G WE+AH +  + +   +   +Y  QAQ++E  GK++EAE+L++T++ P  AI M+K++K+  D+IRL+ K++P+ +  T   L +E E +G +++AE +YL+  +WK+ VN+YR   +WE+AYRV++A   A A K V YLWAK LGGE+AV+LLN+LGLL+  ID+A ++ +F+FAFEL +     K  EIH KYAMYLEDEG+F EAEA FI+A KP+EAVLM+VH QDW+AAQRVAE  D DSV++VLVGQAR A   +D++K+E  L+RAQRP LA+  YKEA +W DA+R+CK+Y+P +LE LQE+Y+RE       + K   G         + L +Q RQWE   EY RAV+CYLK+              +MEK W+KA E+ +KFL   ++++V+ ++GP+LI I K   A++ Y  +D VKEA++A IEGEEW+KAK +A+ ++P+YE YV++ YK FLK+ GK   L  +D++ AL++Y EQ  WDKC+  A      ILHKY+A+YAT LI+      AL +Y+++G+P   QNFNIYKRIF D+ S   TNN ++Y  W  LRD +F +  NL   S  +      F+ ML  SHYYA RSA  +  Q L+ +  ++S+SLLR+T ++PADKAFYEAG   +   + +MAFIF NR+LDL +AIE  +G+ D LD++DF+DTDIP EVPLP K++    +  +V++WVL++SMDQ+LE  LP DER ++  SL  + TG  ++PC+I+G+P+L+N+  FK+  K  + +N+NKF +A K S S  C DVL+FI++WCG LP++
Sbjct:    1 MQLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADMKYGRKSYMVKGMAFSPDSTKIAIGQTDNIIYVYKIGEDWGDKKVICNKFIQTSAVTCLQWPAEYVIVFGLAEGKVRLANTKTNKSSTIYGTESYVVALTTNCSGKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAW-ATNSIVAAGCDRRIVAYGKEGHVLQTFDYSRDPQEREFTTAAASPGGQSVVLGSYDRLRVFNWSPRRSIWEEAKPKEIANLYTVTALAWKRDGSRLCAGTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKNLSSGTRVVLKSHYGYEVEEVKILGKERYLVAHTSDTLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVCMIFNAGELTLVEYGSNDSLGSVRTEFMNPHLISVRINERCQRGMEDNKKLAYLVDIKTIAIVDLIGGYNIGTISHESRVDWLELNETGHKLLFRDRKLRLHLYDIESCSKTMILNFCSYVQWVPGSDVLVAQNRNSLCVWYNIEAPERVTMSSIRGDVVGLERGGGKTEVMVTEGVTTVAYTLDEGLIEFGTAIDDGNYTRATAFLETLEMTPETEAMWKTLSKLALEA--RQLHTAERCFSALGHVAKARFLHETNEIADQVSREYGGEGTDFYQVRARLAMLEKNYKLAEMIFLEQNAVEEAMDMYQELHRWEECIAVAEAKGHPALEKLRRDYYQWLMDTQQEERAGELQESQGDGLAAISLYLKAGLPAKAARLVLTREELLANTELVEHITTALIKGELYERAGDLFEKIRNPQRALECYCKGNAFMKAVELARLAFPVEVVRLEEAWGDHLVQQKQLDAAINHYIEARCSIKAIEAALGARQWKKAIYILDLQDRNTA--SKYYPRVAQHYASLQEYEIAEELYTKGDRTKDAIDMYTQAGRWEQAHKLAMKCMRPEDVSVLYITQAQEMEKQGKYREAERLYVTVEEPDLAITMFKKHKLYDDMIRLVGKHHPDLLSDTHLHLGKELEAEGRLQEAEYHYLEAQEWKATVNMYRSSGLWEEAYRVAKAHGGANAHKHVAYLWAKSLGGEAAVRLLNKLGLLEATIDHAADNCSFEFAFELSRLAFKHKAPEIHLKYAMYLEDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPGQLEALQEEYERE------ATKKGGRG--------VEGLVEQARQWEQAGEYSRAVDCYLKVR-------DSGSSGLMEKCWMKAAELSIKFLPPQRSLEVVRVVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQHYKEFLKNQGKVDSLVGVDVVAALDLYVEQGQWDKCIETATKQNYKILHKYVALYATHLIREGGYAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNNAEAYHSWADLRDVLFNLCENLVKSSEANSAAHEEFEMMLLISHYYATRSAAQSIKQ-LETVAARLSVSLLRHTQLLPADKAFYEAGTAAKEVGWENMAFIFLNRFLDLTDAIE--EGTLDALDHSDFQDTDIPFEVPLPAKQHVPEAQREEVRDWVLTVSMDQRLEQVLPRDERGVYEASLVAASTGVRALPCLITGYPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQWCGGLPST 1744          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Mouse
Match: Ift172 (intraflagellar transport 172 [Source:MGI Symbol;Acc:MGI:2682064])

HSP 1 Score: 280.411 bits (716), Expect = 2.552e-85
Identity = 134/231 (58.01%), Postives = 181/231 (78.35%), Query Frame = 1
Query: 1096 EVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVT-----SFPLKGDIHNIVRSDGKTEVLVNEG 1770
            EVKI GK++Y++AHTS+TL+LGD++TN+LSEI WQ SG  EK+ F+N+NVCMI+  GELTL+EYG ++ LG VRTEF++PH ISVRINER Q  ++ NKKLAYL+D+KTI+++DL  G +I  IS++S++DW+ELNE G  +LFRD+KLRL L +IE+ S+  +LN+CSYVQWVPGSDV+VAQ+R +LC+WYNI+ P+RVT      + L GD  +  R+ G  E L   G
Sbjct:    3 EVKILGKERYLVAHTSDTLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVCMIFNAGELTLVEYGSNDSLGSVRTEFMNPHLISVRINERCQRGMEDNKKLAYLVDIKTIAIVDLIGGYNIGTISHESRVDWLELNETGHKLLFRDRKLRLHLYDIESCSKTMILNFCSYVQWVPGSDVLVAQNRNSLCVWYNIEAPERVTMSSIRGYSLLGDPGDDSRNRGNVENLEQTG 233          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Mouse
Match: Ift172 (intraflagellar transport 172 [Source:MGI Symbol;Acc:MGI:2682064])

HSP 1 Score: 241.891 bits (616), Expect = 1.093e-71
Identity = 136/289 (47.06%), Postives = 187/289 (64.71%), Query Frame = 1
Query: 1435 DLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFN--DNEIG--KVKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGE 2286
            DL  G +I  IS++S++DW+ELNE G  +LFRD+KLRL L +IE+ S+  +LN+CSYVQWVPGSDV+VAQ+R +LC                               V+V EG+  VAY LDEGLIEF TA++DG++ RA +FLE++E+T ETE+MW+ L+  AL      +  AERC++ALG + K  +LHET  + +    E G      Y+V ARLA+L  N+KLAE I+LE N ++EA++MY+ L+ W+E I VA  KGH +   LR  YYQWL++T Q E+AGE
Sbjct:    2 DLIGGYNIGTISHESRVDWLELNETGHKLLFRDRKLRLHLYDIESCSKTMILNFCSYVQWVPGSDVLVAQNRNSLC-------------------------------VMVTEGVTTVAYTLDEGLIEFGTAIDDGNYTRATAFLETLEMTPETEAMWKTLSKLAL--EARQLHTAERCFSALGHVAKARFLHETNEIADQVSREYGGEGTDFYQVRARLAMLEKNYKLAEMIFLEQNAVEEAMDMYQELHRWEECIAVAEAKGHPALEKLRRDYYQWLMDTQQEERAGE 257          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Mouse
Match: Ift172 (intraflagellar transport 172 [Source:MGI Symbol;Acc:MGI:2682064])

HSP 1 Score: 79.337 bits (194), Expect = 3.106e-17
Identity = 31/61 (50.82%), Postives = 47/61 (77.05%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTK 201
            M+LKH++T+L PQ   AK+  + WS N  KFA C+ DRV++L+DE+GE++D+F+TK +D K
Sbjct:    1 MQLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADMK 61          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Mouse
Match: Wdr19 (WD repeat domain 19 [Source:MGI Symbol;Acc:MGI:2443231])

HSP 1 Score: 53.9138 bits (128), Expect = 2.566e-6
Identity = 97/416 (23.32%), Postives = 164/416 (39.42%), Query Frame = 1
Query: 1900 WRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIGKVKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPA------RAARLALSKRDIISADLINRIAQSLLKFE---LFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEW---GNYLVSIHQLDNAIQHYIES---GSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYR---------ILAEHYLSIKKFEKAEEYFIKGSFYRQAVE-AYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRL 3072
            W  LA KA L  +E ++ A R    +GD+     L E I+   D  +       +   LA+ TN+F LA+++YL +N    A+EM + L  WD A+++A          +   Y   L             E  GDY++A++ Y K G+              +++  I   D I R A   LK     L    G + E +   SEA + Y KG  + RA         S  +R  + W   G  L  +      +Q+       G Y +A+ A  +A+QW  V  I  +   N +      R         ++A  +L +  +  A ++ +      +A   A  +N M   A  IG+      +    Y++ A   E + +  +A K FL   +   A+  + +    +D + +
Sbjct:  678 WSELA-KACLHHME-VEFAIRVSRTMGDVGTVMSL-EQIKGIEDYNL-------LAGHLAMFTNDFNLAQDLYLASNCPVAALEMRRDLQHWDSALQLAKRLAPDQIPFISKEYAIQL-------------EFTGDYVNALAHYEK-GITGDNKEHDEVCLAGVAQMSIRMGD-IRRGANQALKHPSRVLKRDCGAILENMKQFSEAAQLYEKGQYYDRAA--------SVYIRC-KNWAKVGELLPHVSSPKIHLQYAKAKEADGRYKEAVVAYENAKQWNSVIRIYLDHLNNPEKAVSIVRETQSLDGAKMVARFFLQLGDYGSAIQFLVLSKCNNEAFTLAQQHNKMEIYADIIGAEDTTNED----YQSIALYFEGEKRHFQAGKFFLLCGQYSRALKHFLKCPSSEDNVAI 1055          

HSP 2 Score: 52.373 bits (124), Expect = 6.712e-6
Identity = 68/284 (23.94%), Postives = 117/284 (41.20%), Query Frame = 1
Query: 2443 FEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYV--KAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSI----KKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKY--NPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAE 3270
            F  A +LY        A++  R    +  A++LA+   P  +  + +E+   L       NA+ HY E G     K  D    A   Q    + + + G N+      R+L     +I    K+F +A + + KG +Y +A   Y+    W +   +    L      K++   A+  E DG++KEA             +  Y+  K    VIR+   +  NPE+    +S + E    DG  K   +++LQ+GD+ SA+          +A+ ++Q  N  E
Sbjct:  733 FNLAQDLYLASNCPVAALEMRRDLQHWDSALQLAKRLAPDQIPFISKEYAIQLEFTGDYVNALAHY-EKGITGDNKEHDEVCLAGVAQMSIRMGDIRRGANQALKHPSRVLKRDCGAILENMKQFSEAAQLYEKGQYYDRAASVYIRCKNWAKVGEL----LPHVSSPKIHLQYAKAKEADGRYKEA-------------VVAYENAKQWNSVIRIYLDHLNNPEK---AVSIVRETQSLDG-AKMVARFFLQLGDYGSAIQFLVLSKCNNEAFTLAQQHNKME 994          
BLAST of Intraflagellar transport protein 172 vs. UniProt
Match: sp|Q9JKU3|IF172_RAT (Intraflagellar transport protein 172 homolog OS=Rattus norvegicus OX=10116 GN=Ift172 PE=1 SV=1)

HSP 1 Score: 1929.45 bits (4997), Expect = 0.000e+0
Identity = 909/1773 (51.27%), Postives = 1294/1773 (72.98%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFN--DNEIGK--VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIIS-ADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKI--NLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQNKKCIS-ENFNKFQIASKVSRSTECADVLRFINEWCGSLPAS 5310
            M+LKH++T+L PQ   AK+  + WS N  KFA C+ DRV++L+DE+GE++D+F+TK +D KYG+K+Y+V  +AFSPDS+K+A+GQ+D+I+YVYK+G+ W DKK ICNKF Q S+VTCL WP +  IV GL +GKVR+AN KTNKS T+Y  D Y V+L ++ + KG +SGH+DG+I+RYFFDDEGS +SQGK+  HP  PYALAW ++N+I+AAGCD+RI  Y +EG +LQ FD+SRD  E+EFT A+++P GQSVV+GSY++LR+ NW+ R+ +WEE + KEI NLYTV+ L WK+DGS++C   +CGG+  FDCCLR+ IYK+KFEL YVGPSQ+IV N+ +  ++++KS++G+E+ EVKI GK++Y++AHTS+TL+LGD++TN+LSEIPWQ SG  EK+ F+N+NVCMI+  GELTL+EYG ++ LG VRTEF++PH ISVRINER Q  ++ NKKLAYL+D+KTI+++DL  G +I  IS++S++DW+ELNE G  +LFRD+KLRL L +IE+ S+  +LN+CSYVQWVPGSDV+VAQ+R +LC+WYNI+ P+RVT   ++GD+  + R  GKTEV+V EG+  VAY LDEGLIEF TA++DG++ RA +FLE++E+T ETE+MW+ L+  AL      +  AERC++ALG + K  +LHET  + +    E G      Y+V ARLA+L  N+KLAE I+LE N ++EA++MY+ L+ WDE I VA  KGH +   LR  YYQ L++T Q E+AGE +E  GD L AISLY+K+G+PA+AARL L++ ++++  +L+  I  +L+K EL+E+AG+L+E + N   A++CY KGN+F +AVELAR +FP +V+RLEE WG++LV   QLD AI HYIE+   +KAI+AA+ A+QW+K   IL+ QD N    +KYY  +A+HY S++++E AEE + KG   + A++ Y   G WE+AH +  + +   +   +Y  QAQ++E  GK++EAE+L++T++ P  AI M+K++K+  D+IRL+ K++P+ +  T   L +E E +G +++AE +YL+  +WK+ VN+YR   +WE+AYRV++A   A A K V YLWAK LGGE+AV+LLN+LGLL+ AID+A ++ +F+FAFEL +     K  EIH +YAMYLEDEG+F EAEA FI+A KP+EAVLM+VH QDW+AAQRVAE  D DSV++VLVGQAR A   +D++K+E  L+RAQRP LA+  YKEA +W DA+R+CK+Y+P +LE LQE+Y+RE       + K   G         + L +Q RQWE   EY RAV+CYLK+              +MEK W+KA E+ +KFL   ++++V+ ++GP+LI I K   +++ Y  +D VKEA++A IEGEEW+KAK +A+ ++P+YE YV++ YK FLK+ GK   L  +D++ AL++Y EQ  WDKC+  A      ILHKY+A+YAT LI+      AL +Y+++G+P   QNFNIYKRIF D+ S   TNN ++Y  W  LRD +F +  NL   S  +      F+ ML  +HYYA RSA  +  Q L+ +  ++S+SLLR+T ++PADKAFYEAG   +   + +MAFIFFNR+LDL +AIE  +G+ D LD++DF+DTDIP EVPLP K++    +  +V++WVL++SMDQ+LE  LP DER ++  SL  + TG  ++PC+I+G+P+L+N+  FK+  K  + +N+NKF +A K S S  C DVL+FI++WCG LP++
Sbjct:    1 MQLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADMKYGRKSYMVKGMAFSPDSTKIAIGQTDNIIYVYKIGEDWGDKKVICNKFIQTSAVTCLQWPAEYIIVFGLAEGKVRLANTKTNKSSTIYGTDSYVVALTTNCSGKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAW-ATNSIVAAGCDRRIVAYGKEGHVLQTFDYSRDPQEREFTTAAASPGGQSVVLGSYDRLRVFNWSPRRSIWEEAKPKEIANLYTVTALAWKRDGSRLCAGTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQLIVKNLSSGTRVVLKSHYGYEVEEVKILGKERYLVAHTSDTLLLGDLNTNRLSEIPWQGSGGNEKYFFENENVCMIFNAGELTLVEYGSNDSLGSVRTEFMNPHLISVRINERCQRGMEDNKKLAYLVDIKTIAIVDLIGGYNIGTISHESRVDWLELNETGHKLLFRDRKLRLHLYDIESCSKTMILNFCSYVQWVPGSDVLVAQNRNSLCVWYNIEAPERVTMSSIRGDVVGLERGGGKTEVMVTEGVTTVAYTLDEGLIEFGTAIDDGNYTRATAFLETLEMTPETEAMWKTLSKLALEA--RQLHTAERCFSALGHVAKARFLHETNEIADQVSREYGGEGTDFYQVRARLAMLEKNYKLAEMIFLEQNAVEEAMDMYQELHRWDECIAVAEAKGHPALEKLRRDYYQRLMDTQQEERAGELQESQGDGLAAISLYLKAGLPAKAARLVLTREELLANTELVEHITTALIKGELYERAGDLFEKIRNPQRALECYCKGNAFMKAVELARLAFPVEVVRLEEAWGDHLVQQKQLDAAINHYIEARCSIKAIEAALGARQWKKAIYILDLQDRNTA--SKYYPRVAQHYASLQEYEIAEELYTKGDRTKDAIDMYTQAGRWEQAHKLAMKCMRPEDVSVLYITQAQEMEKQGKYREAERLYVTVEEPDLAITMFKKHKLYDDMIRLVGKHHPDLLSDTHLHLGKELETEGRLQEAEYHYLEAQEWKATVNMYRSSGLWEEAYRVAKAHGGANAHKHVAYLWAKSLGGEAAVRLLNKLGLLEAAIDHAADNCSFEFAFELSRLALKHKTPEIHLRYAMYLEDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPGQLEALQEEYERE------ATKKGGRG--------VEGLVEQARQWEQAGEYSRAVDCYLKVR-------DSGSSGLMEKCWMKAAELSIKFLPPQRSLEVVRVVGPQLIGIGKHSASAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQHYKEFLKNQGKVDSLVGVDVVAALDLYVEQGQWDKCIETATKQNYKILHKYVALYATHLIREGGYAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNNAEAYHSWADLRDVLFNLCENLVKSSEANSAAHEEFEMMLLIAHYYATRSAAQSIKQ-LETVAARLSVSLLRHTQLLPADKAFYEAGTAAKEVGWENMAFIFFNRFLDLTDAIE--EGTLDALDHSDFQDTDIPFEVPLPAKQHVPEAQREEVRDWVLTVSMDQRLEQVLPRDERGVYEASLVAASTGVRALPCLITGYPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQWCGGLPST 1744          
BLAST of Intraflagellar transport protein 172 vs. UniProt
Match: sp|Q6VH22|IF172_MOUSE (Intraflagellar transport protein 172 homolog OS=Mus musculus OX=10090 GN=Ift172 PE=1 SV=1)

