Protocadherin gamma

Overview
NameProtocadherin gamma
Smed IDSMED30030878
Length (bp)3115
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin gamma (SMED30030878) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin gamma (SMED30030878) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin gamma (SMED30030878) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin gamma (SMED30030878) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030878

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030878SMESG000036716.1 SmedASXL_015287SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30030878SMESG000036716.1 dd_Smed_v4_15643_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030878SMESG000036716.1 dd_Smed_v4_15643_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30030878SMESG000036716.1 dd_Smed_v6_15643_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30030878SMESG000036716.1 OX_Smed_1.0.16184ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 254.218 bits (648), Expect = 9.751e-70
Identity = 234/807 (29.00%), Postives = 375/807 (46.47%), Query Frame = 1
Query:  100 LYIFQCLIN-LRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGE---MGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVT-YKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
             Y+   LI  LRL     Q  ++I Y I+E  P    IG I +D+ +S        S  + YR   +        V  S   I  T   ID E+LC       E     +L +V+   D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N V  Y+L     ++    +     + +P L++++ LD E+   Y + I   +     + +   + + V ++ND  P FK+ + EV + EN P+ + +IQ+ A D D   ++EI Y    + A  + + F+++ + G I ++R LD E T++H + V ASD     A   V I V DVND  P  +L    +P      + E  P N  I  IT+ D+D++  NGK+ C+  R +          P   K  Y  +Y L T    D E T +   K++      + K  L  T  + + + D NDN PIF + V  +S+ ENN     +  ++ATD+D G+N  + Y+      + P  S F +D  +G +TA+   DRE++  +   + A+D GT P Q  S   + +T++D NDNSPKF     +  + EN    + VG++  TD D G+N  +   +L N N+NF     +G ++S   FDRE    Y   ++  D G+ P S T  V IN++DVNDN P +I P  +  +  +  S +              PG  + +  A D+D G NA   + I   N+  +F IDP  G + ++ K     +G + + + + D G P  +H+
Sbjct:    6 FYLLAALIACLRLDSAIAQ--ELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPDTG--FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDV-NGKVICFIEREV----------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASD---SGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ------LGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSIL-NDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHT 766          

HSP 2 Score: 132.88 bits (333), Expect = 9.749e-31
Identity = 160/585 (27.35%), Postives = 254/585 (43.42%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSK---GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      +  E+    + F              Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F       ++E   PEN  +G   I    ++A  G  S  E R ++  Q      P   + F       L T  R  DREET      V+       +  P  +T+TI++T  D+NDN P      I      +V + E +PV+ K+  +T +DKD   NG V   I+  R + P     V D+     T++L LD E    +   IVA D G     QT+   + + + D NDN P F  P  +L + EN + G  +  + ATD D G N  ++++L PN   +FF L    G L +++ FDRE  +R+   +   D G  PL     V + +LD NDN P+      H  + +          ++ +L  Y + G        +D D GEN A    +S+ ND D F +DP  G+++      +E    Y   +   D G+P +  + K+ + + D+
Sbjct:  126 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEG----QVEVHIPENAPVGTSVIQLHATDADIG--SNAEIRYIFGAQVA----PATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD---GSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REV-PFHLKAVYDNQYLLETSSL-LDYEGTKEFSFKIVASDSGKPSLNQTA--LVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN--ASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDADAGENKAV--TLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDV 668          
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 254.218 bits (648), Expect = 3.240e-69
Identity = 235/808 (29.08%), Postives = 375/808 (46.41%), Query Frame = 1
Query:  100 LYIFQCLIN-LRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGE---MGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVT-YKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIF--ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
             Y+   LI  LRL     Q  ++I Y I+E  P    IG I +D+ +S        S  + YR   +        V  S   I  T   ID E+LC       E     +L +V+   D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N V  Y+L     ++    +     + +P L++++ LD E+   Y + I   +     + +   + + V ++ND  P FK+ + EV + EN P+ + +IQ+ A D D   ++EI Y    + A  + + F+++ + G I ++R LD E T++H + V ASD     A   V I V DVND  P  +L    +P      + E  P N  I  IT+ D+D++  NGK+ C+  R +          P   K  Y  +Y L T    D E T +   K++      + K  L  T  + + + D NDN PIF + V  +S+ ENN     +  ++ATD+D G+N  + Y+      + P  S F +D  +G +TA+   DRE++  +   + A+D GT P Q  S   + +T++D NDNSPKF      + F  EN    + VG++  TD D G+N  +   +L N N+NF     +G ++S   FDRE    Y   ++  D G+ P S T  V IN++DVNDN P +I P  +  +  +  S +              PG  + +  A D+D G NA   + I   N+  +F IDP  G + ++ K     +G + + + + D G P  +H+
Sbjct:    6 FYLLAALIACLRLDSAIAQ--ELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPDTG--FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDV-NGKVICFIEREV----------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASD---SGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ------LGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTH-NHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSIL-NDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHT 766          

HSP 2 Score: 132.494 bits (332), Expect = 1.340e-30
Identity = 160/585 (27.35%), Postives = 254/585 (43.42%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSK---GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      +  E+    + F              Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F       ++E   PEN  +G   I    ++A  G  S  E R ++  Q      P   + F       L T  R  DREET      V+       +  P  +T+TI++T  D+NDN P      I      +V + E +PV+ K+  +T +DKD   NG V   I+  R + P     V D+     T++L LD E    +   IVA D G     QT+   + + + D NDN P F  P  +L + EN + G  +  + ATD D G N  ++++L PN   +FF L    G L +++ FDRE  +R+   +   D G  PL     V + +LD NDN P+      H  + +          ++ +L  Y + G        +D D GEN A    +S+ ND D F +DP  G+++      +E    Y   +   D G+P +  + K+ + + D+
Sbjct:  126 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEG----QVEVHIPENAPVGTSVIQLHATDADIG--SNAEIRYIFGAQVA----PATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD---GSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REV-PFHLKAVYDNQYLLETSSL-LDYEGTKEFSFKIVASDSGKPSLNQTA--LVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN--ASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDADAGENKAV--TLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDV 668          
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 254.218 bits (648), Expect = 3.777e-69
Identity = 235/808 (29.08%), Postives = 375/808 (46.41%), Query Frame = 1
Query:  100 LYIFQCLIN-LRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGE---MGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVT-YKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIF--ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
             Y+   LI  LRL     Q  ++I Y I+E  P    IG I +D+ +S        S  + YR   +        V  S   I  T   ID E+LC       E     +L +V+   D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N V  Y+L     ++    +     + +P L++++ LD E+   Y + I   +     + +   + + V ++ND  P FK+ + EV + EN P+ + +IQ+ A D D   ++EI Y    + A  + + F+++ + G I ++R LD E T++H + V ASD     A   V I V DVND  P  +L    +P      + E  P N  I  IT+ D+D++  NGK+ C+  R +          P   K  Y  +Y L T    D E T +   K++      + K  L  T  + + + D NDN PIF + V  +S+ ENN     +  ++ATD+D G+N  + Y+      + P  S F +D  +G +TA+   DRE++  +   + A+D GT P Q  S   + +T++D NDNSPKF      + F  EN    + VG++  TD D G+N  +   +L N N+NF     +G ++S   FDRE    Y   ++  D G+ P S T  V IN++DVNDN P +I P  +  +  +  S +              PG  + +  A D+D G NA   + I   N+  +F IDP  G + ++ K     +G + + + + D G P  +H+
Sbjct:    6 FYLLAALIACLRLDSAIAQ--ELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPDTG--FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDV-NGKVICFIEREV----------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASD---SGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ------LGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTH-NHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSIL-NDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHT 766          

HSP 2 Score: 132.494 bits (332), Expect = 1.402e-30
Identity = 160/585 (27.35%), Postives = 254/585 (43.42%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSK---GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      +  E+    + F              Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F       ++E   PEN  +G   I    ++A  G  S  E R ++  Q      P   + F       L T  R  DREET      V+       +  P  +T+TI++T  D+NDN P      I      +V + E +PV+ K+  +T +DKD   NG V   I+  R + P     V D+     T++L LD E    +   IVA D G     QT+   + + + D NDN P F  P  +L + EN + G  +  + ATD D G N  ++++L PN   +FF L    G L +++ FDRE  +R+   +   D G  PL     V + +LD NDN P+      H  + +          ++ +L  Y + G        +D D GEN A    +S+ ND D F +DP  G+++      +E    Y   +   D G+P +  + K+ + + D+
Sbjct:  126 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEG----QVEVHIPENAPVGTSVIQLHATDADIG--SNAEIRYIFGAQVA----PATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD---GSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REV-PFHLKAVYDNQYLLETSSL-LDYEGTKEFSFKIVASDSGKPSLNQTA--LVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN--ASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDADAGENKAV--TLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDV 668          
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 253.832 bits (647), Expect = 4.887e-69
Identity = 235/808 (29.08%), Postives = 375/808 (46.41%), Query Frame = 1
Query:  100 LYIFQCLIN-LRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGE---MGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVT-YKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIF--ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
             Y+   LI  LRL     Q  ++I Y I+E  P    IG I +D+ +S        S  + YR   +        V  S   I  T   ID E+LC       E     +L +V+   D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N V  Y+L     ++    +     + +P L++++ LD E+   Y + I   +     + +   + + V ++ND  P FK+ + EV + EN P+ + +IQ+ A D D   ++EI Y    + A  + + F+++ + G I ++R LD E T++H + V ASD     A   V I V DVND  P  +L    +P      + E  P N  I  IT+ D+D++  NGK+ C+  R +          P   K  Y  +Y L T    D E T +   K++      + K  L  T  + + + D NDN PIF + V  +S+ ENN     +  ++ATD+D G+N  + Y+      + P  S F +D  +G +TA+   DRE++  +   + A+D GT P Q  S   + +T++D NDNSPKF      + F  EN    + VG++  TD D G+N  +   +L N N+NF     +G ++S   FDRE    Y   ++  D G+ P S T  V IN++DVNDN P +I P  +  +  +  S +              PG  + +  A D+D G NA   + I   N+  +F IDP  G + ++ K     +G + + + + D G P  +H+
Sbjct:    6 FYLLAALIACLRLDSAIAQ--ELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPDTG--FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDV-NGKVICFIEREV----------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASD---SGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ------LGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTH-NHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSIL-NDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHT 766          

HSP 2 Score: 132.494 bits (332), Expect = 1.339e-30
Identity = 160/585 (27.35%), Postives = 254/585 (43.42%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSK---GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      +  E+    + F              Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F       ++E   PEN  +G   I    ++A  G  S  E R ++  Q      P   + F       L T  R  DREET      V+       +  P  +T+TI++T  D+NDN P      I      +V + E +PV+ K+  +T +DKD   NG V   I+  R + P     V D+     T++L LD E    +   IVA D G     QT+   + + + D NDN P F  P  +L + EN + G  +  + ATD D G N  ++++L PN   +FF L    G L +++ FDRE  +R+   +   D G  PL     V + +LD NDN P+      H  + +          ++ +L  Y + G        +D D GEN A    +S+ ND D F +DP  G+++      +E    Y   +   D G+P +  + K+ + + D+
Sbjct:  126 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEG----QVEVHIPENAPVGTSVIQLHATDADIG--SNAEIRYIFGAQVA----PATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD---GSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REV-PFHLKAVYDNQYLLETSSL-LDYEGTKEFSFKIVASDSGKPSLNQTA--LVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN--ASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDADAGENKAV--TLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDV 668          
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 249.98 bits (637), Expect = 3.267e-68
Identity = 236/824 (28.64%), Postives = 382/824 (46.36%), Query Frame = 1
Query:   55 VKQDTMKQIKCSLFLLYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLS---TQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCP-----DHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFSS----QYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKIL 2451
            V+ +T    KC L   YIF  L+   +++   Q  +   Y I+E  P    IG + +D+ LS    + +   +  K+ Y+        + +    I  T   ID E+LC      +HC        Y V        +  ++++   ++D+NDN P F  + I  S+ E    +     L  A+D DV   +    Y+L    +I+    +     D  P L+++K LD E    Y + +   +     + +   + + V + ND  P FK+ + EVS+ EN P+ + + Q+ A D D  E+++I +  ++  S    + F + ++ G I +K PLD E T  H + V ASD     A   V++ V DVND  P  ++    NP      + E  P N  I  IT+ D+D++  NG+++C+    +  +     +P      F  ++ L      D E T +   K++      A K PL  +  + + + D NDN P+F ++  +VSI ENN    +++KV+ATD D G N  + Y +       PE   F +D  +G +T   KLDREKE  Y   I+AKD G  P   TS+ T+ ++IID NDNSP F   + K  + EN      VG++  TD D GDN  +   +L + N++F   +  G ++    FDRE  + Y   ++  D G+   S +  V IN++DVNDN P  I P Y+  Y  +  ST              +PG  + +  A D D G NA   + I   N  D+F+ID + G + +  K     +G + V +   D G+P  + S  I+
Sbjct:   13 VRVNTTNCHKCLLSGTYIFAVLLVCVVFHSGAQEKN---YTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-------FYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVGI-NGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADH-NGRVTCFTDHEIPFR----LRP-----VFSNQFLLENAAYLDYESTKEYAIKLLAA---DAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLG--PDAPPE---FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPP--LTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSIL-DENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPST--------------NPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIV 789          

HSP 2 Score: 146.747 bits (369), Expect = 4.587e-35
Identity = 105/359 (29.25%), Postives = 176/359 (49.03%), Query Frame = 1
Query: 1423 TSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI-GP--KKLEIFENEKPGTEVGILIATDNDEGDNGKLL--------FKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            +ST  + +++ D NDN P+F++    VSI EN PV   V ++ ATD DIG N  + +   NL S N  + LF +++ +G +T    LDRE+   ++L+++A D G MP +      +     +V     ++I  P    + + EN    T++ ++  TD D   NG++         F+L P  +  F        L++A   D E+T  Y +++   D GK PL+ +  + I + D NDN P  +F                +  +T+ +    SPG +++K  A+D D G NA  ++ +  P+ P  FS+D + G+L V +KL +E    Y   I+ +DNG P    +  + V I D
Sbjct:  251 SSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVS-NIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFL-------LENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAP--VF---------------TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLG-PDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIID 583          

HSP 3 Score: 122.094 bits (305), Expect = 2.001e-27
Identity = 151/573 (26.35%), Postives = 238/573 (41.54%), Query Frame = 1
Query:  808 NINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSKG---QIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVI---TVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            +IND  P F      +S+ EN  INS      AVD D      ++ E+      F              Q+ +++ LD E    +++ V+  D  F   +   I   +V D ND  P F        I E  P    + Q+   D D    N K+       + N    +F   L++ T      +  +   DREET +    V+      +    + +   + + + D+NDN P      I      +V + EN P++ K+  +T TDKD   NG VT   D+         L  + S+   +     LD E    Y + ++A D G  P  Q  S  + I + D NDN+P F      + I EN  PG ++  + ATD D G N ++ + L P+    F      G L   K+ DRE  D+Y   I   D G  PL+   TV ++I+D NDN P     +Y  K+   +N           L  + + G        +D D G+N+A    +S+ ++ D F+ID Q G++R      +E    Y   +  ED G+ S+  S K+ + + D+
Sbjct:  152 DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADI-GENAKIHFSFSNLVSNIARRLFH--LNATTGL----ITIKEPLDREETPNHKLLVL-----ASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFR----LRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQ--SAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEY--KFYVPEN-----------LPRHGTVGL----ITVTDPDYGDNSA--VTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDV 687          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 182.57 bits (462), Expect = 2.686e-46
Identity = 179/596 (30.03%), Postives = 288/596 (48.32%), Query Frame = 1
Query:  415 VVNVWDGL--SLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDAD----IYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFS---VSSKGQIF-----LKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY----GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIG-PKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL----TINGSLQ--SAKEFDRET-TDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRL 2124
            V+   DG   +L   + + INV D+ND+ PT + +  + +++E +  +G+ +    AID D S  +  + Y ++      I  D+ ++K T          K LD E    Y+L + A +    +  T  +I + + +IND  P F +++Y V++ E +P  S II ++AVD DED +ITYR  +   + FS   +  +G I      LKR  D +      +++ A+D        VV   +D  + AP FN +P   +I E  P    +  IT+   D +  +        R +Y+         +DS  F+       D+      DRE+       V        A  PL ++  I + + DINDN+P F  + Y+ +I E+ PV    ++V+A D DIG NG+V Y + N  S +P   LF +D  SG +  + KLDRE+ +   L I A+D+GT P    +S  I +T+ DVNDN+P F      L I EN   G+ VG ++A D DEGDN  + F++    +   F +      NG ++  +  EFD E   +++  +++ +      LS T  V I++ DVNDN P L
Sbjct:  448 VIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENV-AIGEEVGRVYAIDED-SGPNGIIKYSMEGSEDFIIDEDSGLIKTT----------KLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ-DHKVR----VEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPV--ITLKAEDHDRGDNA------RIVYS---------IDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDH---ASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFL-NESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGT-PSLSAAS-EITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQAS---SGQLSSTVPVRIHVSDVNDNKPAL 1000          