HSP 1 Score: 1927.91 bits (4993), Expect = 0.000e+0
Identity = 909/1773 (51.27%), Postives = 1292/1773 (72.87%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFN--DNEIGK--VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIIS-ADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKI--NLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQNKKCIS-ENFNKFQIASKVSRSTECADVLRFINEWCGSLPAS 5310
            M+LKH++T+L PQ   AK+  + WS N  KFA C+ DRV++L+DE+GE++D+F+TK +D KYG+K+Y+V  +AFSPDS+K+A+GQ+D+I+YVYK+G+ W DKK ICNKF Q S+VTCL WP +  IV GL +GKVR+AN KTNKS T+Y  + Y V+L ++ + KG +SGH+DG+I+RYFFDDEGS +SQGK+  HP  PYALAW ++N+I+AAGCD+RI  Y +EG +LQ FD+SRD  E+EFT A+++P GQSVV+GSY++LR+ NW+ R+ +WEE + KEI NLYTV+ L WK+DGS++C   +CGG+  FDCCLR+ IYK+KFEL YVGPSQVIV N+ +  ++++KS++G+E+ EVKI GK++Y++AHTS+TL+LGD++TN+LSEI WQ SG  EK+ F+N+NVCMI+  GELTL+EYG ++ LG VRTEF++PH ISVRINER Q  ++ NKKLAYL+D+KTI+++DL  G +I  IS++S++DW+ELNE G  +LFRD+KLRL L +IE+ S+  +LN+CSYVQWVPGSDV+VAQ+R +LC+WYNI+ P+RVT   ++GD+  + R  GKTEV+V EG+  VAY LDEGLIEF TA++DG++ RA +FLE++E+T ETE+MW+ L+  AL      +  AERC++ALG + K  +LHET  + +    E G      Y+V ARLA+L  N+KLAE I+LE N ++EA++MY+ L+ W+E I VA  KGH +   LR  YYQWL++T Q E+AGE +E  GD L AISLY+K+G+PA+AARL L++ ++++  +L+  I  +L+K EL+E+AG+L+E + N   A++CY KGN+F +AVELAR +FP +V+RLEE WG++LV   QLD AI HYIE+   +KAI+AA+ A+QW+K   IL+ QD N    +KYY  +A+HY S++++E AEE + KG   + A++ Y   G WE+AH +  + +   +   +Y  QAQ++E  GK++EAE+L++T++ P  AI M+K++K+  D+IRL+ K++P+ +  T   L +E E +G +++AE +YL+  +WK+ VN+YR   +WE+AYRV++A   A A K V YLWAK LGGE+AV+LLN+LGLL+  ID+A ++ +F+FAFEL +     K  EIH KYAMYLEDEG+F EAEA FI+A KP+EAVLM+VH QDW+AAQRVAE  D DSV++VLVGQAR A   +D++K+E  L+RAQRP LA+  YKEA +W DA+R+CK+Y+P +LE LQE+Y+RE       + K   G         + L +Q RQWE   EY RAV+CYLK+              +MEK W+KA E+ +KFL   ++++V+ ++GP+LI I K   A++ Y  +D VKEA++A IEGEEW+KAK +A+ ++P+YE YV++ YK FLK+ GK   L  +D++ AL++Y EQ  WDKC+  A      ILHKY+A+YAT LI+      AL +Y+++G+P   QNFNIYKRIF D+ S   TNN ++Y  W  LRD +F +  NL   S  +      F+ ML  SHYYA RSA  +  Q L+ +  ++S+SLLR+T ++PADKAFYEAG   +   + +MAFIF NR+LDL +AIE  +G+ D LD++DF+DTDIP EVPLP K++    +  +V++WVL++SMDQ+LE  LP DER ++  SL  + TG  ++PC+I+G+P+L+N+  FK+  K  + +N+NKF +A K S S  C DVL+FI++WCG LP++
Sbjct:    1 MQLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADMKYGRKSYMVKGMAFSPDSTKIAIGQTDNIIYVYKIGEDWGDKKVICNKFIQTSAVTCLQWPAEYVIVFGLAEGKVRLANTKTNKSSTIYGTESYVVALTTNCSGKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAW-ATNSIVAAGCDRRIVAYGKEGHVLQTFDYSRDPQEREFTTAAASPGGQSVVLGSYDRLRVFNWSPRRSIWEEAKPKEIANLYTVTALAWKRDGSRLCAGTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKNLSSGTRVVLKSHYGYEVEEVKILGKERYLVAHTSDTLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVCMIFNAGELTLVEYGSNDSLGSVRTEFMNPHLISVRINERCQRGMEDNKKLAYLVDIKTIAIVDLIGGYNIGTISHESRVDWLELNETGHKLLFRDRKLRLHLYDIESCSKTMILNFCSYVQWVPGSDVLVAQNRNSLCVWYNIEAPERVTMSSIRGDVVGLERGGGKTEVMVTEGVTTVAYTLDEGLIEFGTAIDDGNYTRATAFLETLEMTPETEAMWKTLSKLALEA--RQLHTAERCFSALGHVAKARFLHETNEIADQVSREYGGEGTDFYQVRARLAMLEKNYKLAEMIFLEQNAVEEAMDMYQELHRWEECIAVAEAKGHPALEKLRRDYYQWLMDTQQEERAGELQESQGDGLAAISLYLKAGLPAKAARLVLTREELLANTELVEHITTALIKGELYERAGDLFEKIRNPQRALECYCKGNAFMKAVELARLAFPVEVVRLEEAWGDHLVQQKQLDAAINHYIEARCSIKAIEAALGARQWKKAIYILDLQDRNTA--SKYYPRVAQHYASLQEYEIAEELYTKGDRTKDAIDMYTQAGRWEQAHKLAMKCMRPEDVSVLYITQAQEMEKQGKYREAERLYVTVEEPDLAITMFKKHKLYDDMIRLVGKHHPDLLSDTHLHLGKELEAEGRLQEAEYHYLEAQEWKATVNMYRSSGLWEEAYRVAKAHGGANAHKHVAYLWAKSLGGEAAVRLLNKLGLLEATIDHAADNCSFEFAFELSRLAFKHKAPEIHLKYAMYLEDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPGQLEALQEEYERE------ATKKGGRG--------VEGLVEQARQWEQAGEYSRAVDCYLKVR-------DSGSSGLMEKCWMKAAELSIKFLPPQRSLEVVRVVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQHYKEFLKNQGKVDSLVGVDVVAALDLYVEQGQWDKCIETATKQNYKILHKYVALYATHLIREGGYAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNNAEAYHSWADLRDVLFNLCENLVKSSEANSAAHEEFEMMLLISHYYATRSAAQSIKQ-LETVAARLSVSLLRHTQLLPADKAFYEAGTAAKEVGWENMAFIFLNRFLDLTDAIE--EGTLDALDHSDFQDTDIPFEVPLPAKQHVPEAQREEVRDWVLTVSMDQRLEQVLPRDERGVYEASLVAASTGVRALPCLITGYPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQWCGGLPST 1744          
BLAST of Intraflagellar transport protein 172 vs. UniProt
Match: sp|Q9UG01|IF172_HUMAN (Intraflagellar transport protein 172 homolog OS=Homo sapiens OX=9606 GN=IFT172 PE=1 SV=2)

HSP 1 Score: 1918.28 bits (4968), Expect = 0.000e+0
Identity = 908/1773 (51.21%), Postives = 1287/1773 (72.59%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFN--DNEIGK--VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIIS-ADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKI--NLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQNKKCIS-ENFNKFQIASKVSRSTECADVLRFINEWCGSLPAS 5310
            M LKH++T+L PQ   AK+  + WS N  KFA C+ DRV++L+DE+GE++D+F+TK +D KYG+K+Y+V  +AFSPDS+K+A+GQ+D+I+YVYK+G+ W DKK ICNKF Q S+VTCL WP +  IV GL +GKVR+AN KTNKS T+Y  + Y VSL ++ + KG +SGH+DG+I+RYFFDDEGS +SQGK+  HP  PYALAW ++N+I+AAGCD++I  Y +EG +LQ FD+SRD  E+EFT A S+P GQSVV+GSY++LR+ NW  R+ +WEE + KEI NLYT++ L WK+DGS++C+  +CGG+  FDCCLR+ IYK+KFEL YVGPSQVIV N+ +  ++++KS++G+E+ EVKI GK++Y++AHTSETL+LGD++TN+LSEI WQ SG  EK+ F+N+NVCMI+  GELTL+EYG ++ LG VRTEF++PH ISVRINER Q   + NKKLAYLID+KTI+++DL  G +I  +S++S++DW+ELNE G  +LFRD+KLRL L +IE+ S+  +LN+CSY+QWVPGSDV+VAQ+R +LC+WYNI+ P+RVT F ++GD+  + R  GKTEV+V EG+  VAY LDEGLIEF TA++DG++ RA +FLE++E+T ETE+MW+ L+  AL      + IAERC++ALG + K  +LHET  + +    E G      Y+V ARLA+L  N+KLAE I+LE N ++EA+ MY+ L+ WDE I VA  KGH +   LR SYYQWL++T Q E+AGE +E  GD L AISLY+K+G+PA+AARL L++ ++++  +L+  I  +L+K EL+E+AG+L+E + N  +A++CYRKGN+F +AVELAR +FP +V++LEE WG++LV   QLD AI HYIE+   +KAI+AA+ A+QW+K   IL+ QD N    +KYY ++A+HY S++++E AEE + KG   + A++ Y   G WE+AH +  + +   +   +Y  QAQ++E  GK++EAE+L++T+  P  AI MYK++K+  D+IRL+ K++P+ +  T   L +E E +G +++AE +YL+  +WK+ VN+YR   +WE+AYRV++    A A K V YLWAK LGGE+AV+LLN+LGLL+ A+D+A ++ +F+FAFEL +     K  E+H KYAM+LEDEG+F EAEA FI+A KP+EAVLM+VH QDW+AAQRVAE  D DSV++VLVGQAR A   +D++K+E  L+RAQRP LA+  YKEA +W DA+R+CK+Y+P +LE LQE+Y+RE       + K   G         +   +Q R WE   EY RAV+CYLK+              + EK W+KA E+ +KFL   + ++V+  +GP+LI I K   A++ Y  +D VKEA++A IEGEEW+KAK +A+ ++P+YE YV++ YK FLK+ GK   L  +D+I AL++Y EQ  WDKC+  A      ILHKY+A+YAT LI+   S  AL +Y+++G+P   QNFNIYKRIF D+ S   TN  ++Y  W  LRD +F +  NL   S  +      F+ ML  +HYYA RSA  +  Q L+ +  ++S+SLLR+T ++P DKAFYEAG+  +   + +MAFIF NR+LDL +AIE  +G+ D LD++DF+DTDIP EVPLP K++    E  +V++WVL++SMDQ+LE  LP DER  +  SL  + TG  ++PC+I+G+P+L+N+  FK+  K  + +N+NKF +A K S S  C DVL+FI++WCG LP++
Sbjct:    1 MHLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADMKYGRKSYMVKGMAFSPDSTKIAIGQTDNIIYVYKIGEDWGDKKVICNKFIQTSAVTCLQWPAEYIIVFGLAEGKVRLANTKTNKSSTIYGTESYVVSLTTNCSGKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAW-ATNSIVAAGCDRKIVAYGKEGHMLQTFDYSRDPQEREFTTAVSSPGGQSVVLGSYDRLRVFNWIPRRSIWEEAKPKEITNLYTITALAWKRDGSRLCVGTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKNLSSGTRVVLKSHYGYEVEEVKILGKERYLVAHTSETLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVCMIFNAGELTLVEYGNNDTLGSVRTEFMNPHLISVRINERCQRGTEDNKKLAYLIDIKTIAIVDLIGGYNIGTVSHESRVDWLELNETGHKLLFRDRKLRLHLYDIESCSKTMILNFCSYMQWVPGSDVLVAQNRNSLCVWYNIEAPERVTMFTIRGDVIGLERGGGKTEVMVMEGVTTVAYTLDEGLIEFGTAIDDGNYIRATAFLETLEMTPETEAMWKTLSKLALEA--RQLHIAERCFSALGQVAKARFLHETNEIADQVSREYGGEGTDFYQVRARLAMLEKNYKLAEMIFLEQNAVEEAMGMYQELHRWDECIAVAEAKGHPALEKLRRSYYQWLMDTQQEERAGELQESQGDGLAAISLYLKAGLPAKAARLVLTREELLANTELVEHITAALIKGELYERAGDLFEKIHNPQKALECYRKGNAFMKAVELARLAFPVEVVKLEEAWGDHLVQQKQLDAAINHYIEARCSIKAIEAALGARQWKKAIYILDLQDRNTA--SKYYPLVAQHYASLQEYEIAEELYTKGDRTKDAIDMYTQAGRWEQAHKLAMKCMRPEDVSVLYITQAQEMEKQGKYREAERLYVTVQEPDLAITMYKKHKLYDDMIRLVGKHHPDLLSDTHLHLGKELEAEGRLQEAEYHYLEAQEWKATVNMYRASGLWEEAYRVARTQGGANAHKHVAYLWAKSLGGEAAVRLLNKLGLLEAAVDHAADNCSFEFAFELSRLALKHKTPEVHLKYAMFLEDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPSQLEALQEEYERE------ATKKGARG--------VEGFVEQARHWEQAGEYSRAVDCYLKVR-------DSGNSGLAEKCWMKAAELSIKFLPPQRNMEVVLAVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQHYKEFLKNQGKVDSLVGVDVIAALDLYVEQGQWDKCIETATKQNYKILHKYVALYATHLIREGSSAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNCAEAYHSWADLRDVLFNLCENLVKSSEANSPAHEEFKTMLLIAHYYATRSAAQSVKQ-LETVAARLSVSLLRHTQLLPVDKAFYEAGIAAKAVGWDNMAFIFLNRFLDLTDAIE--EGTLDGLDHSDFQDTDIPFEVPLPAKQHVPEAEREEVRDWVLTVSMDQRLEQVLPRDERGAYEASLVAASTGVRALPCLITGYPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQWCGGLPST 1744          
BLAST of Intraflagellar transport protein 172 vs. UniProt
Match: sp|Q5RHH4|IF172_DANRE (Intraflagellar transport protein 172 homolog OS=Danio rerio OX=7955 GN=ift172 PE=2 SV=1)

HSP 1 Score: 1908.26 bits (4942), Expect = 0.000e+0
Identity = 904/1774 (50.96%), Postives = 1305/1774 (73.56%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFN----DNEIGKVKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIISA-DLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKI--NLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQNKKCIS-ENFNKFQIASKVSRSTECADVLRFINEWCGSLPASG 5313
            M+LK++KT+L PQ   AK+  + W+PN  KFA C+ DRV++L+DE GEK+DRF TK +D KYGKK YVV ++AFSPDS+K+AV Q+D+I++VYK+G+ W DKK ICNKF Q S+VT L+WP +  I+ GL +GKVR AN KT+KS T+Y  D Y VSL S+ + KG +SGH+DG+++RYF DDEGS +SQGK+ TH   PYALAWG+ N+II AGCDK+I  Y +EG ++Q FD+SRD  EKEFTVA+S+PSGQS+V+GS+++LR+ NW+ RKG W+E   KEI NLYT++ L WKKDGS++ +  +CGG+ +FDCCLR+ IYK+KFE+ YVG SQVIV N+ T  ++++KS +G+EI+EVK+ GKD+Y++AHTS+TL+LGD+ +NKLSE+ WQ SG  EKF F+N+ VCMI+  GEL L+EYG ++ILG VRTEF++PH ISVR+NER+Q  ++ NKKLAYLID+KTI+++DL  G ++  IS+DSKIDW+ELNE G  +LFRDKKLRL L +IE+  +  +L++C YVQWVPGSDV+VAQ+R NLC+WY I  P+RVT FPLKGDI ++ RS+GKTEV+VNEG++ ++Y LDEGLIEF TA++DGD+ RA +FLE++E++ ETE+MW+ L+  +L    + + IAERC+AALGD+ K  +L+ET ++ +    + +      Y+V ARLA+L  NFKLAE  Y+E N +DE +EMY+ L+MWDE I VA  KGH    +LR SYY +L+ TNQ+EKA E KE  GD+  A++LY+K+G+PA+AA LA+SK +++S+ D+++RI  +L+K E +E+AG+L+E   N   A++CYRKGN+F++AV+LAR +FP++V++LEE WG+YLV   Q+D AI HYIE+G  +KAI+AAI+A+QW+K   ILE Q+  ++   KYY  +A++Y S+++FE AE  F+KG   + A++ Y   G WE+AH +  + + + +   +Y ++AQ+LE +GK+KEAE+LF T+D P  AI MYK+NKM  D+IRL+  ++ + +  T   LA+E E +   ++AE +YL+  DWK+AVN+YR  +MWE+AYR+++    A A KQV YLWAK LGGE+AVKLLN+ GLL+ AID+A ++  FDFAFEL +     K+ +IH K AM+LED+G+F+EAE  FIKA KP+EAVLM VH +DW  AQRVAE  D +SV+D+LV QA+F F+ ++++K+E++L+RAQRPELA+K YK+A MW DA+R+CK+YLP KL  LQ++Y+ E           N G         + + +Q ++WE   EY RAV+CYLK+            + ++ K W+KA E+ +KFL++D+A+ V +I+GPRLI+++K+  A++ Y  +D +K A++A IEGEEW+KAK +A+ ++P+ E YV+++YK  LK+ GK   L  +D++ AL++YAE+  W+KC+  A      +LHKY+A+YAT LIK  +    L +Y+++G P + QNFNIYKR+F+++ ++RD +  +++ +W  LRD +  +  NL   S  +      F++ML  +HYYA RSA    +Q L  +  ++SISLLR+T++IPADKAFYEAGL  +   + +MAFIF NR+LDL + I+  +G+ D LD+TDF+DTDIP EVP+P + +   ++  +++EWVL++SMDQ++E  LP DER  +  SL  + TG  S+PCVI+G+PVL+N+  FK+     + +++NKF +A+K + S EC DVL+FI +WCG LP++G
Sbjct:    1 MQLKYMKTLLTPQDGAAKVTCMAWAPNNAKFAVCTIDRVVILYDEQGEKRDRFTTKPADPKYGKKTYVVKSMAFSPDSTKIAVAQTDNIIFVYKIGEEWGDKKVICNKFIQTSAVTSLVWPSEHAIIFGLAEGKVRQANTKTSKSSTIYGTDSYVVSLTSNVSGKGILSGHADGTVVRYFIDDEGSGESQGKLLTHACPPYALAWGT-NSIIVAGCDKKIVAYGKEGNVIQTFDYSRDRAEKEFTVAASSPSGQSIVVGSFDRLRVFNWSPRKGTWDESSPKEIPNLYTITALSWKKDGSRLSVGTLCGGVEMFDCCLRRSIYKNKFEMTYVGLSQVIVRNLSTGTRVVLKSQYGYEIDEVKVMGKDQYLVAHTSDTLLLGDLVSNKLSEVAWQGSGGNEKFFFENETVCMIFNAGELALVEYGSNDILGSVRTEFMNPHLISVRLNERRQRGVEDNKKLAYLIDIKTIAIVDLVGGYNLGTISHDSKIDWLELNETGRKLLFRDKKLRLHLYDIESSVKSTMLSFCPYVQWVPGSDVVVAQNRGNLCVWYTIDSPERVTMFPLKGDIVDLERSNGKTEVIVNEGVNSISYTLDEGLIEFGTAIDDGDYYRATAFLETLEMSAETEAMWKTLSKLSLEA--QQLHIAERCFAALGDVSKARFLNETNKIADAVAKEYDGDGTDHYQVKARLAMLDKNFKLAEMYYMEQNAVDEVMEMYQELHMWDECIAVAEGKGHPELDNLRRSYYSYLMETNQNEKAAEVKENEGDFTGAVNLYLKAGLPAKAAWLAMSKDELLSSQDIVSRITAALIKGEFYERAGDLFERTRNNQRALECYRKGNAFKKAVDLARVAFPAEVVKLEEVWGDYLVQQKQMDAAINHYIEAGRSIKAIEAAIAARQWKKALHILELQE--DRTAAKYYLKIAQYYASVQEFEVAERLFVKGDHIKDAIDMYTQAGRWEQAHKLAVKCMTQEDVSVLYVSRAQELEKEGKYKEAERLFTTVDEPDLAITMYKKNKMYDDMIRLVAVHHKDLLQETHIHLAKELEAESRFQEAEYHYLEGQDWKAAVNMYRVNDMWEEAYRIAKTHGGANAHKQVAYLWAKSLGGEAAVKLLNKFGLLETAIDFAADNYTFDFAFELARLSMKQKIPDIHLKNAMFLEDQGKFNEAEIEFIKAGKPKEAVLMHVHNKDWSNAQRVAEAHDPESVADILVSQAKFCFDQKEFQKAEAFLLRAQRPELAIKYYKDAGMWTDAMRICKDYLPSKLSVLQKEYESE----------GNWG--------VEGMIEQAQEWEQTGEYSRAVDCYLKVK-------DSSNLDLLLKCWMKAAELAIKFLSHDKAVDVSQIVGPRLIQLRKYNEAAELYLNLDLIKNAIDAFIEGEEWNKAKRVAKELDPRLEEYVDKRYKEHLKNQGKVDSLVGVDVVAALDMYAERGQWEKCIDTASKQNFKVLHKYIALYATHLIKEGEVEKVLSLYIQHGVPAYSQNFNIYKRMFQELVNLRDRDCAEAFRMWSDLRDVLLLLCENLTKSSEANSPAHEEFEQMLLVAHYYATRSAAKGIDQ-LSSVAAKLSISLLRHTELIPADKAFYEAGLAAKAVGWENMAFIFLNRFLDLADGID--EGTLDALDHTDFQDTDIPFEVPVPSRLHVTVEKREEIREWVLTVSMDQRVEQVLPKDERGTYEASLVAASTGIRSLPCVITGYPVLRNKIEFKRPGMAANKDDWNKFLMATKTTHSPECQDVLKFITQWCGGLPSAG 1741          
BLAST of Intraflagellar transport protein 172 vs. UniProt
Match: sp|Q9W040|OSM1_DROME (Intraflagellar transport protein 172 homolog OS=Drosophila melanogaster OX=7227 GN=Oseg2 PE=3 SV=3)