HSP 2 Score: 145.591 bits (366), Expect = 6.534e-35
Identity = 163/544 (29.96%), Postives = 255/544 (46.88%), Query Frame = 1
Query:  832 FKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSA----DFSSQ-YFSVSS-KGQIFLKRPLDFETTSLHLIDVQA---SDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGK----LSCWEPRNLY---NKQAVI-FKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKL-EIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFS---IDPQIGILRVKRKLKKELIGDYNVQI 2400
            F+Q+KY   + E+ PI ++I  V+A      S+  Y S     D  SQ  F++ +  G+I L + +D E    H++ V A    D   +A+T VV+ V+DV D +P F  +  F  I E  P    +  +   D DS   NG+    L     +NL     K  VI    PLD +T        + +R D           +I  D G  K    ST  + +T+ D+NDN P+F    Y+V+I EN  + A +  V ATD+D G NG V Y + +   +        ID  +G VT   ++D  K S    +I AKD G  P   +S+  + I +ID+ND++P  I  +K+  + EN   G EVG + A D D G NG + + +    +E+F     +G +++ K  DRETT RY L++   D G   L+ + T+ + + D+NDN P                 T  K+   + +S     G +I+  +A D DE +   +    +   D ++FS   I  Q  IL V  +LK++   D+ V++
Sbjct:  165 FQQEKYVKELPEDTPIETIIASVKA--SHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDS-GENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETL-------SLIRLD-----------VIASDKGTPKR--ESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG----LTIDYSTGEVTLRERID-AKNSPITAVIRAKD-GAQPA-LSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM--EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAP-----------------TFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEA---DREVFSILDIGDQGAILSVSGELKRQ---DHKVRV 653          

HSP 3 Score: 141.739 bits (356), Expect = 1.044e-33
Identity = 190/757 (25.10%), Postives = 316/757 (41.74%), Query Frame = 1
Query:  178 IKENQP---GQTRIGKISEDVPLSTQMI---LRNLSEKINYRFQKQLS------YFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTND-SFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLS----ITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDED-SEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAA-KNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKP-GTEVGILIATDNDEGDNGKLLFKLLPNHNE---NFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYE-SP-GFEILKCEASDLDEGENAAFHFRISLPNDPDIFSID---PQIGILRV 2352
            +++N P     +  G+I ED P+ T ++    R+L    N   +  L          +++ + +++T   +D E L         + +L ++ +       +    VEI V DVNDN P F + S   ++ E I  +   +   KA D D          K+   + S + +  +T D S   + L++ +D +     N  I A     D  +  LS    +TI V++IND  P     +  +++EEN+ I   + +V A+DED   + I   S + S  +      G I   + LD ETT+ + + V A D      N +T + + + D+ND AP F+       I E  P    I  +   D D +                 Q + ++     +  +   D+  +            +   +  +  A  +  L     +++ I D+N + P F    +SV I E++P+   VI + A D D G N  + Y ID+          F ID  SG ++ +  LDRE  + + +I+ A D  + P    +S  I + + D+NDNSP+F           + P GT    + A D D G NG + + L  + +      F L   +G+L+ + + DRE      L I   D+G   LS    + + + DVNDN P                     E ++ DL I E SP G  +    A D DEG+NA   FRI    D  +F I+    Q G++R+
Sbjct:  263 VQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETL--------SLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENIT-IPAVIATVKATDEDFGTNG-----KVHYSMASSSGIGGLTIDYSTGEVTLRERIDAK-----NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDED-----------------QKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS-------SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLN--TSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF-------------------EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRI 954          

HSP 4 Score: 138.272 bits (347), Expect = 1.439e-32
Identity = 170/688 (24.71%), Postives = 301/688 (43.75%), Query Frame = 1
Query:  460 VEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFSSQYFSVS---SKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYD---LYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLF-VID-SDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAF-HFRISLPNDPDI--FSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            V ++V DV DN P F   S    ++E    +G ++    A D D S E+  + Y L      +   L   N    ++     LD E   L  L + A +     +++   + I VV++ND  P F    Y V++ EN+ I ++I  V+A DED   + ++ Y  A  SS    ++   S G++ L+  +D + + +  + ++A D      ++   + I V+D+ND AP          +EE       +G++   D DS   NG +        Y+ +         S+ F    D   + T    DRE T     KV        +   L ++ TI++ + DINDN P F+K  Y+V+I E  P  +++I + A D D   +  +TY I+       ++ +F ++D  D G + +     + ++   ++ I A D+G +  +      +    ID  +++P F   P  ++I E+   G  V  L A D+D GDN ++++ +    +  FF +   +G +  + + DRE    + + +  +D    PL+ +  + + + D+NDN P+     Y               +I+ D+ +    G   L+  A D D G N    +F     + P I  F +D   G LRV  KL +E      + I   D G PS   + +I + + D+
Sbjct:  256 VVVHVLDVQDNSPIFEKDSYFGEIREDA-PIGTTVLSVFARDLD-SGENGEIEYSLGE---GNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS-SSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDS-GPNGIIK-------YSMEG--------SEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPS---LNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIE-----EADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGR-----CVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI---DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSY-------------AATISEDIPV----GTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDV 885          

HSP 5 Score: 117.472 bits (293), Expect = 3.442e-26
Identity = 105/354 (29.66%), Postives = 174/354 (49.15%), Query Frame = 1
Query: 1420 LTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTIN---GSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            ++++ T+ + + D+ DN+PIFEK  Y   I E+ P+   V+ V A D D G NG + Y +         K+L  I++ SG +     LDRE  S  +L ++A DKGT PK++ S+  + IT++DVNDN+P F      + I EN      +  + ATD D G NGK+ + +    +     LTI+   G +   +  D + +    + I   D  +  LS T  + IN++D+ND+ P LI                 ++ IT++ ++  + G E+ +  A D D G N    + +    D   F ID   G+++  + L +E    Y++++   D G PS   S  I V ++DI
Sbjct:  250 ISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNG----KNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGT-PKRE-STAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMA--SSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLI---------------AAQKMITLEENV--AIGEEVGRVYAIDEDSGPNGIIKYSMEGSED---FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDI 574          

HSP 6 Score: 75.0998 bits (183), Expect = 2.596e-13
Identity = 109/469 (23.24%), Postives = 201/469 (42.86%), Query Frame = 1
Query:  217 ISEDVPLSTQMI-LRNLS----EKINYRFQKQ----LSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKD 1566
            ISE++P  +Q+I L+ +     +KI YR ++      S   +    +IL     +  +    DH       ++ + ++  D   L+G   V + + DVN + P F        + E    +G  +   KA D D   ++  + Y +D+  +      ++   S  I V    LD E    +++ + A +  +    T   I + + +IND  P+F    Y  ++ E++P+ +  +QV A+D D       D  +   S+  S Q F +  + G + +   LD E  ++ ++ + A D      +A +++ +T+ DVND AP F        I E  P    +G I   D D E  N  +S    R      A +F    D++   G   + TR  FD E   +     +      A+   L+ST+ + + ++D+NDN P  +  V  ++  +N  +  ++  + A D D
Sbjct:  590 ISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ----DH-------KVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEH-SPIGYPVITLKAEDHD-RGDNARIVYSIDSSQF-----FRIDPSSGDISV-SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDAD-EGDNADISF---RIFGGADAKLFDIEEDAEQ-NGVVRILTRAEFDYEAKANKFFFELQ-----ASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD 1028          

HSP 7 Score: 69.3218 bits (168), Expect = 1.577e-11
Identity = 44/179 (24.58%), Postives = 87/179 (48.60%), Query Frame = 1
Query: 1936 NHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + ++N F L T++G ++ AK  DRE  D++ L++   ++    +S + TV +++LDV DN P  IF               +K+S   ++      G  +L   A DLD GEN    + +   N  ++ +I+ + G+++    L +E +    + +I  D G P +  +  + + + D+
Sbjct:  207 SRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSP--IF---------------EKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDV 368          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 181.415 bits (459), Expect = 5.555e-46
Identity = 179/596 (30.03%), Postives = 288/596 (48.32%), Query Frame = 1
Query:  415 VVNVWDGL--SLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDAD----IYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFS---VSSKGQIF-----LKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY----GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIG-PKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL----TINGSLQ--SAKEFDRET-TDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRL 2124
            V+   DG   +L   + + INV D+ND+ PT + +  + +++E +  +G+ +    AID D S  +  + Y ++      I  D+ ++K T          K LD E    Y+L + A +    +  T  +I + + +IND  P F +++Y V++ E +P  S II ++AVD DED +ITYR  +   + FS   +  +G I      LKR  D +      +++ A+D        VV   +D  + AP FN +P   +I E  P    +  IT+   D +  +        R +Y+         +DS  F+       D+      DRE+       V        A  PL ++  I + + DINDN+P F  + Y+ +I E+ PV    ++V+A D DIG NG+V Y + N  S +P   LF +D  SG +  + KLDRE+ +   L I A+D+GT P    +S  I +T+ DVNDN+P F      L I EN   G+ VG ++A D DEGDN  + F++    +   F +      NG ++  +  EFD E   +++  +++ +      LS T  V I++ DVNDN P L
Sbjct:   89 VIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENV-AIGEEVGRVYAIDED-SGPNGIIKYSMEGSEDFIIDEDSGLIKTT----------KLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ-DHKVR----VEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPV--ITLKAEDHDRGD------NARIVYS---------IDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDH---ASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFL-NESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGT-PSLSAAS-EITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQAS---SGQLSSTVPVRIHVSDVNDNKPAL 641          

HSP 2 Score: 135.576 bits (340), Expect = 8.553e-32
Identity = 173/651 (26.57%), Postives = 275/651 (42.24%), Query Frame = 1
Query:  460 VEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTND-SFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLS----ITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDED-SEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAA-KNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKP-GTEVGILIATDNDEGDNGKLLFKLLPNHNE---NFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYE-SP-GFEILKCEASDLDEGENAAFHFRISLPNDPDIFSID---PQIGILRV 2352
            VEI V DVNDN P F + S   ++ E I  +   +   KA D D          K+   + S + +  +T D S   + L++ +D +     N  I A     D  +  LS    +TI V++IND  P     +  +++EEN+ I   + +V A+DED   + I   S + S  +      G I   + LD ETT+ + + V A D      N +T + + + D+ND AP F+       I E  P    I  +   D D +                 Q + ++     +  +   D+  +            +   +  +  A  +  L     +++ I D+N + P F    +SV I E++P+   VI + A D D G N  + Y ID+          F ID  SG ++ +  LDRE  + + +I+ A D  + P    +S  I + + D+NDNSP+F           + P GT    + A D D G NG + + L  + +      F L   +G+L+ + + DRE      L I   D+G   LS    + + + DVNDN P                     E ++ DL I E SP G  +    A D DEG+NA   FRI    D  +F I+    Q G++R+
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENIT-IPAVIATVKATDEDFGTNG-----KVHYSMASSSGIGGLTIDYSTGEVTLRERIDAK-----NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDED-----------------QKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS-------SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLN--TSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF-------------------EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRI 595          

HSP 3 Score: 124.02 bits (310), Expect = 3.067e-28
Identity = 144/578 (24.91%), Postives = 257/578 (44.46%), Query Frame = 1
Query:  790 ITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFSSQYFSVS---SKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYD---LYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLF-VID-SDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAF-HFRISLPNDPDI--FSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I VV++ND  P F    Y V++ EN+ I ++I  V+A DED   + ++ Y  A  SS    ++   S G++ L+  +D + + +  + ++A D      ++   + I V+D+ND AP          +EE       +G++   D DS   NG +        Y+ +         S+ F    D   + T    DRE T     KV            L ++ TI++ + DINDN P F+K  Y+V+I E  P  +++I + A D D   +  +TY I+       ++ +F ++D  D G + +     + ++   ++ I A D+G +  +      +    ID  +++P F   P  ++I E+   G  V  L A D+D GDN ++++ +    +  FF +   +G +  + + DRE    + + +  +D    PL+ +  + + + D+NDN P+     Y               +I+ D+ +    G   L+  A D D G N    +F     + P I  F +D   G LRV  KL +E      + I   D G PS   + +I + + D+
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS-SSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDS-GPNGIIK-------YSMEG--------SEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDM---GTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIE-----EADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGR-----CVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI---DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSY-------------AATISEDIPV----GTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDV 526          

HSP 4 Score: 102.449 bits (254), Expect = 1.236e-21
Identity = 120/457 (26.26%), Postives = 204/457 (44.64%), Query Frame = 1
Query:  307 FVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL-DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNE---FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDS 1656
            F++D ++ ++KT  L+D E        T     L +        SL     + + ++D+NDN PTF       ++ E +   G  +   KA+D D   E   +TY++ +AD   + F +    D   IL +   L  +  K+  + I A +      +  +++ I  VN     P F    + V + E+ PI   +I ++A D D  +++ I Y S D SSQ+F +  S G I +   LD E  +   + V ASD+     N +T++ + + D+ND +PQF  +     I E  P      Q++  D D    NG +  +   +  +    +F+    S T      L    + DRE+    V  +            L++   I+LT++D+NDN P FE+  Y + I EN+PV + V  + A D D G N  +++ I        +  LF I+ D+
Sbjct:  165 FIIDEDSGLIKTTKLLDRE--------TTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEM-PRGSQIITLKAVDND---EDQKITYRIEEAD--REVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGGLQGRCVVNVFIDDVN---SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVY-SID-SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADI-GPNGIVDYFLNESSSSPSIQLFRLDRTSGT------LRVSSKLDREQFAVIVLPIFARDR---GTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFG----GADAKLFDIEEDA 587          

HSP 5 Score: 74.3294 bits (181), Expect = 4.254e-13
Identity = 108/469 (23.03%), Postives = 199/469 (42.43%), Query Frame = 1
Query:  217 ISEDVPLSTQMIL-----RNLSEKINYRFQKQ----LSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKD 1566
            ISE++P  +Q+I       +  +KI YR ++      S   +    +IL     +  +    DH       ++ + ++  D   L+G   V + + DVN + P F        + E    +G  +   KA D D   ++  + Y +D+  +      ++   S  I V    LD E    +++ + A +  +    T   I + + +IND  P+F    Y  ++ E++P+ +  +QV A+D D       D  +   S+  S Q F +  + G + +   LD E  ++ ++ + A D      +A +++ +T+ DVND AP F        I E  P    +G I   D D E  N  +S    R      A +F    D++   G   + TR  FD E   +     +      A+   L+ST+ + + ++D+NDN P  +  V  ++  +N  +  ++  + A D D
Sbjct:  231 ISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ----DH-------KVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEH-SPIGYPVITLKAEDHD-RGDNARIVYSIDSSQF-----FRIDPSSGDISV-SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDAD-EGDNADIS---FRIFGGADAKLFDIEEDAEQ-NGVVRILTRAEFDYEAKANKFFFELQ-----ASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD 669          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 136.346 bits (342), Expect = 5.063e-32
Identity = 192/711 (27.00%), Postives = 308/711 (43.32%), Query Frame = 1
Query:  466 INVQDVNDNVPTFLTSSILKSVKEVIY-------GVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDT---FML-KVTNDSFPILVLKKALDYERCKLYNLAIWAWNS-----PADNQKTKLSITIRVV--NINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYR--SADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVI---KVTATDKD--IGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLII--VAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKP-GTEVGILIATDNDE--GDNGKLLFKLLPNHNENFFYLTIN--------GSLQSAKEFDRETT---DRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDI-FSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + V+DVND VP F       ++ E +          GK +   KAID D     N V Y++  +   +    F + ++T + FP     +  D E+  +Y L + A +      P  N   K ++ +++V  ++ND  P F++QKY   V+E+      +I ++A D D+ S + Y    A      F V +  G IF+K PLDFE +  + + + ASD   NA T V I + DVND APQF        + E   E++ I ++      ++A   + S    R +Y  +            + G  +L   +  DR+          +V       N L     + + + DINDN+PIF + ++    E   P+ +  +    V A D D     N  + Y I   + +N E S+F ID ++G + A   LDRE  S  + II   A D+G   ++  ++    I + D+NDN+P F   +     E   P G  V    A D DE   DN   +F    +   ++FY+T +        G L+  +  D E     D + L I ++D      +  H   + ++D ND+ P +     H            +E +          G  I +  A+D D G+ A   FRI+  +DP   F+ID Q G LRV   L +E I  YN+ I   DN   + +  Q + V +QD+
Sbjct: 1199 VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFP----NEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIE---EDVDIPKVLFNVHATDADQDEKSS---RIVYRLEGQGADEVFRIGKYSGTIELVKAL--DRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGE-SVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANV--TIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDN---VFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVH---VALVDRNDHAPHIHGATEHRV----------REDV--------PRGTSIGRYTATDRDAGDTA--RFRINRQSDPKRQFTID-QDGTLRVAHTLDREDIAVYNLIIEAYDNS--NNIGRQMVAVYLQDV 1865          

HSP 2 Score: 122.479 bits (306), Expect = 1.081e-27
Identity = 153/581 (26.33%), Postives = 251/581 (43.20%), Query Frame = 1
Query:  454 IRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSV-EENLPINSMIIQVEAVDEDED---SEITYR-SADFSSQYFSVSS-KGQIFLKRPLDFE----TTSLHLIDVQASDNEFNA---NTKVVITVVDVNDEAPQFNLNPS--FCRIEEGQ----PENIIIGQITIWDRDSEAA-NGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKD-IGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMP-----KQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPP 2118
            ++V+I + DVNDN P+F     +  VKE   G G  +   KA D D   +H+ + Y L            V  DS  I V K+ LD+E    Y+L + A +          ++ I + ++ND  P+F+QQKY  +V EE++ I  ++  V A D D+D   S I YR     + + F +    G I L + LD +      S + + VQA D++ N       V + V D+ND +P F   P   F  IEE +     + +    +   D D     N  +     RN       +F+   ++   +    L   +  +RE         +   D G       + +TI +T  D+NDN P FEK  Y  S+EE  P+ A V+  +A D D   ++ + TY+      ++ E   F + +D     +++ + R K+      +  +D   +       +  +   +++ ++D ND++P   G  +  + E+   GT +G   ATD D GD  +       +     F +  +G+L+ A   DRE    Y L IE  D           V + + DVNDN P
Sbjct: 1319 VKVQIVINDVNDNAPSFEEQKYIGRVKES-EGEGHDVITIKAHDLD---KHSNLRYHL-IGAGGGRIPFGVRTDSGTIFV-KEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFV-VQAIDDDGNGLVGYADVQVNVRDINDNSPIF---PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSERE-----FIIEVRANDRGVPSREGFANVTIKVT--DMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQ------LSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQ-FTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGR--QMVAVYLQDVNDNGP 1870          

HSP 3 Score: 106.686 bits (265), Expect = 5.986e-23
Identity = 183/755 (24.24%), Postives = 325/755 (43.05%), Query Frame = 1
Query:  430 DGLSLKGIIRVEINVQDVNDNVPTFLTSSI-LKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWN-SPADNQKTKLS-ITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVD----EDEDSE--ITYR----SADFSSQYFSVS-SKGQIFLKRPLDFETTSL---HLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNP--LTSTMTISLTIADINDNTPIF-EKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEK-SLFVIDSDSGWVTATLKLD----REKESFYQLIIVAKDKGTM----PKQQTSSCXXXXXXXXXXXXSPKFIGPKK-------LEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTIN---GSLQSAKE--FDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISL--------PNDPDIFSI----DPQIGILR-VKRKLKKELIGDYNVQIIVEDNGKPSKMHSQ-KILVRIQDILRLEERSKRQKSEHWTKS 2523
            +GL       + I+V D+ D  P+F+ S + + +V  +   +G+ +    A D     + N V YK    I + +F++    D    +V      YER   Y ++  A + SP+DN  ++LS + I  +  ++  P+F +Q+YEV+V E+  ++  ++ V+A      ED  S+  ITY     + +  +++F +  S G I L R LDF+  +L   H + V A ++   ++  + I + DVND  P F       ++ E  P N  I ++T  D+D+   N +++                  +D+  F      ++  +VR D ++  +                P  L+S+  I +   + ND + +F   + Y+  + E+      VI++ A D D      VTY   +    + +K +LF ID  +G V     +      E E+   L ++ +D G+      K  TS  T+ I I DVN+N P+F    K       +E      P T V +  ATD+D   NG +++ L    +E+     I+   G L  +    FDRET  R  + ++  D+G  PL       + ++D+NDN P+   P Y                    +S +E+ G  ++   A D D   NA   + + +         ND D F +      +I +++ +  K +K     +   +I +DNG P  + S  ++ + + D        K+QK+  W  S
Sbjct:  399 NGLQSTRTQTIRIHVADI-DEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSN-VLYKTIDVIPAGSFIV----DPKSGVVRTGWSKYERGDTYRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDT-GDNSRITY----------------SVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDE---VTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVE-ATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYE-----------------TSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQK-----FIFNVIADDNGIPEALQSSAQVTLNVLD--------KQQKAPKWQTS 1096          

HSP 4 Score: 98.2117 bits (243), Expect = 2.776e-20
Identity = 93/339 (27.43%), Postives = 166/339 (48.97%), Query Frame = 1
Query:  265 SEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWD-GLSLKGIIRVEINVQDVNDNVPTFLTS--SILKSVKEVIYGVGKS-MELQKAIDRDVSKEHNTVTYKLDAD-IYSDTFMLKVTNDSFPILVLKKALDYERC--KLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSE---ITYRSADFSSQYFSV--------SSKGQIFLKRPLDFETTS----LHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDS 1215
            S +I YR + Q +    D    I K    I+L +      P G     ++V  + D G  L G   V++NV+D+NDN P F       ++  +E I+  G   M++Q     D + E+  + Y +  + + +   + ++  ++  I  ++ +LD E    + + + + A +    +++   ++TI+V ++ND  P F++ +YE SVEE  PI + ++   A D DE+++    TY+ ++  S YF V        SS G + +K+PLD+E  +     HL  ++ SD   +A   V + +VD ND AP  +   +  R+ E  P    IG+ T  DRD+
Sbjct: 1470 SSRIVYRLEGQGA----DEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMR-SLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSE-ESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHL-GIRVSDGRHDAEAAVHVALVDRNDHAPHIH-GATEHRVREDVPRGTSIGRYTATDRDA 1800          

HSP 5 Score: 95.9005 bits (237), Expect = 1.306e-19
Identity = 151/623 (24.24%), Postives = 260/623 (41.73%), Query Frame = 1
Query:  688 LVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSM--------IIQVEAVDEDEDS---EITYR----SADFSSQYFSVSS-KGQIFLKRPLDFETTSLHLIDVQASDNEFNA----------NTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSE---------AANGKLSCWEPRNLYNKQAVIF-KPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVS-IEENNPVDAKVIKVTATDKDIG-RNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESF---YQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKL--EIFENEKPGTEVGILI----ATDNDE--GDNGKLLFKLLPN---HNENFFYLTIN-GSLQSAKEFDRETTD--RYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLD-EGENAAFHFRISLPND-----PDIFSIDPQIGILRVKRKLKKE 2373
            +V+ + LDYE+   Y L + A +  +    TK +  + V ++ND+ P+F    +  +++E +  N          I+ V+A+D D D    E+ YR    +    +++F +    G+IF     D E   ++++ V+ASD   +A          N KV I + DVND AP F       R++E + E   +  I   D D           A  G++    P  +      IF K PLD    +   D Y  V                     A+     +T  + + I D+NDN P FE+  Y+ + IEE+  +   +  V ATD D   ++  + Y ++   +      +F I   SG +     LDR+  +    +  ++ A D             + + + D+NDNSP F  P++L   I EN +P    G+      A D D+   +N  + + ++ N   + E+ F +  N G + + +  DRE +    + +++  ND+G         V I + D+NDN P         + T  + S  +   I          G  ++   A D D E ++  F +++S  +D      D  S    +G+LRVK+ L  E
Sbjct: 1164 VVIMEGLDYEQVNNYTLTLTATDMTSRVASTK-TFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRI----PFGVRTDSGTIFVKEPLD----FEASDQYHLVLI-------------------ASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGA----DEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDG--NGLVGYADVQVNVRDINDNSPIF--PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFF-------EKTRYEGSVEETAPI----------GAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYE 1733          

HSP 6 Score: 84.3445 bits (207), Expect = 4.209e-16
Identity = 119/478 (24.90%), Postives = 196/478 (41.00%), Query Frame = 1
Query:  403 QLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYE---RCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINS---MIIQVEAVDED----EDSEITY-----RSADFSSQYFSVSSKGQIFLKRPLDFETTSLH--LIDVQASDNEFNAN---TKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLS---CWEPRNLY------NKQAVI----FKPPLDSK--TFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKD 1731
            Q +LV+   DG        V I+++DVNDN P F       +V E    + K +    A D D  ++ + + Y+L+     + F +   + +  ++   KALD +       +N  + A +   +       + + V +IND  P F ++ +    E   PI+S     + V+A D D    E++ I Y     +  +  S +    + G+IF  R LD E +S    +I+V+A+D    +      V I V D+ND AP F        +EE  P    +   + +D D EA +   +     E    Y      +KQ+ +     K PLD +  T    + L  RV   R +                      +   + + + D ND+ P    A     + E+ P    + + TATD+D G      + I+  R  +P++  F ID D G +     LDRE  + Y LII A D
Sbjct: 1404 QYHLVLIASDGRH-NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELV---KALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD----------------------AEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTSIGRYTATDRDAGDT--ARFRIN--RQSDPKRQ-FTIDQD-GTLRVAHTLDREDIAVYNLIIEAYD 1848          

HSP 7 Score: 75.0998 bits (183), Expect = 3.201e-13
Identity = 180/778 (23.14%), Postives = 311/778 (39.97%), Query Frame = 1
Query:  289 QKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWA--WNSPADNQKTKLSITIRVVNINDMEPKF-KQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ------YFSVSSK-GQIFLKRPLDFETTSLHLIDVQASDNEFNANTKV--------------------VITVVDVNDEAPQFNLNPSF---CRIEEG----QPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKP-PLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTY--EIDNLRSMNPEKSL---FVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVG--------ILIATDNDEGD--NGKLLFKLL----PNHNENFFYLTINGSLQSAKEF---------DRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLD-EGENAAFHFRI---SLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVED 2412
            + +  +F +D +T I+    L+D ++          + +L+ +       + +  + + I + DVNDNVPTF        V+E I  + +++    A+D+D + +++ +TY +D    +  F +    +    + L      ER  +Y   + A     P     + + I IR  N ND    F    +Y   V E+    + +IQ++A D D D E+TY   D + +       FS+    G + L+         +   D+  ++N  N    V                    +I + DVN+  P+F     +    +I EG     P  I+  ++   D DS +ANG +      +LY  Q+   K   +D +T  G       V FDRE T       +   D G    PL      S+ + DINDN+P FE+  Y  S+     V   VI V A D D   N  +TY  EID       +  L    +++  SG +T    +  + + F    ++A D G +P+   SS  + + ++D    +PK+      +   + KPG  V         IL       GD  N  +++KL     P +     +   N   ++  E+         D E  + Y L +   D   + ++ T T  + + DVND  P+     +          T+ +E +T +  + ++ G  I+  +A D D +G     H+RI   +   +   F ID   G +    K  +E I  Y + +   D
Sbjct:  579 EDETKWFRIDPSTGIIHLTRLLDFDDPA--------LPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDI-PLNQTILKVTAVDKD-TGDNSRITYSVD----NHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAM-IHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRD-EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRH-------GVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIV--KVEATDDDS-SANGDIV----YSLYYTQSESRKAFVIDRQT--GVLTPSPHVVFDRE-TRPREDVTVKATDRG--DRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFI-FNVIADDNG-IPEALQSSAQVTLNVLDKQQKAPKW------QTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFN-KFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLF--------TGTIDEE-MTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASD 1302          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 136.346 bits (342), Expect = 5.063e-32
Identity = 192/711 (27.00%), Postives = 308/711 (43.32%), Query Frame = 1
Query:  466 INVQDVNDNVPTFLTSSILKSVKEVIY-------GVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDT---FML-KVTNDSFPILVLKKALDYERCKLYNLAIWAWNS-----PADNQKTKLSITIRVV--NINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYR--SADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVI---KVTATDKD--IGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLII--VAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKP-GTEVGILIATDNDE--GDNGKLLFKLLPNHNENFFYLTIN--------GSLQSAKEFDRETT---DRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDI-FSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + V+DVND VP F       ++ E +          GK +   KAID D     N V Y++  +   +    F + ++T + FP     +  D E+  +Y L + A +      P  N   K ++ +++V  ++ND  P F++QKY   V+E+      +I ++A D D+ S + Y    A      F V +  G IF+K PLDFE +  + + + ASD   NA T V I + DVND APQF        + E   E++ I ++      ++A   + S    R +Y  +            + G  +L   +  DR+          +V       N L     + + + DINDN+PIF + ++    E   P+ +  +    V A D D     N  + Y I   + +N E S+F ID ++G + A   LDRE  S  + II   A D+G   ++  ++    I + D+NDN+P F   +     E   P G  V    A D DE   DN   +F    +   ++FY+T +        G L+  +  D E     D + L I ++D      +  H   + ++D ND+ P +     H            +E +          G  I +  A+D D G+ A   FRI+  +DP   F+ID Q G LRV   L +E I  YN+ I   DN   + +  Q + V +QD+
Sbjct: 1199 VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFP----NEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIE---EDVDIPKVLFNVHATDADQDEKSS---RIVYRLEGQGADEVFRIGKYSGTIELVKAL--DRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGE-SVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANV--TIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDN---VFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVH---VALVDRNDHAPHIHGATEHRV----------REDV--------PRGTSIGRYTATDRDAGDTA--RFRINRQSDPKRQFTID-QDGTLRVAHTLDREDIAVYNLIIEAYDNS--NNIGRQMVAVYLQDV 1865          

HSP 2 Score: 122.479 bits (306), Expect = 1.081e-27
Identity = 153/581 (26.33%), Postives = 251/581 (43.20%), Query Frame = 1
Query:  454 IRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSV-EENLPINSMIIQVEAVDEDED---SEITYR-SADFSSQYFSVSS-KGQIFLKRPLDFE----TTSLHLIDVQASDNEFNA---NTKVVITVVDVNDEAPQFNLNPS--FCRIEEGQ----PENIIIGQITIWDRDSEAA-NGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKD-IGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMP-----KQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPP 2118
            ++V+I + DVNDN P+F     +  VKE   G G  +   KA D D   +H+ + Y L            V  DS  I V K+ LD+E    Y+L + A +          ++ I + ++ND  P+F+QQKY  +V EE++ I  ++  V A D D+D   S I YR     + + F +    G I L + LD +      S + + VQA D++ N       V + V D+ND +P F   P   F  IEE +     + +    +   D D     N  +     RN       +F+   ++   +    L   +  +RE         +   D G       + +TI +T  D+NDN P FEK  Y  S+EE  P+ A V+  +A D D   ++ + TY+      ++ E   F + +D     +++ + R K+      +  +D   +       +  +   +++ ++D ND++P   G  +  + E+   GT +G   ATD D GD  +       +     F +  +G+L+ A   DRE    Y L IE  D           V + + DVNDN P
Sbjct: 1319 VKVQIVINDVNDNAPSFEEQKYIGRVKES-EGEGHDVITIKAHDLD---KHSNLRYHL-IGAGGGRIPFGVRTDSGTIFV-KEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFV-VQAIDDDGNGLVGYADVQVNVRDINDNSPIF---PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSERE-----FIIEVRANDRGVPSREGFANVTIKVT--DMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQ------LSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQ-FTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGR--QMVAVYLQDVNDNGP 1870          

HSP 3 Score: 106.686 bits (265), Expect = 5.986e-23
Identity = 183/755 (24.24%), Postives = 325/755 (43.05%), Query Frame = 1
Query:  430 DGLSLKGIIRVEINVQDVNDNVPTFLTSSI-LKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWN-SPADNQKTKLS-ITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVD----EDEDSE--ITYR----SADFSSQYFSVS-SKGQIFLKRPLDFETTSL---HLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNP--LTSTMTISLTIADINDNTPIF-EKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEK-SLFVIDSDSGWVTATLKLD----REKESFYQLIIVAKDKGTM----PKQQTSSCXXXXXXXXXXXXSPKFIGPKK-------LEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTIN---GSLQSAKE--FDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISL--------PNDPDIFSI----DPQIGILR-VKRKLKKELIGDYNVQIIVEDNGKPSKMHSQ-KILVRIQDILRLEERSKRQKSEHWTKS 2523
            +GL       + I+V D+ D  P+F+ S + + +V  +   +G+ +    A D     + N V YK    I + +F++    D    +V      YER   Y ++  A + SP+DN  ++LS + I  +  ++  P+F +Q+YEV+V E+  ++  ++ V+A      ED  S+  ITY     + +  +++F +  S G I L R LDF+  +L   H + V A ++   ++  + I + DVND  P F       ++ E  P N  I ++T  D+D+   N +++                  +D+  F      ++  +VR D ++  +                P  L+S+  I +   + ND + +F   + Y+  + E+      VI++ A D D      VTY   +    + +K +LF ID  +G V     +      E E+   L ++ +D G+      K  TS  T+ I I DVN+N P+F    K       +E      P T V +  ATD+D   NG +++ L    +E+     I+   G L  +    FDRET  R  + ++  D+G  PL       + ++D+NDN P+   P Y                    +S +E+ G  ++   A D D   NA   + + +         ND D F +      +I +++ +  K +K     +   +I +DNG P  + S  ++ + + D        K+QK+  W  S
Sbjct:  399 NGLQSTRTQTIRIHVADI-DEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSN-VLYKTIDVIPAGSFIV----DPKSGVVRTGWSKYERGDTYRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDT-GDNSRITY----------------SVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDE---VTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVE-ATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYE-----------------TSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQK-----FIFNVIADDNGIPEALQSSAQVTLNVLD--------KQQKAPKWQTS 1096          