HSP 1 Score: 1447.95 bits (3747), Expect = 0.000e+0
Identity = 746/1778 (41.96%), Postives = 1137/1778 (63.95%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNV-KTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTG-ASIQISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIGK----VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIISAD-LINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYE--TYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRD--TNNGKSYPLWGKLRDFMFKI--NLDTDSNQSDETL-ISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRY--TNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQI-FKQNKKCISEN-FNKFQIASKVSRSTECADVLRFINEWCGS 5298
            M+LK+++T+L  Q    +I  + WSPN ++ A  + DR I+L+D+ GE++D+F+TK ++   GK +YV+  +AFSPDS+KLAVGQSDSIVYVYKLG+ W+DKK ICNKF Q S+VT LIW     I+ GL DGKVR  + K+NKS ++Y  D   +SL +++   GF+SGH+DG+IIRYF  DE + +  G+V  HP  P+ALAW       A GCD+RI  Y+  GR L+ FD SR   E+EFTVA+ +P+GQ+V  GS++++RI  W+ R+G W E   KE+  LYT+S L W++DG+++ + ++ G + LF+  LR+ +++DKFEL +V PSQ++V ++ + S  + I+S  G EI++V+I G+D Y++A T E+L+L D++ N  SE+PW +SG  E+F F+N  VC+I+  GEL+L+EYG + ILG VRTEF++PH ISVR+NER   N  +NKKLA+L+D KTI V+DL +   S QIS+++KIDW+EL+E    +LFRDKKLRL L +  TG +  LL+  S+VQWVP SDV+VAQS  NL IWYNI  P+ VT   ++G+   ++R +G+T V   +G  +  Y LDEGL+EF TA+ D DFGRAV FLES+      ++MW NLA  AL  G  ++ +A+RCYAALG++ K +YL   I+  ++ E       +   +V A+LALL ++ + AE IYLE   I+ A++MY+ L MWDEA+ +A  +G++  A L+  +  +LL++ Q EKAG+  E  GD   A+SLY+K+  PARAARLAL    I+  + ++ ++ + L++ EL+E AG++   ++    A+  YRKG ++ RA+E+ R   P +V  LEEEWG++LVS  QLD +I HYIE+G+  KA++AA+ A+QW+K   I +  D   +   +Y   LA+H       + AE+  ++ + ++ A+E    +G WERA+ IG ++L   +  +++   A  LE  GKF++AEK+ + ++ P  AI MYKR ++   +IRL+ +Y+ + +D T   LA + E  G +K AE +++  GDWKSAV++Y     WED YRV++      AS+QV Y+WAK +  E AV+LL++LGLLD A+ +AC+   F+FA EL K        E+H K AM LEDEG+F  AEA F+KANKPREA+LM+ H  DW AA  VAEN   D+V +VL+GQA  A  + +YK  E+ L+RA RP+L ++ YK+ S+++DA+R+ +E+ P  L DL     R L     +          D  +I ++   +  ++   +++ +A EC ++I     E     +   +E++ ++A EIC +FL    A ++ + +GPRL+ IK+   A+  Y A D  K+A++  I+ E+W KA+ LA+ ++P  +   YVE++ K  LK  G   +L ++D++ AL++ AE   W +CL  A+   P +L KY+A+YA QLI+      AL +YL YG+P  E +FNIY RI  D  ++R+  T  G +   W +LRDF+F++  +L     QS      S ++ L  +HYYA R+A     Q L  +  ++S++LLR+TD++P DK FYEAG+  R     + AF+  N YLD+ EAIE  +GS  L+D++D   TD P  VPLP+  +   +   H +V+EWVL++SMDQ+++ +LPTD+R ++  SL     G + +PC++SGFPV   + + F+ +   ++ + ++KF +A K+S  +  AD++ F  +W G+
Sbjct:    1 MQLKYLRTLLEGQEQIQRIAGLAWSPNQQRLAIATADRHILLYDDAGERRDKFSTKPANPANGKNSYVIRGLAFSPDSTKLAVGQSDSIVYVYKLGESWNDKKVICNKFPQASAVTALIWLTSGSIIAGLEDGKVRALHSKSNKSQSLYGGDSICISLAANTKGTGFLSGHNDGTIIRYFMTDEAT-EPLGRVVQHPVPPFALAW-PQGGFCAGGCDQRIVFYDSMGRQLRTFDHSRTEGEREFTVAACSPNGQAVAFGSFDRIRIFAWSPRQGAWSESATKEVACLYTLSSLLWRRDGARLALGSVSGAVLLFESVLRRTVWQDKFELIFVAPSQLLVRSLTEPSQALTIESQLGLEIDDVRIMGRDNYLVARTEESLILCDLTRNLSSEVPWTASGHHERFYFENPTVCLIFNVGELSLVEYGENSILGSVRTEFVNPHVISVRLNERG--NAKENKKLAFLLDAKTICVVDLISRMTSGQISHETKIDWLELSETAHKLLFRDKKLRLILVDNYTGKKQTLLSNISFVQWVPQSDVVVAQSNSNLAIWYNIDLPEHVTMQSVRGEAIEVLRENGRTVVRSQDGPSEHNYQLDEGLVEFGTAVNDSDFGRAVHFLESLGDKPAAKAMWHNLALIALEDG--NLRVAQRCYAALGNVSKAYYLAGMIQQADEFEESSGSPGILCPEVRAKLALLGSDLRTAERIYLEQGDIESALKMYQQLGMWDEAVALAERRGYNRIAELKQQHMDYLLSSEQQEKAGQVLEEQGDLQQAMSLYMKANKPARAARLALKTPHILQDEQVMLQVTEGLVRSELYELAGDIAHRLSRPEAALALYRKGGAYARALEIGRVVAPQEVTALEEEWGDWLVSRKQLDASINHYIEAGATQKALEAAVGAKQWRKAVQIAKVLD-EPELIQRYAVDLAKHLAFAGDLDGAEDMLVRANLHKDAIELLNRHGKWERAYLIGEKHLKAEQVRELFVQLAGTLEEQGKFRDAEKVLIAVNEPDLAIAMYKRRELYDSMIRLVERYHKDLLDSTHLHLARQLESRGKLKNAEMHFVASGDWKSAVHMYCSSGRWEDGYRVAKLKGTEGASQQVAYMWAKSMPTEGAVRLLSKLGLLDTAVGFACDSGQFEFAMELCKFAG-KPTDEVHLKIAMSLEDEGKFEAAEAEFLKANKPREAILMYQHAGDWQAALNVAENHLPDAVGEVLIGQASAALETSNYKDYEALLLRAHRPDLIIEHYKQESLYEDALRIAEEHYPSALNDL-----RRLQAQLQRGQAQAQAG-EDAASISRSYLQKAAEFAKKEQFRKAAECLMQIDSSNAE-----DASTLERALLRAAEICNQFLEGQDAQELAQSLGPRLLAIKQIGPAAQLYLAADMPKQAVDVFIKTEQWSKARRLAKEIDPDLQLLAYVEQQQKASLKHEGNIEQLADIDIVSALDLLAEHGEWQRCLEKAKGLNPALLQKYVAVYAAQLIREGNCTTALGLYLSYGAPPIEAHFNIYTRIALDCLALREEQTERGTT---WRQLRDFLFRLLQSLKATPAQSQTKFAASMEQFLLIAHYYATRAA-CKEVQALQPVALRLSLALLRHTDLLPVDKGFYEAGMDLRQAGREAEAFVMLNHYLDVCEAIE--EGSGQLVDHSDLASTDFPSSVPLPEDIHLKNDPSLHEEVREWVLAVSMDQQVDQQLPTDDRGLYESSL-----GPNDLPCMLSGFPVRGRQPVTFQGSSNQVNRDVWSKFSVALKMSPGSGIADIISFTEKWQGA 1748          
BLAST of Intraflagellar transport protein 172 vs. TrEMBL
Match: gnl|BL_ORD_ID|23482698 (tr|A0A210PPZ5|A0A210PPZ5_MIZYE Intraflagellar transport protein 172 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08953 PE=4 SV=1)

HSP 1 Score: 2063.89 bits (5346), Expect = 0.000e+0
Identity = 969/1777 (54.53%), Postives = 1343/1777 (75.58%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIGK------VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIIS-ADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKI------NLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQNKKCIS-ENFNKFQIASKVSRSTECADVLRFINEWCGSLP 5304
            M+LKH+K +L PQ   AKICAI W+ + +K A C+ DRV++LFDE GEKKD+F+ + +D+KYGKK+Y V  +AFS DSSK+AVGQ+D+I+YVYK+G+ W DKK ICNKF Q S+VTC+IWP +QPIV GL DGKVR ANIKTNKS T+Y  D Y VSL  + + KGF+SGH+DG+I+RYFFDDEGS DSQGKV THP  PYALA+ S N+I+AAGCDKRI  Y R+GR  Q FDFSR+ +E EFT A  +PSGQSVVIGS++KLR LNW+ R+ MW+E ++KEI NLYTV+ L WKKDGS++    +CGG+ +FDCCL++ IYK+KFE+ +VG SQVIV N+    ++++KS++G+EI+EV+I GKD+Y+IAHTS+T++LGD+++NKLSEIPW  +G  EK+ FDN++VCMI+  GEL+LIEYG +E+LG VRTEF++PH ISVR+NERKQ  +++NKK+AYL+DLKT++++DL +G ++ Q++++SK+DW+ELNE G  +LFRDK++RL L +IET  R  +LNYCSYVQWVPGSDV+V Q+R NLC+WYNI  P+RVT FPLKGDI ++ R+DGKT+V+VNEG+  ++Y LDEGLIEF TA++DGDF RAVSFLE++E++ ETE+MW+ L+  ++      + IAERCY+ALGDI K  Y+ ET R+    EI +         Y+V AR +++   +K AE IYLE N +DEA+EMY+ ++MWDEAIEVA  K H    +L+ SYY WL+ T Q EKAGE KE   DY+ AI++Y+K+G+PARAARLA S+ +++S ADLI+RIA  L+K ELFE+AG++YE + ++  AM C++KG ++ RAV+LAR S+PS+V++LEE+WG+YLV   QLDNAI H+IE+G+  KA++AAI+++QW K   ILE QD +     KYY+ +A+HY S+ + E AE Y+++    R+AV+ Y N G WE AH + S Y+   +   +Y +QA+QLE  GKFKEAEKL++ +  P  AI MYK+NKM  D+I+L+  ++P+ +  T   LA+E E + N++QAE +YL+   WK+AVN+YR ++MW++A+RV++    A A+KQV YLWA+ LGG+SAVKLLN+ GLL+ AIDYA E+ AFDFAFEL +  N +K+ +IH K+AMYLEDEGRF++AE  FI+A KP+EAVLM+VH QDWD+AQRVAE+ DSDSV+DVLVGQARFAF  +D+ ++ESYL+RAQRPELAVK YK++ MW DA+RVCKEY+PHKL+ LQ++YD E+      +DK   G         +++  Q R+WES+ EY RA+ECYLK++  L+      ++ ++EK W+KAGE+ +KFL   +A  V+EI+ P+L +++K   A++ Y + D +KEA++  I GE+W+KAK +A+ + P+ E YV+E+YK  LK+ GKA  L ++D++ AL++YA +  W+KCL  A+   P +LHKY A+YAT+LIK   S  A+++Y+KYG+P   QNFNIYKRIF DI + RD N  ++Y +W  LRD  + +      + D++S Q +E    F+ ML  SHYYA RS  MA +++LD + T++S+SLLR+TDIIPADKAFYEAG++CR  +  +MAF+F NR+LD+ EAIE  +GS D+LD++DF+DTDIP E+PLP+K +  +Q+H D++EWVL++SMDQK+E  LP DERN++  SL    TG  S+PCVI+G+PVL+N+  FKQ  K  + +++NKF +A+KVS S E  DVL+FI  WCG+ P
Sbjct:    1 MQLKHMKALLQPQDGAAKICAITWAASNQKMAVCTSDRVVILFDEQGEKKDKFSLRPADSKYGKKSYTVKGLAFSSDSSKIAVGQTDNIIYVYKIGEDWGDKKTICNKFVQQSAVTCMIWPNEQPIVFGLADGKVRAANIKTNKSSTIYGTDSYVVSLAPNPSGKGFLSGHADGAIVRYFFDDEGSGDSQGKVCTHPCPPYALAF-SQNSIVAAGCDKRIIAYGRDGRSFQHFDFSRENDEHEFTTAVCSPSGQSVVIGSFDKLRTLNWSPRRQMWDEPKLKEIRNLYTVTALAWKKDGSRVTCGTLCGGVEIFDCCLKRTIYKNKFEMTHVGLSQVIVKNMSNQSRVVLKSHYGYEIDEVRIMGKDRYLIAHTSDTILLGDLTSNKLSEIPWHGTGGNEKYYFDNESVCMIFNAGELSLIEYGANEVLGSVRTEFMNPHLISVRLNERKQRGVEENKKIAYLLDLKTVAIVDLISGLTLGQVNHESKVDWLELNETGRKMLFRDKRMRLNLYDIETKQRTTILNYCSYVQWVPGSDVVVGQNRTNLCVWYNIDAPERVTMFPLKGDIVDLERTDGKTDVVVNEGVTTISYTLDEGLIEFGTAIDDGDFERAVSFLETLEMSAETEAMWKTLSKLSMED--RRLHIAERCYSALGDIAKARYMKETFRIAE--EIAQSTGGDGFSNYRVRARFSIMEKRYKEAEGIYLEQNHVDEAMEMYQEMHMWDEAIEVAEAKNHPELDNLKRSYYGWLMETGQEEKAGEVKEQEEDYMAAINMYMKAGLPARAARLATSRDELMSNADLISRIASELIKGELFERAGDMYEKIHDQQRAMDCFKKGRAYHRAVKLARSSYPSEVVKLEEDWGDYLVQQKQLDNAISHFIEAGATKKAVEAAINSRQWAKAVQILELQDPSMS--AKYYKKIADHYASVGELETAERYYVESGCTREAVDMYNNAGRWEMAHKLASGYMKADDVATLYISQARQLEDQGKFKEAEKLYVAVQEPDMAITMYKKNKMYGDMIKLVKTHHPDLVQDTHLHLAKELEAENNLRQAEHHYLEADTWKAAVNMYRDQDMWDEAHRVAKNAGGATAAKQVAYLWARSLGGDSAVKLLNKFGLLEAAIDYAAENCAFDFAFELARLANKNKLPDIHLKHAMYLEDEGRFADAEREFIQAQKPKEAVLMYVHNQDWDSAQRVAESHDSDSVADVLVGQARFAFEEKDFTRAESYLLRAQRPELAVKYYKDSGMWQDALRVCKEYVPHKLQALQDEYDHEM------TDKSTKGA--------ESMVQQAREWESSGEYARAIECYLKVTPQLIS-----DLNVVEKCWLKAGELAIKFLGQSKAQTVVEIVAPKLAEMRKHGKAAELYLSADLIKEAIDMFISGEDWNKAKKVAKELEPRLEAYVDERYKDHLKNEGKAEALASVDVVGALDMYAGKGEWEKCLQTAEQQNPKVLHKYAALYATELIKGGDSRRAMEIYVKYGAPANAQNFNIYKRIFTDIVNTRDLNRPEAYKIWADLRDVFYDLCENMGKSQDSNSPQHEE----FEWMLLISHYYAARSVAMA-HKSLDSVATKLSVSLLRHTDIIPADKAFYEAGMMCRATNQENMAFVFLNRFLDISEAIE--EGSLDMLDHSDFQDTDIPFEIPLPEKAHLTSQQHEDIREWVLAVSMDQKVEQVLPRDERNVYEASLMAPETGIRSLPCVITGYPVLRNQLDFKQAGKVANKDDWNKFLMATKVSHSAELQDVLKFIGVWCGATP 1744          
BLAST of Intraflagellar transport protein 172 vs. TrEMBL
Match: gnl|BL_ORD_ID|20345316 (tr|A0A1S3IJ99|A0A1S3IJ99_LINUN intraflagellar transport protein 172 homolog OS=Lingula unguis OX=7574 GN=LOC106164727 PE=4 SV=1)