HSP 4 Score: 98.2117 bits (243), Expect = 2.776e-20
Identity = 93/339 (27.43%), Postives = 166/339 (48.97%), Query Frame = 1
Query:  265 SEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWD-GLSLKGIIRVEINVQDVNDNVPTFLTS--SILKSVKEVIYGVGKS-MELQKAIDRDVSKEHNTVTYKLDAD-IYSDTFMLKVTNDSFPILVLKKALDYERC--KLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSE---ITYRSADFSSQYFSV--------SSKGQIFLKRPLDFETTS----LHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDS 1215
            S +I YR + Q +    D    I K    I+L +      P G     ++V  + D G  L G   V++NV+D+NDN P F       ++  +E I+  G   M++Q     D + E+  + Y +  + + +   + ++  ++  I  ++ +LD E    + + + + A +    +++   ++TI+V ++ND  P F++ +YE SVEE  PI + ++   A D DE+++    TY+ ++  S YF V        SS G + +K+PLD+E  +     HL  ++ SD   +A   V + +VD ND AP  +   +  R+ E  P    IG+ T  DRD+
Sbjct: 1470 SSRIVYRLEGQGA----DEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMR-SLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSE-ESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHL-GIRVSDGRHDAEAAVHVALVDRNDHAPHIH-GATEHRVREDVPRGTSIGRYTATDRDA 1800          

HSP 5 Score: 95.9005 bits (237), Expect = 1.306e-19
Identity = 151/623 (24.24%), Postives = 260/623 (41.73%), Query Frame = 1
Query:  688 LVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSM--------IIQVEAVDEDEDS---EITYR----SADFSSQYFSVSS-KGQIFLKRPLDFETTSLHLIDVQASDNEFNA----------NTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSE---------AANGKLSCWEPRNLYNKQAVIF-KPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVS-IEENNPVDAKVIKVTATDKDIG-RNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESF---YQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKL--EIFENEKPGTEVGILI----ATDNDE--GDNGKLLFKLLPN---HNENFFYLTIN-GSLQSAKEFDRETTD--RYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLD-EGENAAFHFRISLPND-----PDIFSIDPQIGILRVKRKLKKE 2373
            +V+ + LDYE+   Y L + A +  +    TK +  + V ++ND+ P+F    +  +++E +  N          I+ V+A+D D D    E+ YR    +    +++F +    G+IF     D E   ++++ V+ASD   +A          N KV I + DVND AP F       R++E + E   +  I   D D           A  G++    P  +      IF K PLD    +   D Y  V                     A+     +T  + + I D+NDN P FE+  Y+ + IEE+  +   +  V ATD D   ++  + Y ++   +      +F I   SG +     LDR+  +    +  ++ A D             + + + D+NDNSP F  P++L   I EN +P    G+      A D D+   +N  + + ++ N   + E+ F +  N G + + +  DRE +    + +++  ND+G         V I + D+NDN P         + T  + S  +   I          G  ++   A D D E ++  F +++S  +D      D  S    +G+LRVK+ L  E
Sbjct: 1164 VVIMEGLDYEQVNNYTLTLTATDMTSRVASTK-TFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRI----PFGVRTDSGTIFVKEPLD----FEASDQYHLVLI-------------------ASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGA----DEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDG--NGLVGYADVQVNVRDINDNSPIF--PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFF-------EKTRYEGSVEETAPI----------GAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYE 1733          

HSP 6 Score: 84.3445 bits (207), Expect = 4.209e-16
Identity = 119/478 (24.90%), Postives = 196/478 (41.00%), Query Frame = 1
Query:  403 QLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYE---RCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINS---MIIQVEAVDED----EDSEITY-----RSADFSSQYFSVSSKGQIFLKRPLDFETTSLH--LIDVQASDNEFNAN---TKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLS---CWEPRNLY------NKQAVI----FKPPLDSK--TFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKD 1731
            Q +LV+   DG        V I+++DVNDN P F       +V E    + K +    A D D  ++ + + Y+L+     + F +   + +  ++   KALD +       +N  + A +   +       + + V +IND  P F ++ +    E   PI+S     + V+A D D    E++ I Y     +  +  S +    + G+IF  R LD E +S    +I+V+A+D    +      V I V D+ND AP F        +EE  P    +   + +D D EA +   +     E    Y      +KQ+ +     K PLD +  T    + L  RV   R +                      +   + + + D ND+ P    A     + E+ P    + + TATD+D G      + I+  R  +P++  F ID D G +     LDRE  + Y LII A D
Sbjct: 1404 QYHLVLIASDGRH-NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELV---KALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD----------------------AEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTSIGRYTATDRDAGDT--ARFRIN--RQSDPKRQ-FTIDQD-GTLRVAHTLDREDIAVYNLIIEAYD 1848          

HSP 7 Score: 75.0998 bits (183), Expect = 3.201e-13
Identity = 180/778 (23.14%), Postives = 311/778 (39.97%), Query Frame = 1
Query:  289 QKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWA--WNSPADNQKTKLSITIRVVNINDMEPKF-KQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ------YFSVSSK-GQIFLKRPLDFETTSLHLIDVQASDNEFNANTKV--------------------VITVVDVNDEAPQFNLNPSF---CRIEEG----QPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKP-PLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTY--EIDNLRSMNPEKSL---FVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVG--------ILIATDNDEGD--NGKLLFKLL----PNHNENFFYLTINGSLQSAKEF---------DRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLD-EGENAAFHFRI---SLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVED 2412
            + +  +F +D +T I+    L+D ++          + +L+ +       + +  + + I + DVNDNVPTF        V+E I  + +++    A+D+D + +++ +TY +D    +  F +    +    + L      ER  +Y   + A     P     + + I IR  N ND    F    +Y   V E+    + +IQ++A D D D E+TY   D + +       FS+    G + L+         +   D+  ++N  N    V                    +I + DVN+  P+F     +    +I EG     P  I+  ++   D DS +ANG +      +LY  Q+   K   +D +T  G       V FDRE T       +   D G    PL      S+ + DINDN+P FE+  Y  S+     V   VI V A D D   N  +TY  EID       +  L    +++  SG +T    +  + + F    ++A D G +P+   SS  + + ++D    +PK+      +   + KPG  V         IL       GD  N  +++KL     P +     +   N   ++  E+         D E  + Y L +   D   + ++ T T  + + DVND  P+     +          T+ +E +T +  + ++ G  I+  +A D D +G     H+RI   +   +   F ID   G +    K  +E I  Y + +   D
Sbjct:  579 EDETKWFRIDPSTGIIHLTRLLDFDDPA--------LPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDI-PLNQTILKVTAVDKD-TGDNSRITYSVD----NHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAM-IHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRD-EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRH-------GVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIV--KVEATDDDS-SANGDIV----YSLYYTQSESRKAFVIDRQT--GVLTPSPHVVFDRE-TRPREDVTVKATDRG--DRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFI-FNVIADDNG-IPEALQSSAQVTLNVLDKQQKAPKW------QTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFN-KFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLF--------TGTIDEE-MTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASD 1302          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 129.413 bits (324), Expect = 7.746e-30
Identity = 163/603 (27.03%), Postives = 274/603 (45.44%), Query Frame = 1
Query:  688 LVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDS--EITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLI----DVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDS-KTFYGKY---DLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESP-GFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRI 2460
            + ++K  D+E+ K Y   + A N  A+++ +   I+IR+ ++ND  P F   +Y ++V E       ++ V A D D  +  E++Y     SS +      G++F ++PL       HL+    D     +E +AN  + ITV+D + + PQF+ +    R  E     I IG +         +  K S +     +N     F    D+ K +  +Y   D++  V  + + T+   +               ++   + + I D NDN P F  ++  +SI E+  +      V A+DKD  +NG V Y I    S +P  S+  ID  +G ++    LD E    Y+L + A D G  P+  +S+ T+ I ++DVNDN+P+F      +E+ EN  P T VG ++A D D  +NG++++++  N +E F      G++ + +  DRE      + I   D+G  P S T +  I++LDVNDNPP  +                   SIT  +    SP    I    A D D+G N +  +R  L +   +F +    G + ++R+L         + +IV D G P K     + VRI
Sbjct:  595 VCIQKTFDFEKQKSYQTTVIATN--ANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPL--ARGRFHLVVSAKDGGGQSSENSAN--IHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV------GAMSKVKYSIYSGDQDHN-----FSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGE---------------SNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSI---ISSHPGSSI-EIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPR--SSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRIT-NGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCL-------------------SITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQS--SLFVVKSN-GDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRI 1136          

HSP 2 Score: 122.479 bits (306), Expect = 8.716e-28
Identity = 166/645 (25.74%), Postives = 280/645 (43.41%), Query Frame = 1
Query:  214 KISEDVPLST---QMILRNL----SEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSME----LQKAIDRDVSKEHNTVTYKLDADIYSDTFMLK-VTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYR--SADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNAN-TKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDS---KTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINI 2094
            +I ED P+ T   +++  N     S++I Y  Q Q  +  +D+ +  +  +   D E+                 V   +  S      + I ++DVNDN P F  +    +V+E     G   E    +  A D D S     V+Y + ++  S +F +  VT + F     +K L   R   ++L + A +    + +   +I I V++ +   P+F + KYE+   E++     I  V A+     S++ Y   S D    +      G+I++ R LD +     L+++QA+     +N T+VVI + D ND  PQF+ +     I E    +     +   D+D +  NG++          + ++I   P  S     F G+  L T    D E T +   +V           P +S MT+ + + D+NDN P FEK+ Y++ + EN+P    V KV A DKD   NG + Y I N          F ID   G V     +DRE  S   + IVA+DKG  P+  T+S  I++  ++ N  S   I P  + +       T +G ++A D D+G NG +L++       + F +  NG +   ++ +        L + ++DQG    S+   V + I
Sbjct:  548 EIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEK----------QKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVRE-----GPKPEEPLLVVSASDMD-SGTFGEVSYHILSE--SSSFSINPVTGEVFA----QKPLARGR---FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAM-----SKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKK-KNGEV----------RYSIISSHPGSSIEIDQFTGQ--LSTGSLLDYEATRNYKLRVKATDL---GIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITN------GSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITP--IVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYR--AQLQSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRI 1136          

HSP 3 Score: 102.449 bits (254), Expect = 1.328e-21
Identity = 168/691 (24.31%), Postives = 285/691 (41.24%), Query Frame = 1
Query:  454 IRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSK--EHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY---RSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNL----NPSFCRIEEGQPENIIIGQITIWD--RDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRY-CLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFE--ILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            I + + V D NDN P+F    +   + E    +G S  L    D D  K   H  V  + + +        KV       LV+   LD E    Y L I A +     +  +L  +I +++ ND  P F + +Y  SV  N+ I S +I V+A D D  E+S I+Y   +++  S+  F++S  G I     L     S H + V ASD+     +++  V ITV+     +P  ++      +   + E      I+ +++I    RD++      S   P+     QA +             Y L      DR ET  +     ++  DG         +TI     DINDN P +  +   +S+   N        +TA D D+G+NG + Y +        +  L  ID ++G +     +D    S  +  + A+D G+     ++   +   ++D     P+F     ++EI E+   GT + + +  +N +  N K +   L N +E+    T++G++   K FD E    Y    I  N   +T  S+   + I + DVNDN P     +YH                   L++ E P  E  +L   ASD+D G      + I   ++   FSI+P  G +  ++ L +   G +++ +  +D G  S  +S  I + + D
Sbjct:  106 IDILVEVDDENDNAPSFADQVVKLEISEFAQ-LGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASL--LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQ--TDQAHV-------------YLLLLCGILDR-ETASEHHLKFLLEKDGQIIIEHPQLLTI----GDINDNAPQWHSSQIHISL---NRTQGGSRTLTAKDPDLGQNGWIRYSV-------LDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGS--PALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCL-VKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSL---ISIRLKDVNDNWPIFYPNEYH-------------------LTVREGPKPEEPLLVVSASDMDSGTFGEVSYHIL--SESSSFSINPVTGEVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVID 733          

HSP 4 Score: 98.2117 bits (243), Expect = 2.228e-20
Identity = 170/757 (22.46%), Postives = 302/757 (39.89%), Query Frame = 1
Query:  244 QMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSS-----ILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEP-KFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFS-SQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQ--ITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPP--LDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAK-VIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKEL--IGDYNVQIIVE--DNGKPSKMHSQKILVRIQ 2463
            +++   ++E+  +RFQ     F ++S T  +    L    E   +H          L++ + DG S      V + V D NDN P    S+     I +S +     VG  +   +A D D+  ++   +++L  D      ++  T D    LVL++    +  K+  L +     P    +  L I+ R        P +F +Q Y  +++E LP    I +++     E + +TY   + +    FSV S+G I     LD E    + + V  + +     T+V + V ++ND  P F ++    R+    PEN+ +G    T+  +D       +    P   +       + P   +   F G   L   + F+                  A      +   +++ ++DINDN P F K +Y  ++        +   K+ A D D    G +TY +    S     S+F +  +SG +   +K+       Y + + A D G +P   TS     I       + P F   + + E+ EN K G ++G L   ++ E       +++        F +   G L  A   DRE    +  Q+EI+++  T   +     + +LD NDN P      Y   Y  + +S                 G +I +  ASD D GEN    +RI   ND +I +++P  G +++      +L    +   QI+VE  D+G P++    K+ V ++
Sbjct: 1652 RILATGMTEESRFRFQGNAPKFSINSTTGSISVLPLD--REASQEHL---------LIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSR-----VGDVLHRFRASDMDIG-QNGKFSFELLEDSSGSLDLVPETGD----LVLRRLSSLQSWKI-KLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQP----ELAGLTYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQQIGTRVDVRVNNLNDNVPSFPMSKPR-RV----PENLRVGSYVATVGAKD-------VDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFE--------VLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQGSS-----SIFRVAPESGAL--FMKVLPPAGERYLVTVTATDNG-VPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESRE-----FHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAY---YLSLKDSMAH--------------GQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLK 2330          

HSP 5 Score: 93.9745 bits (232), Expect = 5.325e-19
Identity = 164/696 (23.56%), Postives = 281/696 (40.37%), Query Frame = 1
Query:  457 RVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRD---------VSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVE-ENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFSVSSK-GQIFLK-RPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEG--QPENIIIG-QITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTF----YGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEI-----DNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNV---QIIVEDNGKPSKMHSQKILVRI 2460
            RV++ V ++NDNVP+F  S   + V E +  VG  +    A D D         VS          + D ++ T  L               LD+E    + L I A +   D   T  ++TI V +IND  P F +  Y+ +V            ++EA D D    +TY     SS  F V+ + G +F+K  P   E    +L+ V A+DN   + +  V   V + +  P     P F + E      EN  IG QI           G LS  E R  + +     + P  SK F    +G+  L+     DRE+      +V I  +   ++        I L   D NDN P+F    Y +S++++     K+ ++ A+D+D G NG V+Y I      N+ ++NP+     ++    W  A  +LD    + +Q+++ A+D G   +       +++ +   + ++P F+ P  ++ + E+   GT +  + A++     N  LL+  L  H          G L      D E+     + + ++D       +   + +  +D           ++ P +T        K S T+ + I    G  + + +A D D G +    + IS  +      I+   GI+R    L+K L+   N+   QI V     P+K     + + I
Sbjct: 1912 RVDVRVNNLNDNVPSFPMSK-PRRVPENLR-VGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTA------------PLDFEVLPEHTLTIKATDGSFD---TFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGER---YLVTVTATDNGVPSFSTSVPVSVIIGEAEP--TDKPGFEKAEFRFEVMENSKIGLQI-----------GNLSGEESREFHYR----IQDPEASKIFSIDKFGR--LFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVL---DENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNE---WNDA--QLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYS-LKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAVVPLKIVVEPVD-----------EFAPVFT--------KSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSIS--DRQSTVKIEEHTGIIR----LQKPLVSRRNLTIEQITVVAYSSPTKQSKTTVYLEI 2534          