HSP 1 Score: 2063.5 bits (5345), Expect = 0.000e+0
Identity = 972/1774 (54.79%), Postives = 1338/1774 (75.42%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIGKV------KQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIIS-ADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKI--NLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQNKKCIS-ENFNKFQIASKVSRSTECADVLRFINEWCGSLPA 5307
            M+LKH+KT+L PQ   AKI A+ WSPN +K A  + DRV++L+DE GE +D+F TK +D K+GKK+Y+V  IAFSPDS+KLAV Q+D+I+YVYK+G+ W +KK ICNKF Q S+VTCLIWP DQ I+ GL DGKVR+ N+KTNKS T+Y++D Y VSLCS+ + KG +SGH+DGSI+RYFFDDEGS D+QGK+A H   PYALAW ++N+ IAAGCDKRI  Y R+GR +QQFD+SRD +EKEFT A  +PSGQS+VIGS+++LR+ NW+ RK  W+E + KEI  LYT++ L W+KDGS++C   +CG + LFDCCLR+ IYK+KFE+ YVG SQVIV N+ T  ++++KSY+G+EI+EVKI G D+Y++AHT++TL+LGD+ T+KLSE+PWQ +G  EKF FDN++VCMI+  GEL+L+EYG +EILG VRTEF++PH ISVR+NERKQ  +D NKK+AYLIDLKTI+++DL  G ++ QI++DSKIDW+ELNE G  +LFRDK+LRL L +IET +R  +LNYCSYVQWVPGSDV+VAQ+R +LCIWYNI  P+RVT FPLKGDI ++ +++GKTEV+VN+G+  V+Y+LDEGLIEF TA++DGD+ RAV++LES+E++ ETE+MW+ L+  +L  G  HI  AERCYAALGD+ K  YL ET R     E  K       + YKV AR+A+L   FK AE+IYLE N +DEA+EMY+ ++ WDEAIEVA  K H    +LR +YYQWL++T+Q EKAGE KE  GDY+ AI+LY+K+G+PARAARLA S  +++S +++INRIA +L++ E +E+AG+L+E + +  +A +CYR G ++++AV+LAR +FP  V+ LE+EWG++LV+  QLD AI HYIE+G+ +KA++AAI+++QW K + ILE QD       KYYR +A HY S+ + E AE+YF++    ++A++ Y N G WE+AH + ++ + + E   +Y  QA  LE +GKFKEAE+L++T++ P  AI MYK+ KM  D++RL+ +++PE +  T   LA+E   + N++QAE ++L+  DWK AVN+YR  +MW++AYRV+++   A  +KQV YLWAK LGG+SAVKLL + GLL+ AIDYA E+ AFDFAF+L K+   +KM +IH KYAMYLEDEG+F EAEA FIKA KP+EAVLM+VH QDWD+AQRVAE  D DSV+DVLVGQARFAF  ++Y+K+ES+L+RAQRPELA+K YKEASMW DA+RVCKEY+PHKL+ LQ++YD+E+     K          DT      L  Q + WE++ EY RAVECY+K++  +       +  +M K WIKAGE+ LKFL  D+A+ V++++GPRL++ KK+  A++ Y  +D  K+A++A I GEEW+KAK +A+ + P+YE YV+++YK +LK+ GKA  L  +D++ AL++Y E+  WDKCL  A+     +LHKY+AMYA+QLIK N +  AL +Y+KYG+P  +QNFNIYKRIF DI+ M   N  ++Y  W  LRD +F +  N+   +  +      F+ ML  +HYYA RSA M S+++L+ + T++S+SLLR+ ++IPADKAFYEAG++C+   + +MAF+  NRYLD+VEAIE  +GS D+LDNTDF+DTDIP E  LP+K + N  +H +VKEWVL++SMDQ++E  LP DER+ +  SL  + TG  S+PCVISG+PVL+N+  FK+  K  + +++NKF +A+KVS S EC D L+FI  WCG+ P+
Sbjct:    1 MQLKHMKTVLAPQEGAAKITAMAWSPNNQKMAVVTSDRVVLLYDETGEMRDKFTTKPADAKFGKKSYIVKGIAFSPDSAKLAVAQTDNIIYVYKIGEDWGEKKVICNKFVQQSAVTCLIWPPDQNIIFGLADGKVRLGNMKTNKSSTIYSSDSYVVSLCSNPSGKGIMSGHADGSIVRYFFDDEGSGDAQGKIAVHSCPPYALAW-ATNSFIAAGCDKRIVAYGRDGRSIQQFDYSRDDDEKEFTTAVCSPSGQSIVIGSFDRLRVFNWSPRKATWDESKPKEIPYLYTITALAWRKDGSRLCAGTLCGAVELFDCCLRRAIYKNKFEMTYVGLSQVIVRNLSTGTRVVLKSYYGYEIDEVKILGNDRYLVAHTTDTLILGDLQTSKLSEVPWQGTGGNEKFYFDNESVCMIFNAGELSLVEYGNNEILGSVRTEFMNPHLISVRLNERKQRGVDDNKKMAYLIDLKTIAIIDLLFGVTLGQINHDSKIDWLELNETGRKLLFRDKRLRLNLYDIETQTRTTILNYCSYVQWVPGSDVVVAQNRGSLCIWYNIDAPERVTMFPLKGDIVDLEKNNGKTEVIVNDGITTVSYSLDEGLIEFGTAIDDGDYARAVAYLESLEMSAETEAMWKTLSKLSLEAGQLHI--AERCYAALGDVSKARYLRETNR--QAEEAAKTTGGDGFQYYKVRARMAILDKQFKQAESIYLEQNNLDEAMEMYQEMHKWDEAIEVAQAKAHPELENLRRTYYQWLMDTSQEEKAGEVKEREGDYMGAIALYMKAGLPARAARLATSNEELMSNSEVINRIATALIQGEFYERAGDLFEKIRSYQKAAECYRMGKAYRQAVDLARYAFPEQVVNLEQEWGDHLVAQKQLDAAINHYIEAGATLKAVEAAINSRQWAKATQILELQDSEMS--AKYYRKIAVHYASVGELEVAEKYFLEADCIKEAIDMYNNAGKWEKAHRLAAQCMKQDEVAVLYIKQANSLEAEGKFKEAERLYVTVEEPDMAITMYKKQKMYNDMVRLVKQFHPELLQDTHLHLAQELHAENNLRQAEIHFLEAKDWKGAVNMYRSNDMWDEAYRVAKSHGGANPAKQVAYLWAKSLGGDSAVKLLTKFGLLEAAIDYAAENCAFDFAFDLAKTSMKNKMPDIHLKYAMYLEDEGKFKEAEAEFIKAAKPKEAVLMYVHNQDWDSAQRVAEEHDPDSVADVLVGQARFAFEEKEYQKAESFLLRAQRPELAIKYYKEASMWQDALRVCKEYIPHKLQQLQDEYDKEMITKSTKG--------ADT------LIQQAKDWEASGEYTRAVECYVKVTPKVTN-----DTNMMTKCWIKAGELALKFLGADKAVDVVQVLGPRLVEAKKYSNAAELYLGLDMYKDAIDAFIAGEEWNKAKKVAKELEPRYEPYVDDRYKDYLKNQGKADALAGVDVVAALDMYVEKGQWDKCLETAEKQNAKVLHKYVAMYASQLIKENNTEAALDLYVKYGTPPSQQNFNIYKRIFSDIAGMHGLNKAEAYRTWADLRDMLFDLCENMTRSAEANSPAHEEFENMLLVAHYYATRSASM-SHKSLEAVATKLSVSLLRHIELIPADKAFYEAGMMCKIAGWENMAFVLLNRYLDIVEAIE--EGSLDMLDNTDFQDTDIPFEFSLPEKPHLNEDKHEEVKEWVLAVSMDQRVEQVLPKDERDTYEASLVAANTGIRSLPCVISGYPVLRNKLEFKRPGKAANKDDWNKFLMATKVSHSQECQDTLKFIGTWCGAAPS 1745          
BLAST of Intraflagellar transport protein 172 vs. TrEMBL
Match: gnl|BL_ORD_ID|15739805 (tr|R7TM65|R7TM65_CAPTE WD_REPEATS_REGION domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_128053 PE=4 SV=1)

HSP 1 Score: 2030.76 bits (5260), Expect = 0.000e+0
Identity = 945/1770 (53.39%), Postives = 1329/1770 (75.08%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHET--IRMFNDNEIGK-VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIIS-ADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFK--INLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQNKKCIS-ENFNKFQIASKVSRSTECADVLRFINEWCGSLP 5304
            M+LKH+KT+LPPQ   AKICA+ WS N  K A C+ DRV++L+DE GE++D+FATK SD KYGKK+Y+V  +AFSPDS+K+A+GQ+D+I++VYK+GD W DKK ICNKF Q S+VTCLIWP DQ I+ G  DGKVR+AN+KTNKS T+YN D Y VS+  + + KG ISGH+DGSI+R+FFDDEG+ DSQGK+  HP  PYALAWG+ N+I+AAGCDKRI  Y R+GR+ QQFD+SR+ NE EFT A  +PSGQSVVIGSY+++R+LNW+ RK MW+EG  KEI NLY+++ L WKKDGS++    +CGG+  FDCCLR+ +YK+KFE+ YVG SQVIV N+ T  ++I+KS++G+EI+EVKI G D+Y++AHTS+TLMLGD+S+ KLSE+PWQ     EKF FDN++VCMI+  GEL+L+EYG +EILG VRTEF++PH ISVR+NERKQ  +D NKK+AYL+DLKTI+++DL +G +I QI++DSKIDW+ELNE G ++LFRDK+L+L L +IE+ ++  +LNYCSYVQWVPGSDV+VAQ+R NLC+WYNI  P+RVT FP+KGDI  + R DGKTEVLVNEG+  VAY LDEGLIEF TA +DGD+ RAV+FLE++E++ ETE+MW+ L   +L    + + +AERC+AALGDI K+ YLH+T  I    + + G   + YKV AR+A++  NFKLAE+IYLE N I+EA+EMY+ L+ WD+A+ +A  +GH    +LRN+YYQWL++T Q  +AGE KE  GDY+ AI++Y+K+G+P +AARL  S+ ++I+ ++L+NRIA +L+K +++E+AG+LYE +    +A++CYRKG +++R VELAR +FP +V++LEEEWG+YLV   QLD AI H+IE+G+ +KA++AAI ++QW K S I+E   G +   +KYY+ +A+HY ++  +E AE YFI+    + A++ Y N   WE AH + S  +   E   +Y  QAQ LE   ++K+AE+L+LT++ P  AI MYKR KM  D+IRL+  Y+ + +  T   LA+E E +  ++QAE +YL+  DWK+AVN+YR  +MWE++YRV++A    +A++QV YLWAK LGG+S+VKLL + GLL+ AIDYA E+ AFDFAF+L K+   +K+ +IH KYAM+LEDEG+F EAEA FIKA+KP+EAVLM+VH QDWD+AQRVAE  D DSV+DVLVGQARFAF  ++++K+E++L+RAQRPELAVK YK+A MW DA+RVCKEY+PHKLE LQ +YD E++    +                + L  Q R+WES+ E+ RAVECYLK++  +       +V I+EK W+KA ++ LKFL  ++A +V+EI+GPRLI+++K+  A++ Y  VD +K+A++A I+ EEW+KAK +A+ + P  E YV++KYK +LK+ GK   L  +D++  L++Y +   WDK +  A+   P +LHKY+A+YA  LIK N+   A+ +Y+++G+P  +QN+NIYKRI  DI +M++ NN ++Y  W  LR  ++   INL+            F  +L  +HYYA RSA MA N++L+ +  ++S++LLR+ +IIPADKAF+EAG++C+   + +MAF+F NRYLDL+EAIE  +G+ D+LDNTDF+DTDIP E PLP+K + +  +H +VK+WVL+++MDQK+  +LP D+R+ +  SL    +G  S+PC+ISG+PVL N+  FK+  K  + +++NKF +A+KVS S+EC ++L+F+  WCG+ P
Sbjct:    1 MQLKHLKTLLPPQEGAAKICALAWSNNNNKLAVCTYDRVVVLYDEQGERRDKFATKPSDAKYGKKSYMVKGMAFSPDSTKVAIGQTDNIIFVYKIGDEWGDKKTICNKFGQQSAVTCLIWPPDQQIIFGTADGKVRMANVKTNKSSTIYNTDSYVVSITQNPSGKGIISGHADGSIVRFFFDDEGTGDSQGKICVHPCPPYALAWGT-NSIVAAGCDKRIMAYGRDGRVFQQFDYSREENEHEFTNAICSPSGQSVVIGSYDRIRVLNWSPRKSMWDEGNTKEIPNLYSITALAWKKDGSRMTAGTLCGGVEQFDCCLRRSVYKNKFEMTYVGLSQVIVKNLSTGTRVILKSFYGYEIDEVKIMGNDRYLVAHTSDTLMLGDLSSTKLSEVPWQGYAGNEKFYFDNESVCMIFNAGELSLVEYGQNEILGSVRTEFMNPHLISVRLNERKQFGVDDNKKMAYLVDLKTIAIMDLMSGMNIGQINHDSKIDWLELNETGRNMLFRDKRLKLHLYDIESQAKTTVLNYCSYVQWVPGSDVVVAQNRTNLCVWYNIDAPERVTMFPIKGDIVELERHDGKTEVLVNEGVTTVAYTLDEGLIEFGTATDDGDYARAVAFLETLEMSSETEAMWKTLGKLSLEA--KQLHVAERCFAALGDISKSRYLHKTNIIAAEAEKQGGDGFRSYKVRARMAIMEKNFKLAESIYLEQNHIEEAMEMYQELHKWDDALNLAEARGHPELENLRNNYYQWLIDTQQEGRAGELKERQGDYMAAINMYMKAGMPTKAARLVTSQEELINNSELVNRIANALIKGDMYERAGDLYEKINKYPDALQCYRKGENYRRCVELARYAFPGEVVKLEEEWGDYLVQQKQLDAAINHFIEAGATMKAVEAAIQSRQWVKASQIMEVV-GKSPQVSKYYKKIAQHYANMSDYELAERYFIEADCTKDAIDMYNNANKWEEAHRLASHCMKPEEVAVLYIKQAQTLEAQARYKDAERLYLTVEEPDLAITMYKRLKMYNDMIRLVKTYHKDLLADTHLHLAKELEAENQLRQAEHHYLEAKDWKAAVNMYRNNDMWEESYRVAKANGSKQAAQQVAYLWAKSLGGDSSVKLLTKFGLLESAIDYASENGAFDFAFDLAKTAMKNKLPDIHLKYAMFLEDEGKFKEAEAEFIKASKPKEAVLMYVHNQDWDSAQRVAEENDPDSVADVLVGQARFAFEEKEFQKAEAFLLRAQRPELAVKYYKDAGMWQDALRVCKEYIPHKLEMLQNEYDNEMTSQSTRG--------------VETLVQQAREWESSGEHPRAVECYLKVTTGVTN-----DVNILEKCWVKAADLALKFLKPEKAGQVVEIVGPRLIEVQKYSTAAEIYLQVDLIKDAIDAFIQAEEWNKAKKVAKELEPALEKYVDDKYKTYLKTKGKVDALAGVDVMAGLDMYIQNGQWDKAIETAEQQNPKVLHKYVALYAAHLIKENRVLDAMDLYVRHGTPPVQQNYNIYKRIVSDIFTMQNLNNAEAYRTWADLRSMLYDLVINLEKGGESKSSQYEEFDTLLLIAHYYATRSAAMA-NKSLESIAAKVSVALLRHVNIIPADKAFFEAGIMCKAIGWENMAFVFLNRYLDLIEAIE--EGTLDMLDNTDFQDTDIPQEFPLPEKPHLSESQHEEVKQWVLAVAMDQKVVQELPRDDRDTYEASLVACNSGIVSVPCIISGYPVLNNKLEFKRAGKAANKDDWNKFLMATKVSHSSECQEILKFVGTWCGATP 1744          
BLAST of Intraflagellar transport protein 172 vs. TrEMBL
Match: gnl|BL_ORD_ID|22613929 (tr|A0A2C9JHK5|A0A2C9JHK5_BIOGL Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106067536 PE=4 SV=1)