HSP 6 Score: 83.9593 bits (206), Expect = 6.166e-16
Identity = 89/369 (24.12%), Postives = 154/369 (41.73%), Query Frame = 1
Query: 1432 MTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPK----FIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLF--KLLPNHNE--NFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDILRLEERSKRQKSEHW 2514
            +  S+ I D NDN P+F ++ Y+ S+  N  + + +I V ATD DIG N  ++Y+I   ++  P  S F I S SG +T T  L     S + +I+VA D G+ P   +S+      +     + P      +      + EN   G+ V  +           +L+    L P   +  + + L + G L      DRET   + L+  +   G+  + I H   + I D+NDN P+     +H     I  +  Q  S T+                A D D G+N    + +    D ++ SID + G + V   +   +  +   ++  ED G P+     ++   + D+L  E +  + +   W
Sbjct:  217 LRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIK--KTSAPSNSNFAI-SQSGVITTTASL--LPASTHDVIVVASDHGS-PSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGIL------DRETASEHHLKFLLEKDGQ--IIIEHPQLLTIGDINDNAPQ-----WHSSQIHISLNRTQGGSRTL---------------TAKDPDLGQNGWIRYSVL---DTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQV---VADLLDTESKPPQFEKALW 545          

HSP 7 Score: 81.6481 bits (200), Expect = 2.639e-15
Identity = 132/551 (23.96%), Postives = 229/551 (41.56%), Query Frame = 1
Query:  301 SYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNS--PADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSAD-FSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVV----ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKL 1929
            ++F +D  T  +     +D E L P+H          L +   DG S      + I V D+NDN PTF       +V    +  G+     +A D D       +TY L     S  F +   + +  + VL  A   ER   Y + + A ++  P+ +    +S+ I      D +P F++ ++   V EN  I    +Q+  +  +E  E  YR  D  +S+ FS+   G++F+  P+D E  + H   V+  DNE   + KV     + V+D ND  P F     +  +++       IGQI   D+DS   NG++S    R L      I    L+  T   + + +   + D E      + ++   D G         + +SL ++  + + P F   VY V + E+  V   + K+ A+++   RN  + Y      S+   +    ID  +G +T    LD E E    + +   D       +++   + I +  V++ +P F      L+I  +   G  VG + A D D G +G + + +
Sbjct: 1973 THFNIDQFTGTIHLTAPLDFEVL-PEHT---------LTIKATDG-SFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA---RGALTYSLGQG-SSSIFRVAPESGALFMKVLPPA--GER---YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTD-KPGFEKAEFRFEVMENSKIG---LQIGNLSGEESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEI-DNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDS-GENGRVSY---RILSGNDLNIVT--LNPDTGSIQLNEWNDAQLD-EFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLY------SLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDG----NGRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSI 2481          

HSP 8 Score: 79.337 bits (194), Expect = 1.384e-14
Identity = 133/568 (23.42%), Postives = 240/568 (42.25%), Query Frame = 1
Query:  796 IRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFSVSSK-GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQ--ITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLP-NHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITH--TVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + + +IND  P++   +  +S+       S  +  +  D  ++  I Y   D  ++  S+  + G+IF+   +D    S     V+A D      + + +VV  ++D   + PQF    +  ++E   PE+  IG   + +   +S+  N K   +  +N      V         T  G   +     F+++++                 N  TST  IS+ + D+NDN PIF    Y +++ E    +  ++ V+A+D D G  G V+Y I +      E S F I+  +G V A   L R +   + L++ AKD G    +  +S  I+IT+ID +  +P+F   K ++   E+  PG  +G +       G   K+ + +   + + NF      G +   +  D +  D   L I    Q   P   ++   V I I D NDNPP+              +S++ + SI  DL ++E P + +   +ASD D+ +N    + I   +      ID   G L     L  E   +Y +++   D G P +  +  + + + D+
Sbjct:  429 LTIGDINDNAPQWHSSQIHISLNRTQG-GSRTLTAKDPDLGQNGWIRYSVLD--TELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFE--KALWQVE--IPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTV--------DTMSGTVCIQKTFDFEKQKSYQTTVI-------ATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILS------ESSSFSINPVTGEVFAQKPLARGR---FHLVVSAKDGGGQSSE--NSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-------GAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNI----QATLPSGESNQTQVVIFIEDHNDNPPQF-------------SSSLVEISIREDLKLHE-PFYVV---QASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDV 935          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 204.142 bits (518), Expect = 6.576e-53
Identity = 198/707 (28.01%), Postives = 335/707 (47.38%), Query Frame = 1
Query:  433 GLSLKGIIRVEINVQDVNDNVPTFLTS----SILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCK-LYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ---YFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNE--FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQ----ITIWDRDSEAANGKLSCWEPRNLYNKQA-VIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSL--------FVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPD---IFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            GLS   +I++++   DVNDN P F       S+ +S K         +    A D D       V+Y++ A   ++  + ++   +  I V++  +   R + ++ L I A +           + + +++     P F++ +Y   V+E++P  +++  V A   D       R + +S     YFS+ ++ G I + +PLD E  S  L+++QA+  E     +T+V I V DVND AP+F    S  RI    PE+  +G         D+DS  ++G+++     +L  +    +F   +D+++ +    L      D E +      V      G   + L++ +TI + + D+NDN P+FEK  YSV++ E+  ++A++I+V A+D D G N  +TY I +    N   S+        F I  +SGW+     LDRE    YQL ++A D GT      +     + ++D NDN PKF   K +  I EN + G+ VG++ A+D D G+N  + + LLP  N +F    + G + + +  DRE  + Y L +E  DQG    S    V I++ DVNDN P +  P         D  +V++E         + PG E+++  A D D G+NA+  + I    D D   +FSIDP  G++R +  L  E    Y + +   D G P +   + + V + D+
Sbjct:  694 GLSTTAMIKMQLT--DVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGN-FGQVSYRIVAG--NEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEA--SMVRIS--VPESAELGAPLYAAHAHDKDS-GSSGQVTY----SLVKESGKGLFA--IDARSGH----LILSQHLDYESSQRHTLIVTATD--GGVPS-LSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRV--IVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPI-NSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQE-------DVVSVREE---------QPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDL 1358          

HSP 2 Score: 178.718 bits (452), Expect = 5.174e-45
Identity = 208/796 (26.13%), Postives = 338/796 (42.46%), Query Frame = 1
Query:  172 YAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLS---LKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFS-------------SQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRD-SEAANGKLSCWEPRNLYNKQAVIF----KPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTST-MTISLTIADINDNTP-IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKL-EIFENEKPGTEVG----------ILIATDNDEGDNGKLLFKLLPNHNE----NFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKT--PLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESP--GFEILKCEASDLDEGENAAFHFRI---------SLPNDPDIFSIDPQIGILRVKRKLKKELIGDY 2388
            Y +KE+ P  T +G +   +  S  +  R+      Y       YF +++N+  ++    +D E             +  +++N+   L    + G  +V I V+DVNDN P F  S +  SV E    +G  +    A D+D S     VTY L  +     F +   +     L+L + LDYE  + + L + A +    +  T L+I + V ++ND  P F++ +Y V+V E+  IN+ IIQV A D D   ++ ITYR  D               SQ+F +  + G I+L+ PLD ET   + + V A+DN     +A T+V++ V+D ND  P+F  +    RIEE      ++G +T  D D  E A  + S     + +    V      + PLD +     YDL    R                        P+ S  + + + ++D+NDN P I +     VS+ E  P   +V++V A D+D G+N  +TY I   R  +    LF ID  SG +   + LD E+ S Y+L + A D G  P++      + +  ++ N   P F     +  + E+   G  VG          ++  +  +  ++ ++ + L P   +     F     +G+L  A+  DRE    + L+I   D   +  P S   TV I + DVNDN P            W  +         IDL + E+   G  I    A+D D G N    +R+         S      +F +D   G L ++  L  E + +Y
Sbjct:  834 YYVKEDIPRGTVVGSV---IAASGDVAHRSPVRYSIYSGDPD-GYFSIETNSGNIRIAKPLDHE------------AKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAE-LGAPLYAAHAHDKD-SGSSGQVTYSLVKESGKGLFAIDARSGH---LILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLD-RELRELYDLVVEAR--------------------DQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSD-GHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNR--PTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPE-----------WPQDP--------IDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEY 1565          

HSP 3 Score: 159.073 bits (401), Expect = 6.506e-39
Identity = 190/677 (28.06%), Postives = 290/677 (42.84%), Query Frame = 1
Query:  454 IRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAI--DRDVSKE-HNTVTYKLDADIYSDTFMLKVTNDSFPILVL----KKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDS------EITYRSADFSSQYFSVSSK-GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNL----NPSFCRIEEGQPENIIIGQITIWDRDSE-----------AANGKLSCWEPRN-LYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSL--FVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLT------INGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKR 2358
            IRV + V+D NDN PTF  +S+     E         E+++ +   RD+  E +NT  Y + +   +D F L    +   +L L       LD E    Y+L I A +      +  +++ I + ++ND +P F Q +Y  +V EN  + + ++QV A D D D        I  R +D   Q F +  + G I++ + LDFET  LH + V A D+          V I V DVND  P  N+    + +  +I E       + +I++ D DS+             +G  +     N +Y    VI   PLD +     Y L + V  D+                     PL ++ +I L I D+NDN P FE+ +Y  ++ E       V++V A D+D G N  +TY +    +  PE     F ID  +G +T    +D E E   QL +VA+D G  P   T++    +TI DVNDN P F      + + ENE  G  +  + A+D D G N  + + +     E F +LT       +G +  A E D E    Y   +   D+G   LS T  + + + DVNDN P     +Y         ++ Q  S              I+   A+D D G      +RI   N+  IF ID   G + V R
Sbjct:  158 IRVLVTVKDENDNAPTFPQTSMHIEFPE-----NTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSD-KEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIY---LVIVHLPLD-REIVSNYTL-SVVATDK------------------GTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSL----AETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATV--LVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI----GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASST------------PIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVR 781          

HSP 4 Score: 150.599 bits (379), Expect = 2.850e-36
Identity = 180/718 (25.07%), Postives = 322/718 (44.85%), Query Frame = 1
Query:  412 LVVNVWDGLS--LKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPK----FKQQKYEVSVEENLPINSMIIQVEAVDEDEDSE-----ITYRSADFSSQYFSVSSKGQ----IFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEI-DNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKP-------GTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKE--FDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPD-IFSIDPQIGILRVKRKLKKELIGD--YNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            L++   DG +  L+G + V I +QDVNDN P F  S    +V E    VG S+    A D D + E+  V Y ++        M ++   +  I +  KALD+E  +L+ L + A +      +T   ++IRV ++ND +P     F        + E+      + ++   D D  +E     +T    D    +F+++++      + +  PLD E  S + + V A+D      +A+  + + + DVND  P+F  +     + E       + Q+   DRD E  N  L+ +         A  F+  +D +T      + TR   D  ET    +  ++  D G    PL+ST T+ +TI D+NDN PIF+++ Y+VS+ EN PV   ++KV+A+D D G N +V Y I +  + +    + F + S SG +    +LD E+ S Y+  ++A D+G +    +++  I + + DVNDN P F  P++ ++   E P        T +  ++ATD D G+ G++ ++++  +    F +    G +   +       T   + L I   D G    +    V ++I+D    PP  IF     +Y +     + + ++             +    A+  D    +   + I    DPD  FSI+   G +R+ + L  E       N+Q  +   G+P      ++ + ++D+
Sbjct:  254 LLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENAT-VGTSVLQVYASDTD-ADENGLVEYAINRRQSDKEQMFRIDPRTGAIYI-NKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGD---GHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRD-EGLNSALT-YSLAETPETHAQWFQ--IDPQTGL----ITTRSHIDC-ETEPVPQLTVVARDGGVP--PLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHL----TEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGL----STTAMIKMQLTDVNDNRPVFY-PREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPP--IF--EKARYNYYVKEDIPRGTV-------------VGSVIAASGDVAHRSPVRYSI-YSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATL---GEPPVYGHTQVNIEVEDV 924          

HSP 5 Score: 149.058 bits (375), Expect = 9.015e-36
Identity = 182/756 (24.07%), Postives = 312/756 (41.27%), Query Frame = 1
Query:  274 INYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPT----FLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSA---DFSSQYFSVSSK-GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAK-----VIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSG--WVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKP-GTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTIN-GSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESP--GFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            IN R   +   F +D  T  +     +D E        T E+ +L +V        L+    V I V DVNDN PT    FL+      + E     G+ +      D D   E+  V   L+       F L   ++S  ++++   LD E    Y L++ A +          SI +R+ ++ND  P+F+Q  Y  +V E     + ++QV A D DE  +S +TY  A   +  +Q+F +  + G I  +  +D ET  +  + V A D      ++   V++T+ DVND  P F+ +     + E +P    I +++  D D    N  +      N    +        + ++  G+  +   + F+R  + +              +  L++T  I + + D+NDN P+F    Y VS+ E+    ++     ++ V ATD D G  G V+Y I        E  +F ID  +G  +V     L    +  + L I A D G +  +  +   + ++IID     P F   +     + + P GT VG +IA   D      + + +     + +F +  N G+++ AK  D E   +  L I+    G+ P+     V I + DVNDN P                     E+  + +S+ ES   G  +    A D D G +    + +   +   +F+ID + G L + + L  E    + + +   D G PS   +  ILV +QD+
Sbjct:  325 INRRQSDKEQMFRIDPRTGAIYINKALDFE--------TKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQ-PGEFVARISVHDPDSKTEYANVNVTLNGG--DGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDC-GVNAMV------NYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATD-------RGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI----VAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNL--RSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEF-------------------EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDV 1029          

HSP 6 Score: 148.673 bits (374), Expect = 1.194e-35
Identity = 199/762 (26.12%), Postives = 325/762 (42.65%), Query Frame = 1
Query:  394 EMGQLY-LVVNVWD-GLSLKGI-IRVEINVQDVNDNVPTFL-TSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------------EDSEITYR----SADFSSQYFSVS-SKGQIFLKRPLDFETTS-----LHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPR-----NLYNKQAV-IFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIF------EKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKL-----DREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI-GPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTIN-GSLQSAKEFDRETTDRYCLQIEINDQGK-TPLSIT----------------------HTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYES--PGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKP-SKMHSQKILVRIQD 2466
            E+ +LY LVV   D G  ++   + V I+V DVNDN P        + SV+E     G  +   +A+DRD   ++ ++TY +     SD   L   + +  ++  +  LD+E   +Y L + A +     ++T   + + V+++ND  P F        V E+  +  ++  +  ++              ED  +TY     + D     F +    G + + R LD E  S     +  +D  AS+N  ++   V I V DVND AP++  +P   ++ E  P   II   T  D D+   NG L     R     N   +QA+ +F+  +DS T  G   L   + F  E   + +  V  +         L +++T+ L I D ND+ P F           S+ I +   +   V  + A D+D G NG +TYEI         +  F I+S +G +     L     D EK   + LII AKD G  P+ + SS  +++ +   ++N P+F+    +  I EN   G+ V  + A      +N  L +++      + F++    G + +  +FDRE+   Y L + + D  + + LS +                       T+ I + DVNDN      P++ P   +              LS+ E+  PG  I    ASDLDEG NA   + I+  N  + FSID   G L   R L +E    Y +QI   D G+P S+     I + ++D
Sbjct: 1217 ELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREE-QPPGTEVVRVRAVDRD-HGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADT-GTNGDLQYRLIRYFPQLNESQEQAMSLFR--MDSLT--GALSLQAPLDF--EAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNG----EGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHG-QPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNS-----PEFRPGSCY-------------GLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSA-RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVED 1944          

HSP 7 Score: 139.428 bits (350), Expect = 7.108e-33
Identity = 176/697 (25.25%), Postives = 302/697 (43.33%), Query Frame = 1
Query:  466 INVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSAD---FSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVV-ITVVDVNDEAPQFNLNPSFCRIEEG-----QPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKT---FYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTI-NGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRI------------SLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            + + DVNDN P F       +V EV    G S+    A DRD    ++ +TY L    + ++  F +        ++  +  +D E   +  L + A +       +  ++ + + ++ND EP F Q  Y VSV EN P+   I++V A D D   ++ + Y   +     +++   S+ G+I +   LDFE  S +   V A+D    + T ++ + + DVND  P F        + E      Q  +  I  +   D D     G       R +   +A IF+  +D  T   F  + D+ + VR     T       I   D G  ++   +   + L+I D     PIFEKA Y+  ++E+ P    V  V A   D+     V Y I    S +P+   F I+++SG +     LD E +S   L I A   G  P    +   I +  ++ N  +P+F     ++ + E+ + G  +    A D D G +G++ + L+    +  F +   +G L  ++  D E++ R+ L +   D G   LS   T+ +++ DVNDNPP  +F               +K+  ++++S   S   +I++  ASDLD G NA   +RI            S  +    F I P  G + ++  L +E    Y + ++  DNG P+     +++VR+ D
Sbjct:  492 LRITDVNDNPPEFEQDLYHANVMEVA-DPGTSVLQVLAHDRD-EGLNSALTYSLAETPETHAQWFQIDPQTG---LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDY----GNFGQVSYRIVAGNEAGIFR--IDRSTGEIFVVRPDMLS-VR-----TQPMHMLNISATDGGNLRS--NADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI---YSGDPD-GYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDN--APEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPP--VF---------------EKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLD 1145          