HSP 1 Score: 2007.65 bits (5200), Expect = 0.000e+0
Identity = 956/1771 (53.98%), Postives = 1336/1771 (75.44%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFND--NEIGK--VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIIS-ADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKI--NLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQ-NKKCISENFNKFQIASKVSRSTECADVLRFINEWCGSLP 5304
            M+LKH+K++LPP    AKICA+ +SPN +K A C+ DRV++LFDE GEK+D+F+ K +D+KYGKK+Y V  +AFS DS+K+AVGQ+D I+YVYK+GD W +KK ICNKF Q S+VTCLIWP DQPI+ GL DGKVR ANI+TNKS TVY+ + Y VSL  + + KG +SGH+DGSIIRYFFDDEGS D+QGK+ATHPS PYALA+ S N I+AAGCDKRI  Y R+GR  QQFDFSRD++E EFTVA  +PSGQ+VVIGS++KLR+LNW+ R+ +WEE ++KEI NLYT++ L WKKDGS++    +CGG+ LFDCCL++ +YK+KFE+ +VG SQ IV N+  + K+++KS++G+EI+EV+I GKD+Y++AHTS+TL+LGDM T++LSE+PWQ SG  EK+ FDN+NVCMI+  GEL L+EYG +E+LGCVRTEF++PH ISVR+NERKQ  ++ NKK+AYL+DLKTI+++D+ +G ++ QIS+D+++DW+ELNE G  +LFRD KL+L L +IET  + ++LNYCSYVQWVPGSDV+VAQ+R NLC+WYNI+ P+RVT  P+KGDI ++ R +G+T+VLV+EG++ VAY LDEGLIEF TA++DGD+ RAV+FLE++E++ ETE+MW+ L+  AL    + + IAERC++ALG+I K  YL ET+R+  +   ++G    + YKV ARLA+    FK AE IYLE N ++EAIEMY+ ++MWDEAIEVA  K H    +L+ +Y QWL+ T Q EKAGE KE  GDY+ AI+LY+KSG+PARAARLA S+ +++S +DLI RIA +L+K EL+++AG+LYE + +   AM+C++KG  ++RA++LAR +FPS+V++LEEE+G+YLV+  QLD AI H+IE+G+  KA++AAI+++QW K   ILE QD       +YY+ + EHY SI ++E AE+++++    R AV+ Y   G WE AH + + Y+   +   +Y AQA+QLE +GKFKEAE+L++ ++ P  AI MYK+ +M  D+IRL+  Y+   +  T   LA+E E +GN +QAE ++ + GDWK+AVN+YR ++MW++AYRV+++     A+KQV YLWAK+LGG+SAVKLLN+ GLL+ AIDYA E+ AFDFAFEL       K+ ++H K+AMYLEDEG+F EAE  F+KA +P+EAVLM+VH QDWD+AQRVAE  D DSV+DVLVGQARFAF  +DY K+ESYL+RAQRPELA+K YK++ MW DA+RVCKEYLPHKL+ LQ++YDRE          ++ G     V        Q R+WES+ E+ RAVECYLK++ D+V      +V+I+EK  +KAG+I +KFL N +A  V++++GPRL +IK +  A++ Y ++D VK+ ++ LI   +W+KAK +A+ ++P++E YV+EKYK F ++ GKA +L  +D+I AL+++AE+  W KC+ +A +  P +  KY+A+YAT LIKSN S  AL++Y+KYG+P   QN+NIYKRIF DI + R+ +  ++Y  W +LRD +  +  N+   S  +      F+KML  +HYYA R A  A   +LD +  ++S+SLLR+TDIIPADKAFYEAG+ C+   + +MAF+F NRYLD+ EA+E  +G+ D+LD+TDF++TDIP E+P+P+K +    +H +VKEWVL++SMD+++E  LP DER  +  SL    TG  ++PCV++G+PVL+N+  FK  NK    E++NK  +A+KVS S+E  DVL+FI  WCG+ P
Sbjct:    1 MQLKHMKSLLPPMDGAAKICALAFSPNNQKLAVCTSDRVVVLFDEQGEKRDKFSLKPADSKYGKKSYTVKGLAFSSDSTKIAVGQTDYIIYVYKIGDEWGEKKVICNKFVQQSAVTCLIWPPDQPIIYGLADGKVRAANIRTNKSSTVYSTESYVVSLTCNPSGKGILSGHADGSIIRYFFDDEGSGDTQGKIATHPSPPYALAY-SQNAIVAAGCDKRILAYGRDGRSFQQFDFSRDVDEHEFTVAVCSPSGQNVVIGSFDKLRVLNWSPRRQVWEEPKLKEIPNLYTITALAWKKDGSRVVAGTLCGGLELFDCCLKRTLYKNKFEITHVGVSQAIVRNLSNNTKVMLKSHYGYEIDEVRIMGKDRYLVAHTSDTLLLGDMLTSRLSEVPWQGSG-SEKYCFDNENVCMIFNAGELALVEYGANEVLGCVRTEFMNPHLISVRLNERKQKGVEDNKKMAYLLDLKTIAIIDIISGLNVAQISHDNRVDWLELNETGHKLLFRDNKLKLHLYDIETQQKTSILNYCSYVQWVPGSDVVVAQNRGNLCVWYNIESPERVTMVPIKGDIIDLERKEGRTDVLVSEGVNTVAYTLDEGLIEFGTAVDDGDYARAVAFLETLEMSAETEAMWKTLSKMALEE--KQLHIAERCFSALGNIAKARYLKETLRIAEEVSKQVGGDGCQHYKVRARLAISEKKFKEAEYIYLEGNHVNEAIEMYQEMHMWDEAIEVADAKSHPELETLKRNYNQWLMETGQEEKAGELKEREGDYMAAINLYMKSGLPARAARLAASREELMSNSDLIARIAGALIKAELYDRAGDLYEKIRDYQRAMECFKKGKEYRRAIDLARHAFPSEVVKLEEEFGDYLVTQKQLDAAINHFIEAGATTKAVEAAINSRQWAKAVQILEIQDSAMA--ARYYKKIGEHYASIGEYELAEKFYVEAGCTRDAVDMYNKAGKWEHAHKLAATYMKGEDVSNLYIAQAKQLEEEGKFKEAERLYVAVEEPDLAITMYKKQRMYVDMIRLVKLYHENLVTDTHLHLAKELESEGNFRQAEHHFQEGGDWKAAVNMYRAQDMWDEAYRVAKSQGGPPAAKQVAYLWAKNLGGDSAVKLLNKFGLLEAAIDYAAENCAFDFAFELCTIAMKEKLPDVHLKHAMYLEDEGKFHEAEQEFVKAQRPKEAVLMYVHNQDWDSAQRVAEAHDPDSVADVLVGQARFAFEEKDYSKAESYLLRAQRPELAIKFYKDSGMWSDALRVCKEYLPHKLQQLQDEYDREAVTKSGNKAHIDGGGAEAIVR-------QAREWESSGEHQRAVECYLKVTPDMVP-----DVKIVEKCLMKAGDIAIKFLDNQKAQTVVQVVGPRLAEIKCYSTAAELYLSMDMVKQGIDMLITAGDWNKAKKVAKEMDPRFENYVDEKYKEFCRNQGKAEDLATVDVIGALDMFAEKGEWSKCMQIAAEQNPKVQQKYVALYATHLIKSNNSLAALELYVKYGAPANSQNYNIYKRIFNDILTKREMSKPEAYRSWAELRDMLHDLCENISKTSEANGPQHEEFEKMLLIAHYYATRCAAQA-QPSLDSIAGKLSVSLLRHTDIIPADKAFYEAGMACKALGWENMAFVFLNRYLDISEAME--EGTLDMLDHTDFQETDIPFEIPIPEKPFLTGGQHEEVKEWVLAVSMDRQVEQILPKDERGTYEASLVAMETGIRALPCVVTGYPVLRNKVEFKNPNKVANKEDWNKLLMATKVSHSSELQDVLKFIGTWCGANP 1750          
BLAST of Intraflagellar transport protein 172 vs. TrEMBL
Match: gnl|BL_ORD_ID|22588486 (tr|A0A2C9JHJ2|A0A2C9JHJ2_BIOGL Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106067536 PE=4 SV=1)

HSP 1 Score: 2003.79 bits (5190), Expect = 0.000e+0
Identity = 955/1771 (53.92%), Postives = 1335/1771 (75.38%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFND--NEIGK--VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIIS-ADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKI--NLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQ-NKKCISENFNKFQIASKVSRSTECADVLRFINEWCGSLP 5304
            M+LKH+K++LPP    AKICA+ +SPN +K A C+ DRV++LFDE GEK+D+F+ K +D+KYGKK+Y V  +AFS DS+K+AVGQ+D I+YVYK+GD W +KK ICNKF Q S+VTCLIWP DQPI+ GL DGKVR ANI+TNKS TVY+ + Y VSL  + + KG +SGH+DGSIIRYFFDDEGS D+QGK+ATHPS PYALA+ S N I+AAGCDKRI  Y R+GR  QQFDFSRD++E EFTVA  +PSGQ+VVIGS++KLR+LNW+ R+ +WEE ++KEI NLYT++ L WKKDGS++    +CGG+ LFDCCL++ +YK+KFE+ +VG SQ IV N+  + K+++KS++G+EI+EV+I GKD+Y++AHTS+TL+LGDM T++LSE+PWQ SG  EK+ FDN+NVCMI+  GEL L+EYG +E+LGCVRTEF++PH ISVR+NERKQ  ++ NKK+AYL+DLKTI+++D+ +G ++ QIS+D+++DW+ELNE G  +LFRD KL+L L +IET  + ++LNYCSYVQWVPGSDV+VAQ+R NLC+WYNI+ P+RVT  P+KGDI ++ R +G+T+VLV+EG++ VAY LDEGLIEF TA++DGD+ RAV+FLE++E++ ETE+MW+ L+  AL    + + IAERC++ALG+I K  YL ET+R+  +   ++G    + YKV ARLA+    FK AE IYLE N ++EAIEMY+ ++MWDEAIEVA  K H    +L+ +Y QWL+ T Q EKAGE KE  GDY+ AI+LY+KSG+PARAARLA S+ +++S +DLI RIA +L+K EL+++AG+LYE + +   AM+C++KG  ++RA++LAR +FPS+V++LEEE+G+YLV+  QLD AI H+IE+G+  KA++AAI+++QW K   ILE QD       +YY+ + EHY SI ++E AE+++++    R AV+ Y   G WE AH + + Y+   +   +Y AQA+QLE +GKFKEAE+L++ ++ P  AI MYK+ +M  D+IRL+  Y+   +  T   LA+E E +GN +QAE ++ + GDWK+AVN+YR ++MW++AYRV+++     A+KQV YLWAK+LGG+SAVKLLN+ GLL+ AIDYA E+ AFDFAFEL       K+ ++H K+AMYLEDEG+F EAE  F+KA +P+EAVLM+VH QDWD+AQRVAE  D DSV+DVLVGQARFAF  +DY K+ESYL+RAQRPELA+K YK++ MW DA+RVCKEYLPHKL+ LQ++YDRE      K                + +  Q R+WES+ E+ RAVECYLK++ D+V      +V+I+EK  +KAG+I +KFL N +A  V++++GPRL +IK +  A++ Y ++D VK+ ++ LI   +W+KAK +A+ ++P++E YV+EKYK F ++ GKA +L  +D+I AL+++AE+  W KC+ +A +  P +  KY+A+YAT LIKSN S  AL++Y+KYG+P   QN+NIYKRIF DI + R+ +  ++Y  W +LRD +  +  N+   S  +      F+KML  +HYYA R A  A   +LD +  ++S+SLLR+TDIIPADKAFYEAG+ C+   + +MAF+F NRYLD+ EA+E  +G+ D+LD+TDF++TDIP E+P+P+K +    +H +VKEWVL++SMD+++E  LP DER  +  SL    TG  ++PCV++G+PVL+N+  FK  NK    E++NK  +A+KVS S+E  DVL+FI  WCG+ P
Sbjct:    1 MQLKHMKSLLPPMDGAAKICALAFSPNNQKLAVCTSDRVVVLFDEQGEKRDKFSLKPADSKYGKKSYTVKGLAFSSDSTKIAVGQTDYIIYVYKIGDEWGEKKVICNKFVQQSAVTCLIWPPDQPIIYGLADGKVRAANIRTNKSSTVYSTESYVVSLTCNPSGKGILSGHADGSIIRYFFDDEGSGDTQGKIATHPSPPYALAY-SQNAIVAAGCDKRILAYGRDGRSFQQFDFSRDVDEHEFTVAVCSPSGQNVVIGSFDKLRVLNWSPRRQVWEEPKLKEIPNLYTITALAWKKDGSRVVAGTLCGGLELFDCCLKRTLYKNKFEITHVGVSQAIVRNLSNNTKVMLKSHYGYEIDEVRIMGKDRYLVAHTSDTLLLGDMLTSRLSEVPWQGSG-SEKYCFDNENVCMIFNAGELALVEYGANEVLGCVRTEFMNPHLISVRLNERKQKGVEDNKKMAYLLDLKTIAIIDIISGLNVAQISHDNRVDWLELNETGHKLLFRDNKLKLHLYDIETQQKTSILNYCSYVQWVPGSDVVVAQNRGNLCVWYNIESPERVTMVPIKGDIIDLERKEGRTDVLVSEGVNTVAYTLDEGLIEFGTAVDDGDYARAVAFLETLEMSAETEAMWKTLSKMALEE--KQLHIAERCFSALGNIAKARYLKETLRIAEEVSKQVGGDGCQHYKVRARLAISEKKFKEAEYIYLEGNHVNEAIEMYQEMHMWDEAIEVADAKSHPELETLKRNYNQWLMETGQEEKAGELKEREGDYMAAINLYMKSGLPARAARLAASREELMSNSDLIARIAGALIKAELYDRAGDLYEKIRDYQRAMECFKKGKEYRRAIDLARHAFPSEVVKLEEEFGDYLVTQKQLDAAINHFIEAGATTKAVEAAINSRQWAKAVQILEIQDSAMA--ARYYKKIGEHYASIGEYELAEKFYVEAGCTRDAVDMYNKAGKWEHAHKLAATYMKGEDVSNLYIAQAKQLEEEGKFKEAERLYVAVEEPDLAITMYKKQRMYVDMIRLVKLYHENLVTDTHLHLAKELESEGNFRQAEHHFQEGGDWKAAVNMYRAQDMWDEAYRVAKSQGGPPAAKQVAYLWAKNLGGDSAVKLLNKFGLLEAAIDYAAENCAFDFAFELCTIAMKEKLPDVHLKHAMYLEDEGKFHEAEQEFVKAQRPKEAVLMYVHNQDWDSAQRVAEAHDPDSVADVLVGQARFAFEEKDYSKAESYLLRAQRPELAIKFYKDSGMWSDALRVCKEYLPHKLQQLQDEYDREAVTKSGKG--------------AEAIVRQAREWESSGEHQRAVECYLKVTPDMVP-----DVKIVEKCLMKAGDIAIKFLDNQKAQTVVQVVGPRLAEIKCYSTAAELYLSMDMVKQGIDMLITAGDWNKAKKVAKEMDPRFENYVDEKYKEFCRNQGKAEDLATVDVIGALDMFAEKGEWSKCMQIAAEQNPKVQQKYVALYATHLIKSNNSLAALELYVKYGAPANSQNYNIYKRIFNDILTKREMSKPEAYRSWAELRDMLHDLCENISKTSEANGPQHEEFEKMLLIAHYYATRCAAQA-QPSLDSIAGKLSVSLLRHTDIIPADKAFYEAGMACKALGWENMAFVFLNRYLDISEAME--EGTLDMLDHTDFQETDIPFEIPIPEKPFLTGGQHEEVKEWVLAVSMDRQVEQILPKDERGTYEASLVAMETGIRALPCVVTGYPVLRNKVEFKNPNKVANKEDWNKLLMATKVSHSSELQDVLKFIGTWCGANP 1743          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Cavefish
Match: ift172 (intraflagellar transport 172 [Source:NCBI gene;Acc:103038328])

HSP 1 Score: 1889 bits (4892), Expect = 0.000e+0
Identity = 900/1776 (50.68%), Postives = 1289/1776 (72.58%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIGK------VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIISA-DLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKI--NLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQNKKCIS-ENFNKFQIASKVSRSTECADVLRFINEWCGSLPASG 5313
            M+LKH+KT+L PQ   AK+  + W+PN  KFA C+ DRV++L+DE GE++D+F+TK +D+KYGKK+Y+V +IAFSPDS+K+A+ Q+D+I++VYK+G+ W DKK ICNKF Q S+V CL+W  +  IV GL +GK+RVAN K NKS TVY  + Y VSL S+ + KG +SGH+DG+++RYFF+DEGS +SQGK+ TH   PYALAWGS N+II AG DK+I  Y +EG +LQ FD+SRD +EKEFTVA+++PSG+SVV+GSY++LR+ NW+ ++G W++   KEI NLYT++ L WKKDGS++C   +CGG+  FDCCLR+ IYK+KFE+ YVG +QVIV N+ T  ++++KS+ G+EI EVKI GKD+Y++AHTS+TL+LGD+  NKLSE+ WQ SG  EKF F+N+ VCM++  GELTL+EYG +EILG VRTEF++PH ISVR+NER+Q  ++ NKKLAYLID+KTI+++DL  G ++  + +DSKIDW+ELNE G  +LFRDKKLRL L +IE+G +  +L++CSYVQWVPGSDV+VAQ+R NLC+WYNI  P+RVT FPL+GDI ++ R++GKTEV+V EG++ V+Y LDEGLIEF TA++D DF RA +FLE++E++ ETE+MW+ L+  +L      + IAERC+AALGD+ K  +L+ET +M   + I K       + Y+  ARLA+L  N+KLAE  Y+E N I+E ++MY+ L+MW++ I VA  KGH    SLR +YY WL+ TNQ+E AGE KE  GDY  AI+LY+K+G+P +AA L +S  +++++ D+INRI  +L+K E +E+AG+L + + N   A+ CY KG SF++AVELAR +FPS+V+ LEE WG+YLV   Q+D AI HYIE+G   KA+++AI A+QW+K   I+E Q+ ++   +KYY  +A+HY SI++FE AE  F+KG   ++A++ Y  +G WE AH +  + + + E   +Y  +A +LE  GK+KEAE+LF+T+  P  AI MYK+NKM  D IRL+ +Y+ + +  T   LA+E E +G  ++AE +Y++  DWK+AVN+Y   +MWE+A+RVS++   A A KQV YLW K+LGGE+AVKLL + GLL+ AID+A E+ +FDFAF+L +     K+ +IH K AM+LEDEG F EAE  FIKA KP+EAV+M++H +DW  AQRV+E  D DS++DVL+ QA+  F  +D++K+ES L+RAQRPELAVK YK+A MW DA+R+CKEYLP +L  LQE+Y++E+      + K N G         +++ +Q  +WE + EY RAV+CYLK+              ++ K  +KA E+ +KFL+ ++++ VI+ +GP L++ +K+  A++ Y  +D +KEA++A IEGEEW+KAK +A+ ++P+ E YV++ YK  L++ GK   L  +D++ AL+IY E+  W+KC+  A      ILHKYLA+YAT LIK  ++   L++Y+++G P   QNFNIYKR+F++  ++ D +  ++Y +W  LRD ++ +  NL   S  +      F++ML  SHYYA RSA    +Q L  L  ++SISLLR+TD+IPADK FYEAGL  +   + SMAFIF NR+LDL + ++  +GS D LD+TDF+DTDIP EVPLP K +   ++  ++++WVL++SMDQ++E  LP DERN +  SL  + T   S PC+I+G+PVL+N+  FK+     + +++NKF +A+K S S EC DVL+FI +WCG LP++G
Sbjct:    1 MQLKHLKTLLTPQDGAAKVTCMAWAPNNAKFAVCTVDRVVLLYDEQGERRDKFSTKPADSKYGKKSYMVKSIAFSPDSTKIAIAQTDNIIFVYKIGEDWGDKKVICNKFVQTSAVICLLWLAEHSIVFGLAEGKIRVANTKNNKSSTVYGTESYVVSLTSNVSGKGILSGHADGTVVRYFFEDEGSGESQGKLLTHTCPPYALAWGS-NSIIVAGSDKKIVAYGKEGHVLQMFDYSRDCSEKEFTVAATSPSGESVVLGSYDRLRVFNWSPQRGAWDQASPKEIPNLYTITALAWKKDGSRLCTGTLCGGVEQFDCCLRRSIYKNKFEITYVGLNQVIVKNLSTGTRVVLKSHHGYEIVEVKIMGKDRYLVAHTSDTLLLGDLGCNKLSEVVWQGSGGNEKFFFENETVCMVFNAGELTLVEYGNNEILGSVRTEFMNPHLISVRLNERRQRGMEDNKKLAYLIDMKTIAIVDLSGGCNLGNVGHDSKIDWLELNETGRKLLFRDKKLRLNLFDIESGLKTTVLSFCSYVQWVPGSDVVVAQNRGNLCVWYNIDSPERVTLFPLRGDIVDLERNNGKTEVIVIEGVNTVSYTLDEGLIEFGTAIDDEDFNRATAFLETLEMSSETEAMWKTLSKLSLEA--RQLHIAERCFAALGDVSKARFLNETNKM--TDSISKDYCDDGTEHYQAKARLAMLDKNYKLAEMYYMEQNSINEVMQMYQELHMWNDCIAVAEAKGHPELDSLRYNYYAWLIETNQNEMAGEVKEKEGDYTGAINLYLKAGLPTKAAWLIISMDEVLTSNDVINRITVALIKGEFYERAGDLLKKIKNNQRALDCYCKGKSFRKAVELARVAFPSEVVNLEEAWGDYLVQQKQMDAAINHYIEAGCSFKAVESAIGARQWKKALHIVELQEDSSS--SKYYLKIAQHYASIQEFEVAEHLFVKGGHIKEAIDMYTQSGRWEEAHKLAMKCMTQEEVSSLYIRRAYELEQAGKYKEAERLFITVSEPDLAITMYKKNKMYDDTIRLVARYHEDLLLETHIHLAKELEIEGRFQEAEYHYIEGQDWKAAVNMYGTNDMWEEAHRVSKSHGPANAHKQVAYLWGKNLGGEAAVKLLKKFGLLETAIDFAAENRSFDFAFDLARLSMKEKIPQIHLKNAMFLEDEGNFDEAEVEFIKAGKPKEAVMMYIHVKDWSGAQRVSEGHDPDSMADVLMAQAKCCFEQKDFQKAESLLLRAQRPELAVKYYKDAKMWSDAMRICKEYLPSQLAVLQEEYEKEV------AKKGNWG--------VEDMVEQACKWEQSGEYARAVDCYLKVK-------DSSNTALLVKCQMKAAELAIKFLSREKSVHVIQAVGPCLVQHRKYRAAAELYLNIDLIKEAVDAFIEGEEWNKAKRVAKELDPRLEGYVDQCYKEHLRNQGKVDSLVGVDVMAALDIYVERGQWEKCIDTASKQNFKILHKYLALYATHLIKEGEAEKVLKLYVQHGVPANPQNFNIYKRLFQECMNLPDKDISEAYRMWADLRDVLYLLCENLTKSSEANSPAHEDFEQMLVISHYYATRSAAKGVDQ-LSTLTARLSISLLRHTDVIPADKVFYEAGLAAKAVGWESMAFIFLNRFLDLADGVD--EGSLDALDHTDFQDTDIPFEVPLPSKLHVTVEKREEIRDWVLTVSMDQRVEQVLPRDERNTYEASLLAANTSIRSHPCIITGYPVLRNKIEFKRPGMAANKDDWNKFLMATKTSHSPECQDVLKFIEKWCGGLPSAG 1745          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Sea Lamprey
Match: IFT172 (intraflagellar transport 172 [Source:HGNC Symbol;Acc:HGNC:30391])

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 307/626 (49.04%), Postives = 449/626 (71.73%), Query Frame = 1
Query: 1960 RCYAALGDICKTHYLHETIRM--FNDNEIGK--VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIIS-ADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELS 3822
            RC+AALGD+ K  +L ET R+   +  E G      Y+V ARLA+L   +KLAE+I+LE N I+EA++MY++L+MWDE I VA  KGH    SLR SY +WL  + Q  +A E +E  GD + A+ LY+++G+PA AAR+A S+ +++   +L+ R+A +L++ EL E+AG+L+E   N   A+ CY+KG SF++AVELAR ++P++V++LEE WG++LV+  QLD AI HYIE+G   KA++AA+ ++QW+K ++ILE QD   +   KYY  +A+HY S++ +E AE++++K    + A++ Y   G WE AH +  R + + E   +Y  QA +LE +GK+KEAE+L++T+  P  AI MYK+ K   D++RL+ KY+ + +  T   LA+E E +  +++AE +YL+  +WK+AVN+YR  ++WE+AYRV+++     A KQV YLWAK LGGESA+KLL + GLL+ AIDYA ++ AF+FAF+L +    SKM++IH K+A++LEDEG++ EAE  FIKA KP+EA+LM+VH QDWD+AQ VAE  D  SVSDVLV QAR AF  RD++++E++L+RAQRPELA+K YKEA MW DAIR+CKEYLP KL  LQ++Y+ + +
Sbjct:   10 RCFAALGDMAKVQFLRETNRIADLDAQEFGGDGTDSYRVRARLAMLDKQYKLAESIFLEQNAIEEAMQMYQNLHMWDECIAVAEAKGHPELESLRRSYVKWLTVSGQDGRAAEVRESEGDAVGAVGLYLQAGLPAAAARVASSRPELLGNEELVARVASALVRAELHERAGDLFEKTKNYKRALDCYKKGCSFRKAVELARSAYPTEVVKLEEAWGDHLVAQKQLDAAINHYIEAGCSAKALEAAMGSRQWKKAASILEMQD--ERTAGKYYVRIAQHYASVQDYELAEQFYVKADRVKDAIDMYTQAGQWENAHRLAKRCMRQEEVGTLYINQAHELEKEGKYKEAERLYVTVGEPDLAITMYKKLKRFDDMVRLVAKYHEDLLADTHLHLAKELEANAQLREAEYHYLEGKEWKAAVNMYRSADIWEEAYRVAKSHGGPTAHKQVAYLWAKSLGGESAIKLLTKFGLLETAIDYAADNCAFEFAFDLARGAMKSKMADIHLKHAIFLEDEGKYKEAEVEFIKAGKPKEAILMYVHSQDWDSAQAVAEAHDPTSVSDVLVAQARAAFEQRDFQRAEAFLLRAQRPELALKHYKEAQMWSDAIRICKEYLPGKLSQLQDEYESQAA 633          

HSP 2 Score: 60.4622 bits (145), Expect = 3.159e-9
Identity = 122/575 (21.22%), Postives = 234/575 (40.70%), Query Frame = 1
Query: 2743 DFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKY-----NPEEIDPTLSKL--AEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFA-----FELGKSVNDSKMSEIHGKY----AMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAEN-FDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQI-EVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMI------EALNIYAEQNNWDKCLTMAQDTTP 4395
            D T  YR+ A   +  K+++ AE  F++ +   +A++ Y N  MW+   ++ +      E   +  +  + L V G+   A ++  +      A+ +Y +  +     R+ +       N E +    S L  AE  E+ G++      + +  ++K A++ Y+K   +  A  ++++    E  K +   W  HL    A K L+    ++  I+  C   A + A     ++   S+ + +     GKY    A +      +  AE  ++KA++ ++A+ M+     W+ A R+A+     + V  + + QA        YK++E   +    P+LA+ +YK+   +DD +R+  +Y         ED   +  LH  K  + N             L++    +   KE+  AV  Y   S D+ E   ++ +      +  +   +  K L  + AIK++   G         +L +    A D              ++ A  LARG        +  K+ IFL+  GK  E E ++ I      EA+ +Y    +WD    +A+   P
Sbjct:   41 DGTDSYRVRARLAMLDKQYKLAESIFLEQNAIEEAMQMYQNLHMWDECIAV-AEAKGHPELESLRRSYVKWLTVSGQDGRAAEVRESEGDAVGAVGLYLQAGLPAAAARVASSRPELLGNEELVARVASALVRAELHERAGDL------FEKTKNYKRALDCYKKGCSFRKAVELARSAYPTEVVK-LEEAWGDHL---VAQKQLD--AAINHYIEAGCSAKALEAAMGSRQWKKAASILEMQDERTAGKYYVRIAQHYASVQDYELAEQFYVKADRVKDAIDMYTQAGQWENAHRLAKRCMRQEEVGTLYINQAHELEKEGKYKEAERLYVTVGEPDLAITMYKKLKRFDDMVRLVAKY--------HEDLLADTHLHLAKELEANA-----------QLREAEYHYLEGKEWKAAVNMYR--SADIWEEAYRVAKSHGGPTAHKQVAYLWAKSLGGESAIKLLTKFG---------LLETAIDYAADNCA-----------FEFAFDLARGAMKSKMADIHLKHAIFLEDEGKYKEAE-VEFIKAGKPKEAILMYVHSQDWDSAQAVAEAHDP 560          

HSP 3 Score: 58.9214 bits (141), Expect = 1.034e-8
Identity = 92/378 (24.34%), Postives = 159/378 (42.06%), Query Frame = 1
Query: 2086 TNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIISADLINRIA---QSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDS--------------FPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIK---KFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQA 3159
              +++LAE  Y++ +++ +AI+MY     W+ A  +A       +  +R      L     HE      E  G Y +A  LY+  G P  A  + + K+     D++  +A   + LL       A EL E  A   EA   Y +G  ++ AV + R +               P+   ++   W   L      ++AI+   + G    AID A     ++    +     G  K  +K   I  +H + ++   K+++AE  FIK    ++A+  Y+++  W+ A ++   + D +    +  AQA+       F+ AE   L   RP+ A+  YK  +M  D IR+  +Y P      LS+L +E E     K A
Sbjct:  289 VQDYELAEQFYVKADRVKDAIDMYTQAGQWENAHRLA-------KRCMRQEEVGTLYINQAHEL-----EKEGKYKEAERLYVTVGEPDLA--ITMYKKLKRFDDMVRLVAKYHEDLLADTHLHLAKEL-EANAQLREAEYHYLEGKEWKAAVNMYRSADIWEEAYRVAKSHGGPTAHKQVAYLWAKSLGG----ESAIKLLTKFGLLETAIDYAADNCAFEFAFDLAR---GAMK--SKMADIHLKHAIFLEDEGKYKEAEVEFIKAGKPKEAILMYVHSQDWDSAQAVAEAH-DPTSVSDVLVAQARAAFEQRDFQRAEAFLLRAQRPELALKHYKEAQMWSDAIRICKEYLP----GKLSQLQDEYESQAAGKGA 637          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007901.1 (pep scaffold:Pmarinus_7.0:GL479708:32874:36568:1 gene:ENSPMAG00000007143.1 transcript:ENSPMAT00000007901.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 474.167 bits (1219), Expect = 5.602e-154
Identity = 208/338 (61.54%), Postives = 276/338 (81.66%), Query Frame = 1
Query:  418 KVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISV 1431
            +VR+AN+KTNKS T+Y AD Y VSL ++S+ KG +SGH+DG+I+RYFFDDEGS +SQGK+ TH   PYALAWG+S  + A GCD+R+  Y REG+ LQ FD+SRD  E+E TVA+++PS QSVVIGSY++LR+ NW+ R+  W+E + KEI N+YTV+ L WKKDGS++C   +CGG+ LFDCCLR+ IYK+KFE+ YVG SQVIV N+ T  + ++KS+ G+E+ EVKI GKD+Y++AHTS+TL+LGD+STN+LSEI WQ SG  EKF F+N+NVCM++  GELTL+EYG +E+LG VRTEF++PH ISVR+NERKQ  ++ NKKLAYL+DLKTI++
Sbjct:    1 QVRLANVKTNKSSTIYGADSYVVSLTANSSGKGILSGHADGTIVRYFFDDEGSGESQGKIVTHSCPPYALAWGASGPL-AGGCDRRVVAYGREGQTLQTFDYSRDPTERELTVAAASPSTQSVVIGSYDRLRVYNWSPRRSAWDEAKPKEIQNMYTVTALAWKKDGSRLCAGTLCGGVELFDCCLRRSIYKNKFEMTYVGLSQVIVKNLSTGTRAVLKSHLGYEVEEVKIMGKDRYLVAHTSDTLLLGDLSTNRLSEIAWQGSGGNEKFFFENENVCMVFNAGELTLVEYGSNEVLGSVRTEFMNPHLISVRLNERKQRGVENNKKLAYLVDLKTIAI 337          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Nematostella
Match: EDO37786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SES7])

HSP 1 Score: 1827.37 bits (4732), Expect = 0.000e+0
Identity = 892/1771 (50.37%), Postives = 1270/1771 (71.71%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQP-IVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFND--NEIGK--VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDII-SADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKINLDTDSNQSDETLISFQK---MLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQNKKCIS-ENFNKFQIASKVSRSTECADVLRFINEWCGS 5298
            M+L+++KT+L PQ    K+ A+ W+PN +K A  + DRV++L+DE GE++D+F+TK S+ + GKK+Y+V  +AFSPDSSK+AVGQ+D+I++VYK+G+ W +KK ICNKF Q S+VTCLIWP +Q  IV GL DGKVR+A++KTNKS T+Y  D Y VSL ++ + +G ISGH+DG+I+RYFFDDEG+  SQG++  H S PYAL WGS+  I+AAGCDKRI  Y +EGR+LQ FD+SRD +EKEFTVA+ +PSGQSVVIGS+++LR+ NW+ R+G W+E + KEI NLYT++ L WK+DGS++    +     + + C+ K + K+     + G + +I+  +KT + + +   + + +++V I GKD+Y++A+T++TL++GD+++NKLSE+PWQ++G  EKF F+N++VCM++  GEL+LIEYG +EILG VRTEF++PH ISVR+NERKQ  +D+NKK+AYL+DLKTISV+DL +G  +  IS+DSKIDW+ELNE G ++LFRDKKLRL L N+E+  R  +LNYC+YVQWVP SDV+VAQ+R NLCIWYNI  P+RVT FP+KG+I ++ R DGKTEV+VNEG+  ++Y LDEGLIEF TA++DGDF RAV+FLES+E++ ETE+MW+ L+  AL      + IAERCYAALGD+ K+  L +  ++ +    E+G        V A+LA+L  NFKLAE+  LE   +DEAIEMY+ L+ WDEAI VA   GH    +LR+++Y WL  T Q EKAG  KE+ G+Y++AI+LY+K+G+PA+AARLA+SK D+  SADLI RIA +LLK  L+EK G+L+E V     A++ YRKG +++RAVEL+R ++P +V+ LEEEWG++LVS  QLD AI HYIE+G  VKAI+AAI A+QW K   I+E QD    +  +YY  +A HY  +++++ AE++F+     R A+E Y    M+E AH +  + +   E   +Y +QAQ+LE  G++KEAE+L+ T+D P  AINMYK+ +    +IRL+  Y+ + +  T   LA+E E +G ++QAE +YL+  DWK+AVN+YR  +MWE+AYRVS+      A+KQV YLWAK LGG+SAVKLL + GLL+ AIDYA E+ AF+FAF+L ++    KM +IH KYAM+LEDEG++ EAE  F+KA++P+EAVLM+VH  DWD+AQRVAE  D DSV+DVLVGQAR AF  R+Y+K+E++L+RAQRPELA + YK+A MW DA+RV KEYLPHKLE  Q++YD+E+    N+                ++L  QG++WE   EY RA++ Y+KI+  +       +  ++E + +KA E+ +KF+  ++A +V  +  PRL  IK +   ++ Y  V+ +KEA++  IEGE W KAK  A  + P+YE YVE+ Y  FLK+ G+A +L ++D+I  L++  ++  W+K +  A+     +L KY+A+YA   IK   S  AL+++ +YG+P  +QNFNIYKRI  D+ S        SY  W  LRD ++ + L+  S + D +L  FQ+   ML  +HYY+ R+A    +++LD L  ++SISLLR++D++P DKAFYEAGL  +   + +MAF+F NRYLDL E IE  +GS D+LDN+DF +TDIP EVP+P+K++   ++  ++KEWVL++SMDQK+E  LPTDER+ +  SL    TG  S+PCV++G+PVL+N+  FK+  K  + E++NKF +A+KVS S EC DVLRF+  WCG+
Sbjct:    1 MQLRYMKTLLSPQDGACKVTAMAWAPNNQKMAVVTMDRVVILYDELGERRDKFSTKPSNPQAGKKSYIVKGLAFSPDSSKIAVGQTDNIIFVYKIGEEWGEKKVICNKFIQQSAVTCLIWPPEQANIVFGLADGKVRLASLKTNKSQTIYGTDSYVVSLAANPSGQGIISGHADGAIVRYFFDDEGTGLSQGQLCKHSSPPYALCWGSA--IVAAGCDKRIVAYGKEGRVLQNFDYSRDDDEKEFTVAACSPSGQSVVIGSFDRLRVFNWSPRRGAWDESKAKEIPNLYTITSLAWKRDGSRLVAVILVANFFVLEMCILKNLAKNTENACHAGYNLMILTEIKTPLHLGL--LYCYVVDKVSIMGKDRYLVAYTTDTLLVGDLNSNKLSEVPWQATGGNEKFFFENESVCMVFNAGELSLIEYGNNEILGTVRTEFMNPHLISVRLNERKQRGIDENKKMAYLVDLKTISVVDLLSGLIVATISHDSKIDWLELNETGKYLLFRDKKLRLHLLNVESEVRTTILNYCTYVQWVPLSDVVVAQNRGNLCIWYNIDSPERVTMFPIKGEILDLERVDGKTEVIVNEGVTNISYTLDEGLIEFGTAVDDGDFTRAVTFLESLEMSPETEAMWKTLSRLALEA--RQLHIAERCYAALGDVAKSKALKQINKIADQVAEEMGGDGTNHVLVRAKLAVLDKNFKLAESYLLEQGHVDEAIEMYQELHKWDEAIAVAEATGHPELENLRSNHYHWLSETGQEEKAGVVKEVEGNYMEAINLYMKAGLPAKAARLAMSKEDLAQSADLIERIAAALLKGGLYEKVGDLFEKVNRNDRALEAYRKGGAYRRAVELSRVAYPREVVTLEEEWGDHLVSQKQLDAAINHYIEAGCSVKAIEAAIQARQWNKAVQIVELQDDTVAE--RYYHQIAHHYAQVQEYKLAEKFFVSAGDPRAAIEMYTKASMYEAAHKLAVQCMKPEEVAVLYISQAQELEAQGRYKEAERLYCTVDEPDLAINMYKKLRQFDHMIRLVTTYHKDLLVDTHLHLAKEMESEGQLRQAEHHYLEAKDWKAAVNMYRTSDMWEEAYRVSKQSGGPNAAKQVAYLWAKSLGGDSAVKLLTKFGLLEAAIDYAAENCAFEFAFDLARTSMKHKMPDIHLKYAMFLEDEGKYKEAEEQFVKASRPKEAVLMYVHNHDWDSAQRVAEQHDPDSVADVLVGQARVAFEKREYQKAETFLLRAQRPELAARYYKDAEMWGDALRVVKEYLPHKLEQWQDEYDKEVLTKGNRGA--------------ESLLSQGKEWEKKGEYNRAIDMYMKITASMTS-----DQDLVEDAMVKAVELAMKFVP-ERASEVARVACPRLATIKAYEQGAELYLGVEMIKEAIDMYIEGELWPKAKRCAAEMAPRYEQYVEDAYVNFLKNQGQAEQLVDVDVIAGLDMMVQRGQWEKAIETAEQQGYEVLSKYVALYAANAIKDGDSLKALELFARYGAPANQQNFNIYKRIVNDVVSTPGLGGPDSYRTWADLRDVLYDV-LEGISKEGDTSLPVFQEFESMLLVAHYYSNRAACQ-QHKSLDTLAAKLSISLLRHSDVVPCDKAFYEAGLAAKGVGWENMAFVFLNRYLDLSEGIE--EGSLDMLDNSDFAETDIPFEVPVPEKQFLPEEKREEIKEWVLAVSMDQKVEQVLPTDERDTYEASLVALNTGISSLPCVVTGYPVLRNKIDFKRPGKAANKEDWNKFIMATKVSHSPECQDVLRFLGHWCGA 1739          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Nematostella
Match: EDO27526 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T907])