HSP 8 Score: 128.642 bits (322), Expect = 1.697e-29
Identity = 188/715 (26.29%), Postives = 298/715 (41.68%), Query Frame = 1
Query:  454 IRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSK----EHNTVTYKLDADIYSDTFMLKVTNDSFP-ILVLKKALDYERCKLYNLAIWAWNSPA---DNQKTKLSITIRVVNINDMEPKF------KQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYR-SADFSSQYFSVSSK-GQIFLKRPL-----DFETTSLHLIDVQASDN----EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXX-------XXXXXXXXXXXGAAKNPLTS-------------TMTISLTIADINDNTPIFE-KAVYSVSIEENNPVDAKVIK-VTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKP-GTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGS---LQSAKEFDRETTDRYCLQIEINDQGKTPL-SITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDP--DIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSK 2430
            I V+I V DVNDN P +    I   V E    VG  +    A D D       ++  + Y    +   +  M     DS    L L+  LD+E  + Y L + A +  +   +  +T +++ +R+++ ND  P F        +   + + +   I  ++  + AVDED  ++ ++TY  +       F ++S+ G I L + L     D E      + + A D+       ++  + + V   ++  P+F        I E  P    + Q+T       A N  LS   P  + N    +F         + +  + TR +FDRE                       A +   +S               TI +T+ D+NDN+P F   + Y +S+ EN+  +  VI  V A+D D G N  + Y I      N     F IDS SG ++A   LDRE+ S Y L I A D+G  PK +   C I I + D NDN+P+F   K     + + P GT V  + A D D G N +L++ L    NE  +   I+G    + +  + DRE    Y   +   D G+  + S T  V IN+LD+NDN P  IF     +Y +I             +     PG  +LK +A D D G NA   + ++  N      F I+P  G L   + L  E     +++++  D G P +
Sbjct: 1469 ITVKIEVADVNDNAPEWPQDPIDLQVSEAT-PVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHG-AENANLSYEIPAGVAND---LFH------VDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENS--EPGVIHTVVASDLDEGPNADLIYSITGGNLGNK----FSIDSSSGELSAR-PLDREQHSRYTLQIQASDRG-QPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA---NETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP--IF----ERYPYIGQ-----------VPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQ 2144          

HSP 9 Score: 97.4413 bits (241), Expect = 5.729e-20
Identity = 165/705 (23.40%), Postives = 297/705 (42.13%), Query Frame = 1
Query:  442 LKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNT---VTYKLDADIYSDTFMLKVTNDSFPI------LVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEV---------SVEENLPINSMIIQVEAVDEDED---SEITY-----------------RSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIII---GQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEK-AVYSVSIEENNPVDAKVIKVTATDKDIGR--NGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKES-FYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXS---PKFIGPKKLEIF-ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNEN-----FFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNV 2394
            + G   + + + DVNDN PTF  ++++         V ++ EL   I    + + +T   +TY+L A+   D   + +    F +      LVLK+ LDYE  + Y L + A ++     + +  +T+RV + ND  P F  Q+             + E+L ++  ++ V A D D +   S++ Y                  S + S    +VSS G  F++           +I   A      ++T + +   D      QF  N    +I E  P   ++   GQ  +    +  A  + S +E   L   +A++   PLD +    + DLY ++R                     +    +S +++ +TI D NDN PIF++ A Y   I E  P+   + ++ A D D     N  V Y+I    +   ++ +F ID  +G +    +LD +  +  Y+LII A D       Q   C++    ++++D +   PKF   + +    ENE  G+ V    A+D D+G  G+L + + P  ++      F   + +G + SA  FD E   RY +++  +D G    S+   V I   D           ++ P++T      V   ++ +        G+ + +  A+D D G +    +++S P+    F ++   G + +KRKLK +  GD N+
Sbjct: 2408 MTGTATIRVQIVDVNDNQPTFPPNNLVT--------VSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSI----FALDRYSGKLVLKRRLDYELQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVR-----------IIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFE---LLQSKAIVLVKPLDRE----RNDLY-KLRL---------VLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDI----TSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDS----HHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRD-----------EFTPQFTERTYRFVLPAAVAL------PQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH--FKVNRSSGAVLIKRKLKLDGDGDGNL 3042          

HSP 10 Score: 96.6709 bits (239), Expect = 1.099e-19
Identity = 154/560 (27.50%), Postives = 232/560 (41.43%), Query Frame = 1
Query:  697 KKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQY---FSVSSK----GQIFLKRP----LDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQ--ITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP----IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVI---DSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLL--PNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRIS 2295
            K  LD E    Y+L       P   +  ++ +T++  + ND  P F Q    +   EN P       + A D D +   T R    S      F +SS     G ++L       LD ETT  + + ++A D           V IT+ DVND  P FN +  F  +    PEN  +G   + ++  D++A    L  +      + +  +F+  +D +T  G   +   + F+ +E  + V            + PL +T  +S+ + D+NDN P    IF     S  I E+      V +++  D D        Y   N+ ++N     F +   D+    V   L LDRE  S Y L +VA DKGT P   + S  + IT ++ N   P+F        + E   PGT V  ++A D DEG N  L + L   P  +  +F +    G + +    D ET     L +   D G  PLS T TV + I DVNDN P  IF       ++ + S  + E +          G  ILK  ASD D G NA  ++ I 
Sbjct:  135 KVKLDRETRASYSLVAI----PLSGRNIRVLVTVK--DENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATV----PENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFR--IDPRT--GAIYINKALDFETKELHELVVVAKDH-----GEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPD----SKTEYANVNV-TLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDN--PPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEP--IF-----DQSFYNVSVAENEPV----------GRCILKVSASDPDCGVNAMVNYTIG 651          

HSP 11 Score: 96.2857 bits (238), Expect = 1.369e-19
Identity = 125/518 (24.13%), Postives = 216/518 (41.70%), Query Frame = 1
Query:  307 FVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLS---LKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLS--------------------------ITIRVVNINDMEPKFKQQK-YEVSVEENL-PINSMIIQVEAVDEDEDSEITYR-SADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN----EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRV-RFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPK 1749
            F ++S T I++      ++ L P      + G+  L++   D       K  + + + VQ  ++N P FL +    ++ E +     S  LQ         E+  ++Y++ A + +D F +        I+  +   D E    Y L ++  ++   N+++ LS                          I I V ++ND  P+F+    Y +SV EN  P     +    +DE  ++++ Y  +       FS+ S       RPLD E  S + + +QASD         +  + I V D ND AP+F L+     ++E  P    + QI+  D D    N +L      +L N+    F          G+  L T V + DRE  +      +++  DG      ++T+ + + + DINDN PIFE+  Y   +         ++KV A D D+G N  + Y ++   S    K  F I+  +G ++A+  L  E      L +VA+DKG  P+
Sbjct: 1656 FRINSQTGIIEL-----VKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENV--PSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRG---IITTRGQFDRESQASYVLPVYVRDA---NRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADL-GVNARLVY----SLANETQWQF-------AIDGQSGLITTVGKLDRE--LQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAK--FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQ 2144          

HSP 12 Score: 82.8037 bits (203), Expect = 1.458e-15
Identity = 103/361 (28.53%), Postives = 164/361 (45.43%), Query Frame = 1
Query: 1420 LTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIA--TDNDEGDNGKLLFKLLPN-----HNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQ-KESITIDLSIYESPGFEILKCEASDLD-EGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELI---GDYNVQIIVEDNGKPSKMHSQKILVRIQ 2463
            L S   + + + D NDN+P F +  +  ++ E N     V +V A D D G N  + Y I +    N + +  +  + SG V   + LDRE    Y+L I+A D+G    Q T + TI + I+DVNDN P F     + + E     TE+G +I   + ND      L ++L         N + F L   +G L   +  D E    Y L +  +D      ++   + + + D NDN P +      P Y  I  +  +  ES+++D        F++L   A+D D EG N+   + I    +   FS+ P  G++ V     +  +   GDY V+II +D GKP+   S   L+R+Q
Sbjct: 2302 LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVD---GNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGV--PQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSE----ATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTV---LTVRVNDENDNAP-VFLAQQPPAYFAILPAISEISESLSVD--------FDLLTVNATDADSEGNNSKVIYIIEPAQEG--FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSS--TLLRVQ 2637          

HSP 13 Score: 82.0333 bits (201), Expect = 2.612e-15
Identity = 159/733 (21.69%), Postives = 285/733 (38.88%), Query Frame = 1
Query:  403 QLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQK--AIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSS------QYFSVSS-KGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAP---------QFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKL-----SCWEPRNLYNKQAVI------FKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVT--ATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXS----PKFIGPKK--LEIFENEKPGTEVGILIATDNDEGD--NGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDR-YCLQIEIND-QGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRIS-LPNDPD---IFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQ 2463
            ++ LV    D   L     + I ++D NDN P F     + +V E   G  K   + +  A D D         + +D + + + F+++       I+     LD E   +Y L I A +          +I +++V++ND +P F      V+V E   + ++I  + A D D    +TYR    S+        F++    G++ LKR LD+E    + +DV ASD    A T + + V D ND AP          F + P+   I E    +  +  +   D DSE  N K+        E  +++    V+       +P + S       D + R+                     A K  L S+  + +   D       F +  Y   I E  P+ + V+++   A D+ +            + + N E +  ++ S +  +     LDRE+   Y+L +V       P   + + +  I++I    ++    P F    K   EI E       +  L A D D+ +  N ++++ +   ++E+ F +  + G L      D ++  + Y L I   D   + PL       + + D NDN P+    +Y   +   +N  V               G  + +  ASDLD+G     ++ I   P+D     +F +D + G++        E    Y+++++  D G   K  S  + V I+
Sbjct: 2289 RVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSE---GNNKGTFVAQVHAFDSDAGSNARLRYHIVDGN-HDNAFVIEPAFSG--IVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSG-----DYFVRI-----------------IAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLA-----------IIAGNEESAFELLQSKA--IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEY--VHFLAENEPV---------------GSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG--GKKASVAVRVEIE 2960          

HSP 14 Score: 72.0182 bits (175), Expect = 3.453e-12
Identity = 109/431 (25.29%), Postives = 171/431 (39.68%), Query Frame = 1
Query:  451 IIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLD----AD-IYSDT---FMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWN-SPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFSSQYFSVSSK-GQIFLKRPLDFETTSLHLIDVQASDNE----FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEG-QPENIIIGQITIWDRDSEA-------ANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPI--FEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWV 1665
            +  + I V DVNDN P F   S         YG+      +  +       H  V   LD    AD IYS T      K + DS    +  + LD E+   Y L I A +     +++   +ITI V + ND  P+FK  KY  SV+E+ P+ + ++Q+ AVD D   ++ + Y  A+ +   F++  + G I     LD E  + +   V A+D       +A   V I V+D+ND  P F   P   ++    QP   ++ ++   D D  A        N + S    +   N             +  GK      V  D+                     P +S   I L I +    TP+  F+   Y V ++EN+P   ++++V A   D GR   V +          E  +  +DS SG +
Sbjct: 1830 VATIYITVGDVNDNSPEFRPGSC--------YGLSVPENSEPGV------IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLL-KVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDK------------------GNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSF----GAGNEDGILSLDSLSGEI 2222          

HSP 15 Score: 66.2402 bits (160), Expect = 1.871e-10
Identity = 63/229 (27.51%), Postives = 106/229 (46.29%), Query Frame = 1
Query: 1804 SPKFIGPKKLE-IFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL--TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPD-----IFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            SPKF   + +  + E    GT V  + A D+D G N +L + ++  +++N F +    +G +++    DRE  D Y L+I   D+G   ++ T T+ + I+DVNDN P   FP         +N     E+  +        G  I    A+D+D     A  +R+   +  D     IF++D   G L +KR+L  EL  +Y + +I  D    ++     + VR+ D
Sbjct: 2319 SPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQP--TFPP--------NNLVTVSEATEL--------GAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVND 2524          

HSP 16 Score: 63.1586 bits (152), Expect = 1.517e-9
Identity = 55/182 (30.22%), Postives = 83/182 (45.60%), Query Frame = 1
Query: 1930 LPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISL--PNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            L +H E    L ++  LQ +   DRETT  Y L IE  D G  PL    TV I I DVNDN P  IF       T  +N+TV               G  +L+  ASD D  EN    + I+    +   +F IDP+ G + + + L  E    + + ++ +D+G+     +  + +R+ D+
Sbjct:  224 LSSHRERDGVLYLD--LQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQP--IFNQSRYFATVPENATV---------------GTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDV 386          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 204.142 bits (518), Expect = 6.576e-53
Identity = 198/707 (28.01%), Postives = 335/707 (47.38%), Query Frame = 1
Query:  433 GLSLKGIIRVEINVQDVNDNVPTFLTS----SILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCK-LYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ---YFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNE--FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQ----ITIWDRDSEAANGKLSCWEPRNLYNKQA-VIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSL--------FVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPD---IFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            GLS   +I++++   DVNDN P F       S+ +S K         +    A D D       V+Y++ A   ++  + ++   +  I V++  +   R + ++ L I A +           + + +++     P F++ +Y   V+E++P  +++  V A   D       R + +S     YFS+ ++ G I + +PLD E  S  L+++QA+  E     +T+V I V DVND AP+F    S  RI    PE+  +G         D+DS  ++G+++     +L  +    +F   +D+++ +    L      D E +      V      G   + L++ +TI + + D+NDN P+FEK  YSV++ E+  ++A++I+V A+D D G N  +TY I +    N   S+        F I  +SGW+     LDRE    YQL ++A D GT      +     + ++D NDN PKF   K +  I EN + G+ VG++ A+D D G+N  + + LLP  N +F    + G + + +  DRE  + Y L +E  DQG    S    V I++ DVNDN P +  P         D  +V++E         + PG E+++  A D D G+NA+  + I    D D   +FSIDP  G++R +  L  E    Y + +   D G P +   + + V + D+
Sbjct:  694 GLSTTAMIKMQLT--DVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGN-FGQVSYRIVAG--NEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEA--SMVRIS--VPESAELGAPLYAAHAHDKDS-GSSGQVTY----SLVKESGKGLFA--IDARSGH----LILSQHLDYESSQRHTLIVTATD--GGVPS-LSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRV--IVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPI-NSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQE-------DVVSVREE---------QPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDL 1358          

HSP 2 Score: 178.718 bits (452), Expect = 5.174e-45
Identity = 208/796 (26.13%), Postives = 338/796 (42.46%), Query Frame = 1
Query:  172 YAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLS---LKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFS-------------SQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRD-SEAANGKLSCWEPRNLYNKQAVIF----KPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTST-MTISLTIADINDNTP-IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKL-EIFENEKPGTEVG----------ILIATDNDEGDNGKLLFKLLPNHNE----NFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKT--PLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESP--GFEILKCEASDLDEGENAAFHFRI---------SLPNDPDIFSIDPQIGILRVKRKLKKELIGDY 2388
            Y +KE+ P  T +G +   +  S  +  R+      Y       YF +++N+  ++    +D E             +  +++N+   L    + G  +V I V+DVNDN P F  S +  SV E    +G  +    A D+D S     VTY L  +     F +   +     L+L + LDYE  + + L + A +    +  T L+I + V ++ND  P F++ +Y V+V E+  IN+ IIQV A D D   ++ ITYR  D               SQ+F +  + G I+L+ PLD ET   + + V A+DN     +A T+V++ V+D ND  P+F  +    RIEE      ++G +T  D D  E A  + S     + +    V      + PLD +     YDL    R                        P+ S  + + + ++D+NDN P I +     VS+ E  P   +V++V A D+D G+N  +TY I   R  +    LF ID  SG +   + LD E+ S Y+L + A D G  P++      + +  ++ N   P F     +  + E+   G  VG          ++  +  +  ++ ++ + L P   +     F     +G+L  A+  DRE    + L+I   D   +  P S   TV I + DVNDN P            W  +         IDL + E+   G  I    A+D D G N    +R+         S      +F +D   G L ++  L  E + +Y
Sbjct:  834 YYVKEDIPRGTVVGSV---IAASGDVAHRSPVRYSIYSGDPD-GYFSIETNSGNIRIAKPLDHE------------AKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAE-LGAPLYAAHAHDKD-SGSSGQVTYSLVKESGKGLFAIDARSGH---LILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLD-RELRELYDLVVEAR--------------------DQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSD-GHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNR--PTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPE-----------WPQDP--------IDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEY 1565          