HSP 1 Score: 409.453 bits (1051), Expect = 2.208e-130
Identity = 182/316 (57.59%), Postives = 249/316 (78.80%), Query Frame = 1
Query:   43 ILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQP-IVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIY 987
            I+  Q    K+ A+ W+PN +K A  + DRV++L+DE GE++D+F+TK S+ + GKK+Y+V  +AFSPDSSK+AVGQ+D+I++VYK+G+ W +KK ICNKF Q S+VTCLIWP +Q  IV GL DGKVR+A++KTNKS T+Y  D Y VSL ++ + +G ISGH+DG+I+RYFFDDEG+  SQG++  H S PYAL WGS+  I+AAGCDKRI  Y +EGR+LQ FD+SRD +EKEFTVA+ +PSGQSVVIGS+++LR+ NW+ R+G W+E + KEI NLYT++ L WK+DGS++    +CGG+ LFDCCLR+ +Y
Sbjct:    1 IVSIQDGACKVTAMAWAPNNQKMAVVTMDRVVILYDELGERRDKFSTKPSNPQAGKKSYIVKGLAFSPDSSKIAVGQTDNIIFVYKIGEEWGEKKVICNKFIQQSAVTCLIWPPEQANIVFGLADGKVRLASLKTNKSQTIYGTDSYVVSLAANPSGQGIISGHADGAIVRYFFDDEGTGLSQGQLCKHSSPPYALCWGSA--IVAAGCDKRIVAYGKEGRVLQNFDYSRDDDEKEFTVAACSPSGQSVVIGSFDRLRVFNWSPRRGAWDESKAKEIPNLYTITSLAWKRDGSRLVAGTLCGGVELFDCCLRRSVY 314          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Nematostella
Match: EDO25896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDE9])

HSP 1 Score: 67.0106 bits (162), Expect = 3.242e-13
Identity = 31/51 (60.78%), Postives = 35/51 (68.63%), Query Frame = 1
Query: 1609 WVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLV 1761
            WVP SDV+VAQ+R NLCIWYNI  P+RVT FP+KG        DG   VLV
Sbjct:    1 WVPLSDVVVAQNRGNLCIWYNIDSPERVTMFPIKG-------GDGTNHVLV 44          

HSP 2 Score: 55.8398 bits (133), Expect = 2.153e-9
Identity = 29/60 (48.33%), Postives = 36/60 (60.00%), Query Frame = 1
Query: 2008 ETIRMFNDNEIGKVKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAI 2187
            E + MF            V A+LA+L  NFKLAE+  LE   +DEAIEMY+ L+ WDEAI
Sbjct:   26 ERVTMFPIKGGDGTNHVLVRAKLAVLDKNFKLAESYLLEQGHVDEAIEMYQELHKWDEAI 85          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Nematostella
Match: EDO40640 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M0])

HSP 1 Score: 57.3806 bits (137), Expect = 5.263e-8
Identity = 118/547 (21.57%), Postives = 223/547 (40.77%), Query Frame = 1
Query:  640 SNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICG-GINLFDCCLRKVIYKDKFELNYVGPSQV----IVNNVKTSVKI---IIKSYFGHEINEVKITGKDKYIIA-HTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASIQISNDSKIDWIELNEIGT----HILFRDKKLRLQLSNIE----TGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKC----PDRVTSFPLKGDIHNIVRSDGKTEVLVNE-GMHQVAYALDEGLIEFQTAL-----EDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIGKVKQYK-VNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVA 2196
            +N I++ G D +  V++  GR+L    +S   +E   T  S  P G+ + +GS+N LR+ +   R G W     K   N  ++  + W  DG++  ++  CG G  +F   + + +    FE+       +    +VN+ K ++     IIK+  G + + V  T    YI +     T M+ D+    +S I       +  F+  +D    IY   E  LI    +     +RT+ ++   +S+  N+   +   K++K+ YL +  +        G+   +++  ++  + LN+ G      +   DK   L L+ ++        + L    + + W   ++++ A       +WY         D +    L+ D  +  ++      L N   M +   +L   +I    A+      D  +  AV          +  ++W  LA  A     + ++ AE  YAA+ +  K  Y+         N I ++   +  NA +AL       AE I L+   +  AI+    L+ WD A+E+A
Sbjct:  200 NNLILSGGEDCKYKVWDSYGRVL----YSSAPHEYPITSVSWAPDGELLGVGSFNTLRLCD---RTG-WSYALEKP--NTGSIFNIAWSNDGTQ--LAGACGNGQVIFAHVIERRLEWKNFEMTVTERKSINVRDVVNDSKDTLDFRDRIIKTALGFQ-HLVVATSSQCYIYSVKNFNTPMIFDLKNGNISLIVLS----KRHFLVVDDAGLQIY-SYEGRLIS---APKFQGLRTDVLNEQTVSLS-NDTLAIKDRKDEKVIYLFEASS----GRAVGSGEPLTHTMEVMELALNQCGPTGDRQLAIIDKNRDLYLTPVKHIGPAAKLVKLGTMVTSMAWNDSTNMLAALQDGRFTVWYYPTAVFVDQDILPKTLLEKDSSDFGKNPHILNFLENHCNMRRADGSLCSTIISPYPAMLHKYCSDSKWDDAVRL----CRFVKDPALWACLATMAAYA--KELNTAETAYAAIDEADKVQYI---------NHIKEIPTKEGRNAAMALFCRQVMEAETILLQAGLVYRAIQTNIDLFNWDRALELA 705          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Medaka
Match: ift172 (intraflagellar transport 172 [Source:NCBI gene;Acc:101174877])

HSP 1 Score: 1441.79 bits (3731), Expect = 0.000e+0
Identity = 781/1786 (43.73%), Postives = 1109/1786 (62.09%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQ-GKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQ--VIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSE--IPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASI-QISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHET------IRMFNDNEIGKVKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDII-SADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDE--GRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKE-ASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKI--NLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLV-EAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNE-QIFKQNKKCISENFNKFQIASKV--SRSTECADVLRFINEWCGSLPAS 5310
            M LKH+KT+LPPQ   AK+  + W+PN  K A C+ DRV++L+DE GE++D+F+TK  D KYGK +Y V A+AFSPDS+K+A+GQSD+I++VYK+G+   DKK ICNKF Q                                                +S +  G +SGH DG+I+RYF  D+GS +SQ G++  HP  PYALAWG+ ++ +   CDK++ VY+REG++LQ FD+SRD +EK F VA+++PSG +VV+GS+++                                           +CGG  +FDC  R++ +K KFE+ YV  SQ  VIV N  T  ++++ SY+ +E+ EV+I GKD++++A TS++++LGD+ TN+LSE  +PW  SG  EKF FDN+ VCMI+  GEL+L+EY  + +LG VRTEF++PH I VR+NER +  L+ NKKLAYLID+KTI+V DL  G ++  I+++SKI W+ELNE G H+LFRD+KL+L L +I++ +R  LL+YCS+ QWVPGSDV+VAQS  NLCIWY++  P+ VT+FP                                                A+ FLE++E++ E E+MW+ L+  AL  G + + IAE C+AALGD+    +L +T      +   +  E G    YKV ARLA L  NFKLAE  +L+   +DEAIE YK L+MWD+AI +A  +G+     LR S+YQWLL T Q  +AGE KE  GD+  AI  Y+K+G+P +AAR+A+S+ +I  SA+ +  IA SL+K E +E+                           VELAR +FP++V++LE  WG++LV + Q+D AI H+IE+ S +KAI+AAI+A+QW+K   IL+ QD  +    KYY  +A+HY SI+ +E AE+ F+KG   R A+E Y   G WE  H +    + + E   +Y  +AQ++E DG+F+EAE L  T+ +   AI MYK+N+M   VIRL+ K+ P+ +  T   LA+E E +    +AE ++++  DWKSAV +YR KNMWEDAYR     + ++A+++V +LWA+ LGGE+AVKLL + GLL+ A++++ E   FDFAFEL +  +  K+ EIH K+A+YLEDE  G+F EAE  FI+A KP EAVL +VH +DW  A+RVAEN D DSV DVLVGQA+ +   +D++K+E+ L+RAQRPELAV  YK+ A MW DAIR+CKEYLP+KL  LQE                            + L +Q R+WE + EY RAVECYLK+  D           +MEK  +KA E+ +KFL+ D+A++V+  + PRL ++++F  A++ Y ++D  K+A++  IEGEEW+KAK +A+   P YETYV++KYK +LK+ G+A  L ++D++ AL++YAE+  WDKCL  A      +LHKYLA+YAT LIK   +  AL++YL+YG+    QNFNIYK +F D+ S  D +   SY +   LRDF+ ++  ++   +  +      F++ML  +HY+A RSA     Q L  +  ++S+SLLR+T  IPADKAFYEAG  C+   + SMAFIF N +LDL  +AIE  D S   LD+ DF DTDIP +VPLP K          ++ WVL++S+DQ++E  LP DERN F GSL  + +G  S+PCV++G+PVL N  Q     K    E++N+F + +K+  S S EC DVLRFI  WCG LPAS
Sbjct:    1 MILKHIKTLLPPQEKVAKLPCLAWAPNNNKVAVCTPDRVVLLYDEQGERRDKFSTKPVDPKYGKDSYAVTAMAFSPDSTKIAIGQSDNIIFVYKIGED-GDKKTICNKFVQ------------------------------------------------TSVSGSGVLSGHHDGTIVRYFLSDDGSRESQQGQLVRHPGPPYALAWGT-DSFLVGSCDKKVVVYDREGQVLQTFDYSRDPSEKMFHVAAASPSGHTVVLGSHDQ-----------------------------------------GTMCGGAEMFDCYRRRINFKKKFEITYVSLSQLQVIVRNYSTGTRVVLSSYYDYEMGEVRIMGKDRFLVARTSDSILLGDLMTNRLSEFQVPWSGSGGNEKFFFDNEKVCMIFNVGELSLVEYSSNGVLGSVRTEFMNPHLI-VRLNERSRSGLEDNKKLAYLIDMKTIAV-DLLKGINVGTINHNSKILWLELNETGHHLLFRDRKLQLHLYDIKSSARTTLLSYCSFAQWVPGSDVVVAQSDRNLCIWYSVDSPESVTTFP------------------------------------------------AMEFLETMEMSAEIEAMWKTLSKLAL--GAQQLHIAE-CFAALGDVSMVRFLRQTSDVADKVSQESQGEDG-ASHYKVQARLATLDKNFKLAEMHFLQG-ALDEAIETYKRLHMWDDAIALA--EGYPELDRLRASHYQWLLKTGQQNEAGEVKERQGDFHAAIGHYLKAGLPTKAARVAISRPEISRSAETVEAIAASLVKGEFYER---------------------------VELARAAFPAEVVKLENAWGDHLVQLKQMDAAINHFIEAYS-LKAIEAAIAARQWKKAVHILDIQD--DPSTAKYYIKIAQHYASIRDYEMAEQLFVKGGRVRDAIEMYTTAGRWEEVHKLAVTCMTEEEVAALYVGRAQEMERDGRFREAE-LLTTVKQIDLAIAMYKKNQMFDQVIRLVAKHYPDLLTETHLHLAKELEAELRFSEAEFHFMEAEDWKSAVQMYRAKNMWEDAYRQVAKKHGSDAAQKVVFLWARSLGGEAAVKLLTKFGLLEFAVEFSTE-KYFDFAFELVRLSHKEKLPEIHLKHAIYLEDEFQGKFPEAEVEFIRAGKPNEAVLRYVHNKDWANAERVAENHDPDSVPDVLVGQAKVSLEQKDFQKAEALLLRAQRPELAVTFYKQDAGMWSDAIRICKEYLPNKLGLLQEG--------------------------GEGLLEQAREWEQSGEYSRAVECYLKVKDD-------ANAALMEKCCMKAAELSIKFLSGDRAVEVVRAVAPRLAQLRRFS-AAELYLSMDLFKDAIDVFIEGEEWNKAKRVAKEQEP-YETYVDQKYKEYLKNQGRAESLVDVDVMAALDMYAERGQWDKCLETASKQNLKVLHKYLALYATHLIKEGDAQRALELYLQYGASPNPQNFNIYKHLFLDLVSPPDNDGPDSYRMLANLRDFLLQLCKSVSMSAQANSPAHEDFEQMLLIAHYFATRSASNGQEQ-LITIAAKLSVSLLRHTRTIPADKAFYEAGKACKKVGWESMAFIFLNHFLDLCYQAIE--DDSEGALDHMDFMDTDIPFDVPLPSKVCITEGPLEQIRNWVLTVSVDQQVEQVLPRDERNTFEGSLVAAGSGLRSVPCVLTGYPVLGNNIQFSALGKAANKEDWNRFVMVTKLQTSHSPECQDVLRFIGLWCGGLPAS 1568          
BLAST of Intraflagellar transport protein 172 vs. Ensembl Medaka
Match: ift172 (intraflagellar transport 172 [Source:NCBI gene;Acc:101174877])

HSP 1 Score: 351.288 bits (900), Expect = 3.969e-108
Identity = 184/409 (44.99%), Postives = 263/409 (64.30%), Query Frame = 1
Query: 1591 YCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFN--DNEIGK--VKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDII-SADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFE 2802
            YCS+ QWVPGSDV+VAQS  NLCIWY++  P+ VT+FP+KGDI  + R++GKT VLV EG + VAY LDEGLIEF TA++DGD+ R+ +                           +H+     C+AALGD+    +L +T  + +    E G+     YKV ARLA L  NFKLAE  ++E   +DEAIE YK L+MWD+AI +A  KG+     LR S+YQWLL T Q  +AGE KE  GD+  AI  Y+K+G+P +AAR+A+S+ +I  SA+ +  IA SL+K E +E+ G+LYE   N+  A++ YRKG ++ +AVELAR +FP++V++LE  WG++LV + Q+D   +   ++    ++I+AAI+A+QW+K   IL+ QD  +    KYY  +A+HY SI+ +E
Sbjct:    2 YCSFAQWVPGSDVVVAQSDRNLCIWYSVDSPESVTTFPVKGDITELERAEGKTNVLVKEGANMVAYTLDEGLIEFGTAIDDGDYIRSSN---------------------------QHL-FGSWCFAALGDVSMVRFLRQTSDVADKVSQESGEDGASHYKVQARLATLDKNFKLAEMHFVERGALDEAIETYKRLHMWDDAIALAEAKGYPELDRLRASHYQWLLKTGQQNEAGEVKERQGDFHAAIGHYLKAGLPTKAARVAISRPEISRSAETVEAIAASLVKGEFYERVGDLYEKSGNQLRALEWYRKGGAYAKAVELARAAFPAEVVKLENAWGDHLVQLKQMDARRKR--DTQGTKRSIEAAIAARQWKKAVHILDIQD--DPSTAKYYIKIAQHYASIRDYE 378          
BLAST of Intraflagellar transport protein 172 vs. Planmine SMEST
Match: SMESG000028841.1 (SMESG000028841.1)