HSP 3 Score: 159.073 bits (401), Expect = 6.506e-39
Identity = 190/677 (28.06%), Postives = 290/677 (42.84%), Query Frame = 1
Query:  454 IRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAI--DRDVSKE-HNTVTYKLDADIYSDTFMLKVTNDSFPILVL----KKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDS------EITYRSADFSSQYFSVSSK-GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNL----NPSFCRIEEGQPENIIIGQITIWDRDSE-----------AANGKLSCWEPRN-LYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSL--FVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLT------INGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKR 2358
            IRV + V+D NDN PTF  +S+     E         E+++ +   RD+  E +NT  Y + +   +D F L    +   +L L       LD E    Y+L I A +      +  +++ I + ++ND +P F Q +Y  +V EN  + + ++QV A D D D        I  R +D   Q F +  + G I++ + LDFET  LH + V A D+          V I V DVND  P  N+    + +  +I E       + +I++ D DS+             +G  +     N +Y    VI   PLD +     Y L + V  D+                     PL ++ +I L I D+NDN P FE+ +Y  ++ E       V++V A D+D G N  +TY +    +  PE     F ID  +G +T    +D E E   QL +VA+D G  P   T++    +TI DVNDN P F      + + ENE  G  +  + A+D D G N  + + +     E F +LT       +G +  A E D E    Y   +   D+G   LS T  + + + DVNDN P     +Y         ++ Q  S              I+   A+D D G      +RI   N+  IF ID   G + V R
Sbjct:  158 IRVLVTVKDENDNAPTFPQTSMHIEFPE-----NTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSD-KEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIY---LVIVHLPLD-REIVSNYTL-SVVATDK------------------GTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSL----AETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATV--LVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI----GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASST------------PIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVR 781          

HSP 4 Score: 150.599 bits (379), Expect = 2.850e-36
Identity = 180/718 (25.07%), Postives = 322/718 (44.85%), Query Frame = 1
Query:  412 LVVNVWDGLS--LKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPK----FKQQKYEVSVEENLPINSMIIQVEAVDEDEDSE-----ITYRSADFSSQYFSVSSKGQ----IFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEI-DNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKP-------GTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKE--FDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPD-IFSIDPQIGILRVKRKLKKELIGD--YNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            L++   DG +  L+G + V I +QDVNDN P F  S    +V E    VG S+    A D D + E+  V Y ++        M ++   +  I +  KALD+E  +L+ L + A +      +T   ++IRV ++ND +P     F        + E+      + ++   D D  +E     +T    D    +F+++++      + +  PLD E  S + + V A+D      +A+  + + + DVND  P+F  +     + E       + Q+   DRD E  N  L+ +         A  F+  +D +T      + TR   D  ET    +  ++  D G    PL+ST T+ +TI D+NDN PIF+++ Y+VS+ EN PV   ++KV+A+D D G N +V Y I +  + +    + F + S SG +    +LD E+ S Y+  ++A D+G +    +++  I + + DVNDN P F  P++ ++   E P        T +  ++ATD D G+ G++ ++++  +    F +    G +   +       T   + L I   D G    +    V ++I+D    PP  IF     +Y +     + + ++             +    A+  D    +   + I    DPD  FSI+   G +R+ + L  E       N+Q  +   G+P      ++ + ++D+
Sbjct:  254 LLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENAT-VGTSVLQVYASDTD-ADENGLVEYAINRRQSDKEQMFRIDPRTGAIYI-NKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGD---GHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRD-EGLNSALT-YSLAETPETHAQWFQ--IDPQTGL----ITTRSHIDC-ETEPVPQLTVVARDGGVP--PLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHL----TEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGL----STTAMIKMQLTDVNDNRPVFY-PREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPP--IF--EKARYNYYVKEDIPRGTV-------------VGSVIAASGDVAHRSPVRYSI-YSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATL---GEPPVYGHTQVNIEVEDV 924          

HSP 5 Score: 149.058 bits (375), Expect = 9.015e-36
Identity = 182/756 (24.07%), Postives = 312/756 (41.27%), Query Frame = 1
Query:  274 INYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPT----FLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSA---DFSSQYFSVSSK-GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAK-----VIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSG--WVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKP-GTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTIN-GSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESP--GFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            IN R   +   F +D  T  +     +D E        T E+ +L +V        L+    V I V DVNDN PT    FL+      + E     G+ +      D D   E+  V   L+       F L   ++S  ++++   LD E    Y L++ A +          SI +R+ ++ND  P+F+Q  Y  +V E     + ++QV A D DE  +S +TY  A   +  +Q+F +  + G I  +  +D ET  +  + V A D      ++   V++T+ DVND  P F+ +     + E +P    I +++  D D    N  +      N    +        + ++  G+  +   + F+R  + +              +  L++T  I + + D+NDN P+F    Y VS+ E+    ++     ++ V ATD D G  G V+Y I        E  +F ID  +G  +V     L    +  + L I A D G +  +  +   + ++IID     P F   +     + + P GT VG +IA   D      + + +     + +F +  N G+++ AK  D E   +  L I+    G+ P+     V I + DVNDN P                     E+  + +S+ ES   G  +    A D D G +    + +   +   +F+ID + G L + + L  E    + + +   D G PS   +  ILV +QD+
Sbjct:  325 INRRQSDKEQMFRIDPRTGAIYINKALDFE--------TKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQ-PGEFVARISVHDPDSKTEYANVNVTLNGG--DGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDC-GVNAMV------NYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATD-------RGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI----VAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNL--RSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEF-------------------EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDV 1029          

HSP 6 Score: 148.673 bits (374), Expect = 1.194e-35
Identity = 199/762 (26.12%), Postives = 325/762 (42.65%), Query Frame = 1
Query:  394 EMGQLY-LVVNVWD-GLSLKGI-IRVEINVQDVNDNVPTFL-TSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------------EDSEITYR----SADFSSQYFSVS-SKGQIFLKRPLDFETTS-----LHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPR-----NLYNKQAV-IFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIF------EKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKL-----DREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI-GPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTIN-GSLQSAKEFDRETTDRYCLQIEINDQGK-TPLSIT----------------------HTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYES--PGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKP-SKMHSQKILVRIQD 2466
            E+ +LY LVV   D G  ++   + V I+V DVNDN P        + SV+E     G  +   +A+DRD   ++ ++TY +     SD   L   + +  ++  +  LD+E   +Y L + A +     ++T   + + V+++ND  P F        V E+  +  ++  +  ++              ED  +TY     + D     F +    G + + R LD E  S     +  +D  AS+N  ++   V I V DVND AP++  +P   ++ E  P   II   T  D D+   NG L     R     N   +QA+ +F+  +DS T  G   L   + F  E   + +  V  +         L +++T+ L I D ND+ P F           S+ I +   +   V  + A D+D G NG +TYEI         +  F I+S +G +     L     D EK   + LII AKD G  P+ + SS  +++ +   ++N P+F+    +  I EN   G+ V  + A      +N  L +++      + F++    G + +  +FDRE+   Y L + + D  + + LS +                       T+ I + DVNDN      P++ P   +              LS+ E+  PG  I    ASDLDEG NA   + I+  N  + FSID   G L   R L +E    Y +QI   D G+P S+     I + ++D
Sbjct: 1217 ELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREE-QPPGTEVVRVRAVDRD-HGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADT-GTNGDLQYRLIRYFPQLNESQEQAMSLFR--MDSLT--GALSLQAPLDF--EAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNG----EGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHG-QPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNS-----PEFRPGSCY-------------GLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSA-RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVED 1944          

HSP 7 Score: 139.428 bits (350), Expect = 7.108e-33
Identity = 176/697 (25.25%), Postives = 302/697 (43.33%), Query Frame = 1
Query:  466 INVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSAD---FSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVV-ITVVDVNDEAPQFNLNPSFCRIEEG-----QPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKT---FYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTI-NGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRI------------SLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            + + DVNDN P F       +V EV    G S+    A DRD    ++ +TY L    + ++  F +        ++  +  +D E   +  L + A +       +  ++ + + ++ND EP F Q  Y VSV EN P+   I++V A D D   ++ + Y   +     +++   S+ G+I +   LDFE  S +   V A+D    + T ++ + + DVND  P F        + E      Q  +  I  +   D D     G       R +   +A IF+  +D  T   F  + D+ + VR     T       I   D G  ++   +   + L+I D     PIFEKA Y+  ++E+ P    V  V A   D+     V Y I    S +P+   F I+++SG +     LD E +S   L I A   G  P    +   I +  ++ N  +P+F     ++ + E+ + G  +    A D D G +G++ + L+    +  F +   +G L  ++  D E++ R+ L +   D G   LS   T+ +++ DVNDNPP  +F               +K+  ++++S   S   +I++  ASDLD G NA   +RI            S  +    F I P  G + ++  L +E    Y + ++  DNG P+     +++VR+ D
Sbjct:  492 LRITDVNDNPPEFEQDLYHANVMEVA-DPGTSVLQVLAHDRD-EGLNSALTYSLAETPETHAQWFQIDPQTG---LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDY----GNFGQVSYRIVAGNEAGIFR--IDRSTGEIFVVRPDMLS-VR-----TQPMHMLNISATDGGNLRS--NADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI---YSGDPD-GYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDN--APEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPP--VF---------------EKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLD 1145          

HSP 8 Score: 128.642 bits (322), Expect = 1.697e-29
Identity = 188/715 (26.29%), Postives = 298/715 (41.68%), Query Frame = 1
Query:  454 IRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSK----EHNTVTYKLDADIYSDTFMLKVTNDSFP-ILVLKKALDYERCKLYNLAIWAWNSPA---DNQKTKLSITIRVVNINDMEPKF------KQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYR-SADFSSQYFSVSSK-GQIFLKRPL-----DFETTSLHLIDVQASDN----EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXX-------XXXXXXXXXXXGAAKNPLTS-------------TMTISLTIADINDNTPIFE-KAVYSVSIEENNPVDAKVIK-VTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKP-GTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGS---LQSAKEFDRETTDRYCLQIEINDQGKTPL-SITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDP--DIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSK 2430
            I V+I V DVNDN P +    I   V E    VG  +    A D D       ++  + Y    +   +  M     DS    L L+  LD+E  + Y L + A +  +   +  +T +++ +R+++ ND  P F        +   + + +   I  ++  + AVDED  ++ ++TY  +       F ++S+ G I L + L     D E      + + A D+       ++  + + V   ++  P+F        I E  P    + Q+T       A N  LS   P  + N    +F         + +  + TR +FDRE                       A +   +S               TI +T+ D+NDN+P F   + Y +S+ EN+  +  VI  V A+D D G N  + Y I      N     F IDS SG ++A   LDRE+ S Y L I A D+G  PK +   C I I + D NDN+P+F   K     + + P GT V  + A D D G N +L++ L    NE  +   I+G    + +  + DRE    Y   +   D G+  + S T  V IN+LD+NDN P  IF     +Y +I             +     PG  +LK +A D D G NA   + ++  N      F I+P  G L   + L  E     +++++  D G P +
Sbjct: 1469 ITVKIEVADVNDNAPEWPQDPIDLQVSEAT-PVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHG-AENANLSYEIPAGVAND---LFH------VDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENS--EPGVIHTVVASDLDEGPNADLIYSITGGNLGNK----FSIDSSSGELSAR-PLDREQHSRYTLQIQASDRG-QPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA---NETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP--IF----ERYPYIGQ-----------VPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQ 2144          

HSP 9 Score: 97.4413 bits (241), Expect = 5.729e-20
Identity = 165/705 (23.40%), Postives = 297/705 (42.13%), Query Frame = 1
Query:  442 LKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNT---VTYKLDADIYSDTFMLKVTNDSFPI------LVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEV---------SVEENLPINSMIIQVEAVDEDED---SEITY-----------------RSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIII---GQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEK-AVYSVSIEENNPVDAKVIKVTATDKDIGR--NGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKES-FYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXS---PKFIGPKKLEIF-ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNEN-----FFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNV 2394
            + G   + + + DVNDN PTF  ++++         V ++ EL   I    + + +T   +TY+L A+   D   + +    F +      LVLK+ LDYE  + Y L + A ++     + +  +T+RV + ND  P F  Q+             + E+L ++  ++ V A D D +   S++ Y                  S + S    +VSS G  F++           +I   A      ++T + +   D      QF  N    +I E  P   ++   GQ  +    +  A  + S +E   L   +A++   PLD +    + DLY ++R                     +    +S +++ +TI D NDN PIF++ A Y   I E  P+   + ++ A D D     N  V Y+I    +   ++ +F ID  +G +    +LD +  +  Y+LII A D       Q   C++    ++++D +   PKF   + +    ENE  G+ V    A+D D+G  G+L + + P  ++      F   + +G + SA  FD E   RY +++  +D G    S+   V I   D           ++ P++T      V   ++ +        G+ + +  A+D D G +    +++S P+    F ++   G + +KRKLK +  GD N+
Sbjct: 2408 MTGTATIRVQIVDVNDNQPTFPPNNLVT--------VSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSI----FALDRYSGKLVLKRRLDYELQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVR-----------IIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFE---LLQSKAIVLVKPLDRE----RNDLY-KLRL---------VLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDI----TSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDS----HHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRD-----------EFTPQFTERTYRFVLPAAVAL------PQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH--FKVNRSSGAVLIKRKLKLDGDGDGNL 3042          

HSP 10 Score: 96.6709 bits (239), Expect = 1.099e-19
Identity = 154/560 (27.50%), Postives = 232/560 (41.43%), Query Frame = 1
Query:  697 KKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQY---FSVSSK----GQIFLKRP----LDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQ--ITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP----IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVI---DSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLL--PNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRIS 2295
            K  LD E    Y+L       P   +  ++ +T++  + ND  P F Q    +   EN P       + A D D +   T R    S      F +SS     G ++L       LD ETT  + + ++A D           V IT+ DVND  P FN +  F  +    PEN  +G   + ++  D++A    L  +      + +  +F+  +D +T  G   +   + F+ +E  + V            + PL +T  +S+ + D+NDN P    IF     S  I E+      V +++  D D        Y   N+ ++N     F +   D+    V   L LDRE  S Y L +VA DKGT P   + S  + IT ++ N   P+F        + E   PGT V  ++A D DEG N  L + L   P  +  +F +    G + +    D ET     L +   D G  PLS T TV + I DVNDN P  IF       ++ + S  + E +          G  ILK  ASD D G NA  ++ I 
Sbjct:  135 KVKLDRETRASYSLVAI----PLSGRNIRVLVTVK--DENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATV----PENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFR--IDPRT--GAIYINKALDFETKELHELVVVAKDH-----GEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPD----SKTEYANVNV-TLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDN--PPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEP--IF-----DQSFYNVSVAENEPV----------GRCILKVSASDPDCGVNAMVNYTIG 651          

HSP 11 Score: 96.2857 bits (238), Expect = 1.369e-19
Identity = 125/518 (24.13%), Postives = 216/518 (41.70%), Query Frame = 1
Query:  307 FVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLS---LKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLS--------------------------ITIRVVNINDMEPKFKQQK-YEVSVEENL-PINSMIIQVEAVDEDEDSEITYR-SADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN----EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRV-RFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPK 1749
            F ++S T I++      ++ L P      + G+  L++   D       K  + + + VQ  ++N P FL +    ++ E +     S  LQ         E+  ++Y++ A + +D F +        I+  +   D E    Y L ++  ++   N+++ LS                          I I V ++ND  P+F+    Y +SV EN  P     +    +DE  ++++ Y  +       FS+ S       RPLD E  S + + +QASD         +  + I V D ND AP+F L+     ++E  P    + QI+  D D    N +L      +L N+    F          G+  L T V + DRE  +      +++  DG      ++T+ + + + DINDN PIFE+  Y   +         ++KV A D D+G N  + Y ++   S    K  F I+  +G ++A+  L  E      L +VA+DKG  P+
Sbjct: 1656 FRINSQTGIIEL-----VKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENV--PSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRG---IITTRGQFDRESQASYVLPVYVRDA---NRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADL-GVNARLVY----SLANETQWQF-------AIDGQSGLITTVGKLDRE--LQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAK--FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQ 2144          

HSP 12 Score: 82.8037 bits (203), Expect = 1.458e-15
Identity = 103/361 (28.53%), Postives = 164/361 (45.43%), Query Frame = 1
Query: 1420 LTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIA--TDNDEGDNGKLLFKLLPN-----HNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQ-KESITIDLSIYESPGFEILKCEASDLD-EGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELI---GDYNVQIIVEDNGKPSKMHSQKILVRIQ 2463
            L S   + + + D NDN+P F +  +  ++ E N     V +V A D D G N  + Y I +    N + +  +  + SG V   + LDRE    Y+L I+A D+G    Q T + TI + I+DVNDN P F     + + E     TE+G +I   + ND      L ++L         N + F L   +G L   +  D E    Y L +  +D      ++   + + + D NDN P +      P Y  I  +  +  ES+++D        F++L   A+D D EG N+   + I    +   FS+ P  G++ V     +  +   GDY V+II +D GKP+   S   L+R+Q
Sbjct: 2302 LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVD---GNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGV--PQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSE----ATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTV---LTVRVNDENDNAP-VFLAQQPPAYFAILPAISEISESLSVD--------FDLLTVNATDADSEGNNSKVIYIIEPAQEG--FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSS--TLLRVQ 2637          