HSP 1 Score: 3622.79 bits (9393), Expect = 0.000e+0
Identity = 1761/1765 (99.77%), Postives = 1764/1765 (99.94%), Query Frame = 1
Query:   19 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASIQISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFXXXXXXXXXXXXMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIGKVKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIISADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKINLDTDSNQSDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLKNEQIFKQNKKCISENFNKFQIASKVSRSTECADVLRFINEWCGSLPASG 5313
            MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISN+CGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASIQISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFLESIELTEETESMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIGKVKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIISADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKINLDTDSNQ DETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRN+SYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVL+NEQIFKQNKKCISENFNKFQIASKVSRSTECADVLRFINEWCGSLPASG
Sbjct:    1 MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKKDRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWDDKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYNADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAPYALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSNPSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGSKICISNVCGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIIIKSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQEKFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERKQLNLDKNKKLAYLIDLKTISVLDLCTGASIQISNDSKIDWIELNEIGTHILFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWYNIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQTALEDGDFGRAVSFLESIELTEETESMWRNLADKALLTGIEHIDIAERCYAALGDICKTHYLHETIRMFNDNEIGKVKQYKVNARLALLTNNFKLAENIYLENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQHEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIISADLINRIAQSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDVLRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTILENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNNGMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQEAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQYYLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGESAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMYLEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSDVLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKEYLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWESNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQAIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTLARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKCLTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNIYKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKINLDTDSNQLDETLISFQKMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAGLLCRNRSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEVPLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYTGKDSMPCVISGFPVLRNEQIFKQNKKCISENFNKFQIASKVSRSTECADVLRFINEWCGSLPASG 1765          
The following BLAST results are available for this feature:
BLAST of Intraflagellar transport protein 172 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IFT1720.000e+051.21intraflagellar transport 172 [Source:HGNC Symbol;A... [more]
IFT1720.000e+057.92intraflagellar transport 172 [Source:HGNC Symbol;A... [more]
IFT1720.000e+058.35intraflagellar transport 172 [Source:HGNC Symbol;A... [more]
IFT1723.108e-9044.25intraflagellar transport 172 [Source:HGNC Symbol;A... [more]
IFT1724.556e-5849.26intraflagellar transport 172 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Intraflagellar transport protein 172 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
osm-10.000e+038.98Intraflagellar transport protein osm-1 [Source:Un... [more]
back to top
BLAST of Intraflagellar transport protein 172 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Oseg20.000e+041.96gene:FBgn0035317 transcript:FBtr0332661[more]
Oseg12.044e-622.12gene:FBgn0265102 transcript:FBtr0345038[more]
Oseg12.044e-622.12gene:FBgn0265102 transcript:FBtr0076663[more]
Gbeta53.792e-622.86gene:FBgn0030011 transcript:FBtr0071189[more]
back to top
BLAST of Intraflagellar transport protein 172 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ift1720.000e+050.96intraflagellar transport 172 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Intraflagellar transport protein 172 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdk84.684e-622.62cyclin-dependent kinase 8 [Source:Xenbase;Acc:XB-G... [more]
cdk85.192e-622.62cyclin-dependent kinase 8 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Intraflagellar transport protein 172 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ift1720.000e+051.27intraflagellar transport 172 [Source:MGI Symbol;Ac... [more]
Ift1722.552e-8558.01intraflagellar transport 172 [Source:MGI Symbol;Ac... [more]
Ift1721.093e-7147.06intraflagellar transport 172 [Source:MGI Symbol;Ac... [more]
Ift1723.106e-1750.82intraflagellar transport 172 [Source:MGI Symbol;Ac... [more]
Wdr192.566e-623.32WD repeat domain 19 [Source:MGI Symbol;Acc:MGI:244... [more]
back to top
BLAST of Intraflagellar transport protein 172 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JKU3|IF172_RAT0.000e+051.27Intraflagellar transport protein 172 homolog OS=Ra... [more]
sp|Q6VH22|IF172_MOUSE0.000e+051.27Intraflagellar transport protein 172 homolog OS=Mu... [more]
sp|Q9UG01|IF172_HUMAN0.000e+051.21Intraflagellar transport protein 172 homolog OS=Ho... [more]
sp|Q5RHH4|IF172_DANRE0.000e+050.96Intraflagellar transport protein 172 homolog OS=Da... [more]
sp|Q9W040|OSM1_DROME0.000e+041.96Intraflagellar transport protein 172 homolog OS=Dr... [more]
back to top
BLAST of Intraflagellar transport protein 172 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|234826980.000e+054.53tr|A0A210PPZ5|A0A210PPZ5_MIZYE Intraflagellar tran... [more]
gnl|BL_ORD_ID|203453160.000e+054.79tr|A0A1S3IJ99|A0A1S3IJ99_LINUN intraflagellar tran... [more]
gnl|BL_ORD_ID|157398050.000e+053.39tr|R7TM65|R7TM65_CAPTE WD_REPEATS_REGION domain-co... [more]
gnl|BL_ORD_ID|226139290.000e+053.98tr|A0A2C9JHK5|A0A2C9JHK5_BIOGL Uncharacterized pro... [more]
gnl|BL_ORD_ID|225884860.000e+053.92tr|A0A2C9JHJ2|A0A2C9JHJ2_BIOGL Uncharacterized pro... [more]
back to top
BLAST of Intraflagellar transport protein 172 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ift1720.000e+050.68intraflagellar transport 172 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Intraflagellar transport protein 172 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
IFT1723.159e-949.04intraflagellar transport 172 [Source:HGNC Symbol;A... [more]
ENSPMAT00000007901.15.602e-15461.54pep scaffold:Pmarinus_7.0:GL479708:32874:36568:1 g... [more]
back to top
BLAST of Intraflagellar transport protein 172 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Intraflagellar transport protein 172 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO377860.000e+050.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275262.208e-13057.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258963.242e-1360.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406405.263e-821.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Intraflagellar transport protein 172 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ift1720.000e+043.73intraflagellar transport 172 [Source:NCBI gene;Acc... [more]
ift1723.969e-10844.99intraflagellar transport 172 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Intraflagellar transport protein 172 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000028841.10.000e+099.77SMESG000028841.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030892 ID=SMED30030892|Name=Intraflagellar transport protein 172|organism=Schmidtea mediterranea sexual|type=transcript|length=5365bp
ATATAAATCTTATATGATATGAAATTAAAGCATGTTAAAACTATTTTGCC
TCCTCAGGCTAATGAAGCTAAAATTTGTGCAATTGATTGGTCACCAAATG
GGAAGAAATTTGCTGCATGCTCTGATGATCGTGTAATAATGCTCTTTGAT
GAAAATGGTGAAAAAAAGGATCGTTTTGCGACAAAATCATCTGATACTAA
ATATGGGAAAAAAAATTATGTGGTAAATGCAATTGCATTCAGTCCTGATT
CCTCTAAATTAGCAGTCGGTCAATCAGATAGTATTGTATATGTTTATAAA
CTAGGAGATCGGTGGGATGACAAAAAAGCTATTTGTAATAAATTTTTTCA
ACCAAGTTCTGTTACATGTTTAATATGGCCTATTGATCAACCAATTGTGC
TGGGTTTATTAGATGGAAAAGTGCGAGTTGCAAATATTAAAACCAATAAA
TCTCATACAGTATACAATGCTGATAAATACACGGTTTCACTTTGTTCTAG
TTCAACAAGTAAAGGATTTATTTCCGGTCATTCAGACGGATCTATTATTA
GATATTTCTTTGATGATGAGGGAAGCAATGATTCTCAAGGAAAAGTAGCT
ACTCATCCAAGTGCTCCTTATGCCTTAGCCTGGGGATCAAGCAATACAAT
TATTGCTGCTGGCTGTGATAAGAGGATATATGTTTATAATCGAGAAGGAA
GAATATTACAGCAATTTGATTTTAGTAGAGATCTAAATGAGAAAGAGTTT
ACAGTTGCATCCTCAAACCCTAGCGGCCAGTCGGTTGTTATTGGAAGTTA
TAATAAACTAAGAATTCTTAATTGGAATATTCGCAAAGGAATGTGGGAAG
AGGGTGAAATCAAAGAAATCATAAATTTATATACGGTTTCCGGTCTCTGT
TGGAAAAAAGACGGTTCTAAAATCTGCATTAGTAACATTTGTGGAGGAAT
CAATCTATTTGATTGTTGTTTGCGCAAGGTCATTTACAAGGATAAATTTG
AGCTGAATTATGTCGGCCCAAGTCAAGTGATCGTGAATAATGTTAAAACA
AGCGTTAAAATCATTATCAAATCTTATTTCGGACACGAAATCAACGAAGT
GAAAATCACAGGAAAGGATAAATACATAATTGCTCATACCTCAGAAACTC
TGATGCTAGGAGACATGAGCACTAACAAATTAAGCGAAATCCCATGGCAA
TCGTCAGGAGTTCAAGAGAAATTCATATTTGACAATGATAATGTTTGTAT
GATATATAAAGGGGGAGAATTGACTTTAATCGAATATGGGTTGAGCGAGA
TACTAGGGTGTGTAAGGACTGAATTTATTAGTCCTCATCATATCAGTGTG
AGAATAAACGAGAGAAAACAACTGAATTTGGATAAAAACAAAAAGTTAGC
CTATCTCATTGATTTGAAAACGATTTCCGTGTTGGATCTGTGCACGGGGG
CTTCTATTCAAATATCAAATGATTCAAAGATTGATTGGATAGAACTCAAT
GAAATCGGAACGCATATCTTGTTTCGTGACAAGAAGTTAAGACTGCAATT
AAGCAATATCGAAACTGGAAGTAGAATAAATCTATTAAATTACTGTTCCT
ATGTACAATGGGTTCCGGGAAGTGACGTAATTGTAGCTCAGTCGCGAGAG
AACTTGTGCATTTGGTATAATATCAAGTGTCCTGATAGAGTGACGTCTTT
TCCTTTAAAAGGGGATATCCACAATATCGTTAGAAGTGATGGGAAAACCG
AAGTTTTAGTCAACGAAGGCATGCATCAGGTTGCCTATGCATTGGATGAA
GGATTGATTGAGTTTCAAACTGCTTTAGAAGACGGTGATTTTGGTCGGGC
TGTCAGTTTTCTGGAATCGATTGAATTGACCGAGGAAACGGAATCTATGT
GGAGAAACCTGGCAGATAAAGCCCTTCTGACCGGAATAGAACACATCGAC
ATTGCAGAACGATGCTATGCAGCCCTCGGAGATATTTGCAAAACGCATTA
TTTGCACGAGACCATCAGAATGTTCAATGATAATGAAATCGGAAAAGTTA
AACAATACAAAGTCAATGCACGGTTGGCATTGTTGACGAACAATTTCAAA
TTGGCGGAAAATATATATTTAGAAAACAACAAAATTGATGAAGCTATAGA
AATGTATAAATCTCTTTATATGTGGGACGAGGCTATTGAAGTTGCAACCA
TTAAAGGACATTCATCTGAAGCTTCTTTGAGAAACTCTTATTATCAGTGG
TTATTAAATACCAATCAGCATGAAAAGGCAGGAGAAACAAAAGAAATAAA
TGGCGATTATTTAGACGCCATCAGTTTATACATCAAAAGTGGAGTGCCAG
CTAGAGCAGCAAGACTAGCACTTTCAAAACGTGATATTATTTCAGCTGAT
TTAATAAATAGAATTGCTCAGTCATTGTTAAAGTTCGAATTGTTTGAAAA
GGCGGGCGAATTGTATGAATTGGTAGCTAATAAAAGTGAAGCAATGAAGT
GTTATCGCAAAGGAAATTCTTTCCAAAGAGCTGTAGAATTAGCCAGAGAT
TCATTTCCTAGCGATGTTTTACGATTAGAAGAGGAATGGGGCAATTATTT
AGTCAGCATCCACCAGTTAGACAATGCTATCCAGCACTACATAGAAAGCG
GTTCATATGTCAAGGCGATTGATGCAGCAATAAGTGCCCAGCAATGGCAG
AAGGTATCGACTATTTTAGAAAACCAAGATGGCAATAACAAAGATTTCAC
AAAATACTATCGAATACTCGCTGAGCACTATCTATCGATTAAAAAATTTG
AGAAAGCAGAAGAATATTTTATTAAAGGAAGTTTCTACAGGCAAGCAGTT
GAAGCTTATTTGAATAATGGGATGTGGGAGCGGGCTCACTCCATTGGCAG
TCGGTATCTGGATAAATCGGAATTTATGAAAATGTATGAAGCTCAAGCCC
AACAATTGGAGGTTGATGGGAAATTTAAGGAGGCTGAGAAATTATTTTTA
ACCATAGATCGGCCACAAGAGGCTATAAACATGTACAAGAGAAATAAAAT
GCAAAAAGATGTTATTAGACTAATAAATAAATATAATCCAGAAGAAATAG
ATCCAACTTTGTCAAAGCTGGCTGAAGAGGCTGAAAAAGATGGCAATATC
AAACAAGCTGAACAATATTATTTACAGATAGGAGATTGGAAATCTGCTGT
TAATCTCTATCGGAAAAAGAATATGTGGGAAGATGCGTACAGAGTATCAC
AGGCAATAAATGATGCAGAAGCATCAAAACAAGTTGGTTATTTGTGGGCC
AAGCATTTGGGAGGTGAATCTGCAGTGAAATTACTTAACAGGTTAGGTCT
ATTAGATAAAGCGATAGATTATGCTTGTGAGCATAATGCCTTCGACTTTG
CTTTTGAATTAGGAAAATCAGTGAATGATTCTAAGATGTCTGAAATCCAT
GGTAAATACGCAATGTATTTAGAAGATGAAGGCCGTTTCTCAGAGGCTGA
GGCAGCCTTTATAAAAGCAAATAAACCAAGAGAAGCTGTATTAATGTGGG
TGCATCAACAGGATTGGGATGCTGCTCAGCGTGTTGCTGAAAACTTTGAT
TCAGATAGTGTTTCGGATGTCTTAGTTGGTCAAGCTCGATTCGCGTTTAA
TAGTCGAGATTATAAAAAATCTGAATCATATTTAATAAGAGCTCAAAGAC
CAGAATTGGCTGTTAAACTATATAAAGAAGCCTCTATGTGGGATGATGCG
ATTCGAGTCTGCAAAGAATATTTACCTCATAAATTAGAAGACCTTCAAGA
GGATTATGATAGAGAATTATCATTGCATTATAACAAATCTGATAAAATGA
ATATGGGTAAACCCAATGATACCGTAAATATCTTCCAAAACCTTCAAGAT
CAGGGTCGCCAGTGGGAGAGCAACAAAGAATATCTTCGTGCAGTTGAATG
TTACTTAAAAATTTCATTGGATTTAGTAGAAATTCCAACTCAAATTGAAG
TTCAAATAATGGAAAAGTCATGGATAAAAGCAGGTGAAATTTGCCTGAAA
TTTCTAACTAATGATCAAGCCATAAAAGTAATTGAAATAATTGGTCCGCG
TTTGATCAAAATCAAGAAATTTATATTGGCATCAGACTTTTACAAAGCTG
TAGATAAAGTTAAAGAAGCACTGAATGCTCTGATTGAAGGAGAAGAATGG
GATAAAGCAAAAACTCTTGCACGCGGAGTCAATCCGAAATATGAAACTTA
TGTGGAAGAAAAATATAAAATATTTTTGAAATCTTCTGGTAAAGCAGCAG
AATTGGAAAATCTAGACATGATTGAAGCTCTAAATATATATGCAGAGCAA
AACAATTGGGATAAGTGCTTGACAATGGCACAGGACACAACGCCACATAT
TCTGCACAAATACCTGGCAATGTATGCCACACAATTAATCAAATCCAATC
AAAGTCCCTATGCGTTGCAAATGTACCTGAAATACGGATCACCTTATTTT
GAACAAAATTTTAACATTTACAAAAGAATTTTCAAAGACATTTCATCGAT
GCGAGATACCAATAACGGGAAATCCTATCCTTTGTGGGGTAAATTGCGCG
ATTTCATGTTTAAGATCAACCTCGATACCGACTCTAATCAATCGGACGAG
ACTCTAATTTCCTTTCAAAAAATGCTCCACACTTCTCATTATTACGCTAT
TCGTTCTGCGATGATGGCGTCCAATCAAAATCTCGATGAGCTCATAACGC
AAATCTCAATCTCGTTGCTCAGATACACAGATATTATCCCTGCCGATAAG
GCATTTTATGAGGCGGGACTTCTATGCAGGAATAAAAGCTATTTCAGCAT
GGCGTTCATATTTTTCAATCGATATCTTGATCTGGTTGAAGCAATAGAGG
ATCCGGACGGATCTTCTGATCTATTGGATAACACGGATTTTGAGGATACC
GATATTCCGTTGGAAGTGCCACTACCGGATAAACGGTACACAAACACCCA
GGAGCACAATGACGTTAAGGAATGGGTTTTATCCATGTCGATGGATCAGA
AATTGGAGCATAAATTACCAACAGATGAAAGGAACATATTTATAGGGTCA
TTACATGATAGTTATACGGGAAAGGACTCGATGCCCTGTGTGATATCGGG
ATTCCCGGTATTGAAAAATGAGCAAATATTCAAACAAAATAAGAAATGCA
TATCAGAAAATTTTAATAAATTTCAAATCGCTTCTAAAGTTAGCCGTTCA
ACAGAATGTGCTGACGTGCTGCGGTTCATTAATGAATGGTGTGGTTCGCT
TCCTGCTAGTGGTTAAGCGGTCGACACCTCAGGAGGTGTAATTTCATAAT
GGTATAACAATCGTC
back to top

protein sequence of SMED30030892-orf-1

>SMED30030892-orf-1 ID=SMED30030892-orf-1|Name=SMED30030892-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1766bp
MKLKHVKTILPPQANEAKICAIDWSPNGKKFAACSDDRVIMLFDENGEKK
DRFATKSSDTKYGKKNYVVNAIAFSPDSSKLAVGQSDSIVYVYKLGDRWD
DKKAICNKFFQPSSVTCLIWPIDQPIVLGLLDGKVRVANIKTNKSHTVYN
ADKYTVSLCSSSTSKGFISGHSDGSIIRYFFDDEGSNDSQGKVATHPSAP
YALAWGSSNTIIAAGCDKRIYVYNREGRILQQFDFSRDLNEKEFTVASSN
PSGQSVVIGSYNKLRILNWNIRKGMWEEGEIKEIINLYTVSGLCWKKDGS
KICISNICGGINLFDCCLRKVIYKDKFELNYVGPSQVIVNNVKTSVKIII
KSYFGHEINEVKITGKDKYIIAHTSETLMLGDMSTNKLSEIPWQSSGVQE
KFIFDNDNVCMIYKGGELTLIEYGLSEILGCVRTEFISPHHISVRINERK
QLNLDKNKKLAYLIDLKTISVLDLCTGASIQISNDSKIDWIELNEIGTHI
LFRDKKLRLQLSNIETGSRINLLNYCSYVQWVPGSDVIVAQSRENLCIWY
NIKCPDRVTSFPLKGDIHNIVRSDGKTEVLVNEGMHQVAYALDEGLIEFQ
TALEDGDFGRAVSFLESIELTEETESMWRNLADKALLTGIEHIDIAERCY
AALGDICKTHYLHETIRMFNDNEIGKVKQYKVNARLALLTNNFKLAENIY
LENNKIDEAIEMYKSLYMWDEAIEVATIKGHSSEASLRNSYYQWLLNTNQ
HEKAGETKEINGDYLDAISLYIKSGVPARAARLALSKRDIISADLINRIA
QSLLKFELFEKAGELYELVANKSEAMKCYRKGNSFQRAVELARDSFPSDV
LRLEEEWGNYLVSIHQLDNAIQHYIESGSYVKAIDAAISAQQWQKVSTIL
ENQDGNNKDFTKYYRILAEHYLSIKKFEKAEEYFIKGSFYRQAVEAYLNN
GMWERAHSIGSRYLDKSEFMKMYEAQAQQLEVDGKFKEAEKLFLTIDRPQ
EAINMYKRNKMQKDVIRLINKYNPEEIDPTLSKLAEEAEKDGNIKQAEQY
YLQIGDWKSAVNLYRKKNMWEDAYRVSQAINDAEASKQVGYLWAKHLGGE
SAVKLLNRLGLLDKAIDYACEHNAFDFAFELGKSVNDSKMSEIHGKYAMY
LEDEGRFSEAEAAFIKANKPREAVLMWVHQQDWDAAQRVAENFDSDSVSD
VLVGQARFAFNSRDYKKSESYLIRAQRPELAVKLYKEASMWDDAIRVCKE
YLPHKLEDLQEDYDRELSLHYNKSDKMNMGKPNDTVNIFQNLQDQGRQWE
SNKEYLRAVECYLKISLDLVEIPTQIEVQIMEKSWIKAGEICLKFLTNDQ
AIKVIEIIGPRLIKIKKFILASDFYKAVDKVKEALNALIEGEEWDKAKTL
ARGVNPKYETYVEEKYKIFLKSSGKAAELENLDMIEALNIYAEQNNWDKC
LTMAQDTTPHILHKYLAMYATQLIKSNQSPYALQMYLKYGSPYFEQNFNI
YKRIFKDISSMRDTNNGKSYPLWGKLRDFMFKINLDTDSNQSDETLISFQ
KMLHTSHYYAIRSAMMASNQNLDELITQISISLLRYTDIIPADKAFYEAG
LLCRNKSYFSMAFIFFNRYLDLVEAIEDPDGSSDLLDNTDFEDTDIPLEV
PLPDKRYTNTQEHNDVKEWVLSMSMDQKLEHKLPTDERNIFIGSLHDSYT
GKDSMPCVISGFPVLKNEQIFKQNKKCISENFNKFQIASKVSRSTECADV
LRFINEWCGSLPASG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005929cilium
GO:0005930axoneme
GO:0030992intraciliary transport particle B
GO:0036064ciliary basal body
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
IPR011990TPR-like_helical_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0032006regulation of TOR signaling
GO:0045494photoreceptor cell maintenance
GO:0048793pronephros development
GO:0060041retina development in camera-type eye
GO:0060271cilium morphogenesis