HSP 13 Score: 82.0333 bits (201), Expect = 2.612e-15
Identity = 159/733 (21.69%), Postives = 285/733 (38.88%), Query Frame = 1
Query:  403 QLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQK--AIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSS------QYFSVSS-KGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAP---------QFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKL-----SCWEPRNLYNKQAVI------FKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVT--ATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXS----PKFIGPKK--LEIFENEKPGTEVGILIATDNDEGD--NGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDR-YCLQIEIND-QGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRIS-LPNDPD---IFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQ 2463
            ++ LV    D   L     + I ++D NDN P F     + +V E   G  K   + +  A D D         + +D + + + F+++       I+     LD E   +Y L I A +          +I +++V++ND +P F      V+V E   + ++I  + A D D    +TYR    S+        F++    G++ LKR LD+E    + +DV ASD    A T + + V D ND AP          F + P+   I E    +  +  +   D DSE  N K+        E  +++    V+       +P + S       D + R+                     A K  L S+  + +   D       F +  Y   I E  P+ + V+++   A D+ +            + + N E +  ++ S +  +     LDRE+   Y+L +V       P   + + +  I++I    ++    P F    K   EI E       +  L A D D+ +  N ++++ +   ++E+ F +  + G L      D ++  + Y L I   D   + PL       + + D NDN P+    +Y   +   +N  V               G  + +  ASDLD+G     ++ I   P+D     +F +D + G++        E    Y+++++  D G   K  S  + V I+
Sbjct: 2289 RVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSE---GNNKGTFVAQVHAFDSDAGSNARLRYHIVDGN-HDNAFVIEPAFSG--IVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSG-----DYFVRI-----------------IAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLA-----------IIAGNEESAFELLQSKA--IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEY--VHFLAENEPV---------------GSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG--GKKASVAVRVEIE 2960          

HSP 14 Score: 72.0182 bits (175), Expect = 3.453e-12
Identity = 109/431 (25.29%), Postives = 171/431 (39.68%), Query Frame = 1
Query:  451 IIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLD----AD-IYSDT---FMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWN-SPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFSSQYFSVSSK-GQIFLKRPLDFETTSLHLIDVQASDNE----FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEG-QPENIIIGQITIWDRDSEA-------ANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPI--FEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWV 1665
            +  + I V DVNDN P F   S         YG+      +  +       H  V   LD    AD IYS T      K + DS    +  + LD E+   Y L I A +     +++   +ITI V + ND  P+FK  KY  SV+E+ P+ + ++Q+ AVD D   ++ + Y  A+ +   F++  + G I     LD E  + +   V A+D       +A   V I V+D+ND  P F   P   ++    QP   ++ ++   D D  A        N + S    +   N             +  GK      V  D+                     P +S   I L I +    TP+  F+   Y V ++EN+P   ++++V A   D GR   V +          E  +  +DS SG +
Sbjct: 1830 VATIYITVGDVNDNSPEFRPGSC--------YGLSVPENSEPGV------IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLL-KVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDK------------------GNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSF----GAGNEDGILSLDSLSGEI 2222          

HSP 15 Score: 66.2402 bits (160), Expect = 1.871e-10
Identity = 63/229 (27.51%), Postives = 106/229 (46.29%), Query Frame = 1
Query: 1804 SPKFIGPKKLE-IFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL--TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPD-----IFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            SPKF   + +  + E    GT V  + A D+D G N +L + ++  +++N F +    +G +++    DRE  D Y L+I   D+G   ++ T T+ + I+DVNDN P   FP         +N     E+  +        G  I    A+D+D     A  +R+   +  D     IF++D   G L +KR+L  EL  +Y + +I  D    ++     + VR+ D
Sbjct: 2319 SPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQP--TFPP--------NNLVTVSEATEL--------GAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVND 2524          

HSP 16 Score: 63.1586 bits (152), Expect = 1.517e-9
Identity = 55/182 (30.22%), Postives = 83/182 (45.60%), Query Frame = 1
Query: 1930 LPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISL--PNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            L +H E    L ++  LQ +   DRETT  Y L IE  D G  PL    TV I I DVNDN P  IF       T  +N+TV               G  +L+  ASD D  EN    + I+    +   +F IDP+ G + + + L  E    + + ++ +D+G+     +  + +R+ D+
Sbjct:  224 LSSHRERDGVLYLD--LQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQP--IFNQSRYFATVPENATV---------------GTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDV 386          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 194.126 bits (492), Expect = 9.333e-50
Identity = 197/717 (27.48%), Postives = 320/717 (44.63%), Query Frame = 1
Query:  292 KQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIR-----VEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNT-VTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQY-FSVSSK-GQIFLKRPLDFETTSLHLIDVQASDNEF---NANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAA-NGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTY-----EIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNEN--FFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKEL 2376
            +++  F +DS + ++ T++ +D E               +L+V   D  S +   R     V++ V D NDN P F   +    V E  +G  +   +      D  + +N  + Y +        F +   +     + L K LDYE  + Y L I A +  + ++     + + V++ ND  P+F   +++ SV EN+P+   II+V+A D DE  ++EITY  ++    +  +V  + G +   +PLD E        V A D      +A++ VVITV DVND  P FN       + E QP    +  +T  D D ++  + +++    R  +          + S+   G   +   + + +E+         ++          + T T+ + I D N+  PIFE A YS S+ E+ PV   V+ V+ATD D+G N  +TY      I+ L S +P    F I+  +G +     LDRE  S Y L + AKD G      T+   + I + DVNDN+P F  P  +  I E+   GT V  + A+D D G NG++ + L     E+  F     +G++++ K  DRE+   + L     D+G  PLS T  V I + DVND+PP                 T   + IT+ +      G  + +  A D DEG NA  H+ I   +D + FS+  + G  R +     EL
Sbjct:  516 QEMPIFRIDSRSGVISTRSSLDRET----------SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD---VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRF---------AITSQNGRGLITIAQSLDYKQEK-------RFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP----FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTD--VEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPP-----------------TFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTEL 1180          

HSP 2 Score: 189.504 bits (480), Expect = 2.655e-48
Identity = 211/808 (26.11%), Postives = 366/808 (45.30%), Query Frame = 1
Query:  175 AIKENQPGQTRIGKIS----EDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLK-GIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSK----EHNTVTYKLDADIYSDTFMLKVTNDSFP-ILVLKKALDYERCKLYNLAIWAWN---SPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENL---PINSMIIQVEAVDEDEDSEITYRSA----DFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIG----QITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDS--GWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI-GPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL------TIN---GSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDI----FSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            ++ E QP    +  +     ED P+   M+       ++ R Q   S F +DS T ++ T   +D  EL   H         + VV   D    + G   +++NV D ND+ PTF       S++E    VG ++   +A D+D+ K    E+        A +  D  M     DS   ++  + +LD E    Y+L + A +   + ++ +    S+ ++V++ ND  P+F ++ Y V V E+      ++ +  + A D D+ +    R A    +  SQ+   S  G + L +PLD+E+   + + ++A D      +  T++++ V+D ND AP+F  +    + +E   EN+ +G    ++  +D D E AN +++        +++   F   +D +T +    + T    DREE      +V+          P +++ ++ +T+ D+NDN P F    Y  ++ E+ P    V  VTATD D   +  + YEI    +    +  F I S +  G +T    LD ++E  + L + A D G     ++ + T++I I D N+ +P F   P    +FE+   GT V ++ ATD+D G N ++ + L   + E+   L      +IN   G++ +    DRETT  Y L +   D G   LS T  V I + DVNDN P    P Y             + SI  D  +    G  +++  ASD D G N    + +S   D DI    F IDP  G +R  + L +E +  +++  I  D G P    + ++ +R++D+
Sbjct:  367 SVLEEQPAGAAVTTVRARDPEDSPVVYSMV-----SLLDSRSQ---SLFKVDSRTGVVTTSASLD-RELMDVH--------YFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGAT-VGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTS----QFQESVLENVPVGYNIIRVQAYDSD-EGANAEIT-----YSISERDDNFPLAVDPRTGW----VQTIKPLDREEQGRFAFQVVAKD---GGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEI----TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG----RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL---NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLY-------------QASILEDALV----GTSVIQVAASDPDVGLNGRIKYLLS---DRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDV 1106          

HSP 3 Score: 171.785 bits (434), Expect = 9.074e-43
Identity = 188/711 (26.44%), Postives = 306/711 (43.04%), Query Frame = 1
Query:  412 LVVNVWDGLS--LKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILV--------LKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYR-SADFSSQYFSVSS---KGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVV-ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRD------------SEAANGKLSCWEPRNLYNKQ--AVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNP-LTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIF--ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAK-----EFDRETT-DRYCLQIEINDQGKTPLSITHTVCINILDVNDNPP-----RLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDN 2415
            LV+   DG S       ++ +NV D NDN P F TS   +SV E +  VG ++   +A D D            +A+I   T+ +   +D+FP+ V          K LD E    +   + A +     +    S+ I V ++ND +P F  + YE +V E+ P  + +  V A D DEDS + Y  +   +   F+++S   +G I + + LD++     L+ V A+D+   ++T  V I + D N+ AP F   P    + E  P    +  ++  D D             E+ NG L   +P ++ N Q  A++   PLD +T  G   L T    D                     NP L+ T  + + + D+NDN P F+  +Y  SI E+  V   VI+V A+D D+G NG + Y + +    + E   FVID  SG +     LDRE  + + L  +A DKG+ P    SS       ++  ++SP      K+ ++  EN   G+ VG + A D DEG N  + + ++   + N F L      + A+     E D E+T  R+ L +        PL     + I + DVNDN P     ++IF ++   +                      P  EI +  A D D  +    H+RI   N+ ++  ++   G L +  +L   +     +++ V D 
Sbjct:  657 LVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENV-PVGYNIIRVQAYDSDEGA---------NAEI---TYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESING-LGSPDPFSI-NPQTGAIVTNAPLDRETTSGY--LLTVTAKD-------------------GGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD---RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP---LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVR---AASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHF----------------------PSGEIGRIPAFDADVSDK--LHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDG 1298          

HSP 4 Score: 102.064 bits (253), Expect = 2.384e-21
Identity = 97/354 (27.40%), Postives = 162/354 (45.76%), Query Frame = 1
Query: 1456 DINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLF---------KLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTP---LSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFE---ILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            ++ + +P FE+A+Y  S+ E  P  A V  V A D +   +  V Y + +L      +SLF +DS +G VT +  LDRE    +   +VA D    P+  T++  + + ++D ND+SP F   + +  I E    G+ V  L ATD D G N ++ +          L  +     F + + +G + +    DRET+D Y L +   D         + T +V + +LD NDN P+                   + + T+ +   +  G E   +    A+D D+G NAA  + I   N    FSID   G + + + L  E +  Y + I  +D G PS+ ++ ++LV + D
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPE---DSPVVYSMVSLLDSR-SQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTT--LQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF-----------------SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVID 681          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0330601)

HSP 1 Score: 194.126 bits (492), Expect = 1.013e-49
Identity = 197/717 (27.48%), Postives = 320/717 (44.63%), Query Frame = 1
Query:  292 KQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIR-----VEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNT-VTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQY-FSVSSK-GQIFLKRPLDFETTSLHLIDVQASDNEF---NANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAA-NGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTY-----EIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNEN--FFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKEL 2376
            +++  F +DS + ++ T++ +D E               +L+V   D  S +   R     V++ V D NDN P F   +    V E  +G  +   +      D  + +N  + Y +        F +   +     + L K LDYE  + Y L I A +  + ++     + + V++ ND  P+F   +++ SV EN+P+   II+V+A D DE  ++EITY  ++    +  +V  + G +   +PLD E        V A D      +A++ VVITV DVND  P FN       + E QP    +  +T  D D ++  + +++    R  +          + S+   G   +   + + +E+         ++          + T T+ + I D N+  PIFE A YS S+ E+ PV   V+ V+ATD D+G N  +TY      I+ L S +P    F I+  +G +     LDRE  S Y L + AKD G      T+   + I + DVNDN+P F  P  +  I E+   GT V  + A+D D G NG++ + L     E+  F     +G++++ K  DRE+   + L     D+G  PLS T  V I + DVND+PP                 T   + IT+ +      G  + +  A D DEG NA  H+ I   +D + FS+  + G  R +     EL
Sbjct:  516 QEMPIFRIDSRSGVISTRSSLDRET----------SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD---VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRF---------AITSQNGRGLITIAQSLDYKQEK-------RFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP----FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTD--VEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPP-----------------TFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTEL 1180          

HSP 2 Score: 189.119 bits (479), Expect = 3.008e-48
Identity = 211/808 (26.11%), Postives = 366/808 (45.30%), Query Frame = 1
Query:  175 AIKENQPGQTRIGKIS----EDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLK-GIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSK----EHNTVTYKLDADIYSDTFMLKVTNDSFP-ILVLKKALDYERCKLYNLAIWAWN---SPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENL---PINSMIIQVEAVDEDEDSEITYRSA----DFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIG----QITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDS--GWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI-GPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL------TIN---GSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDI----FSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            ++ E QP    +  +     ED P+   M+       ++ R Q   S F +DS T ++ T   +D  EL   H         + VV   D    + G   +++NV D ND+ PTF       S++E    VG ++   +A D+D+ K    E+        A +  D  M     DS   ++  + +LD E    Y+L + A +   + ++ +    S+ ++V++ ND  P+F ++ Y V V E+      ++ +  + A D D+ +    R A    +  SQ+   S  G + L +PLD+E+   + + ++A D      +  T++++ V+D ND AP+F  +    + +E   EN+ +G    ++  +D D E AN +++        +++   F   +D +T +    + T    DREE      +V+          P +++ ++ +T+ D+NDN P F    Y  ++ E+ P    V  VTATD D   +  + YEI    +    +  F I S +  G +T    LD ++E  + L + A D G     ++ + T++I I D N+ +P F   P    +FE+   GT V ++ ATD+D G N ++ + L   + E+   L      +IN   G++ +    DRETT  Y L +   D G   LS T  V I + DVNDN P    P Y             + SI  D  +    G  +++  ASD D G N    + +S   D DI    F IDP  G +R  + L +E +  +++  I  D G P    + ++ +R++D+
Sbjct:  367 SVLEEQPAGAAVTTVRARDPEDSPVVYSMV-----SLLDSRSQ---SLFKVDSRTGVVTTSASLD-RELMDVH--------YFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGAT-VGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTS----QFQESVLENVPVGYNIIRVQAYDSD-EGANAEIT-----YSISERDDNFPLAVDPRTGW----VQTIKPLDREEQGRFAFQVVAKD---GGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEI----TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG----RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL---NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLY-------------QASILEDALV----GTSVIQVAASDPDVGLNGRIKYLLS---DRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDV 1106          

HSP 3 Score: 171.4 bits (433), Expect = 9.919e-43
Identity = 188/711 (26.44%), Postives = 306/711 (43.04%), Query Frame = 1
Query:  412 LVVNVWDGLS--LKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILV--------LKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYR-SADFSSQYFSVSS---KGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVV-ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRD------------SEAANGKLSCWEPRNLYNKQ--AVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNP-LTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIF--ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAK-----EFDRETT-DRYCLQIEINDQGKTPLSITHTVCINILDVNDNPP-----RLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDN 2415
            LV+   DG S       ++ +NV D NDN P F TS   +SV E +  VG ++   +A D D            +A+I   T+ +   +D+FP+ V          K LD E    +   + A +     +    S+ I V ++ND +P F  + YE +V E+ P  + +  V A D DEDS + Y  +   +   F+++S   +G I + + LD++     L+ V A+D+   ++T  V I + D N+ AP F   P    + E  P    +  ++  D D             E+ NG L   +P ++ N Q  A++   PLD +T  G   L T    D                     NP L+ T  + + + D+NDN P F+  +Y  SI E+  V   VI+V A+D D+G NG + Y + +    + E   FVID  SG +     LDRE  + + L  +A DKG+ P    SS       ++  ++SP      K+ ++  EN   G+ VG + A D DEG N  + + ++   + N F L      + A+     E D E+T  R+ L +        PL     + I + DVNDN P     ++IF ++   +                      P  EI +  A D D  +    H+RI   N+ ++  ++   G L +  +L   +     +++ V D 
Sbjct:  657 LVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENV-PVGYNIIRVQAYDSDEGA---------NAEI---TYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESING-LGSPDPFSI-NPQTGAIVTNAPLDRETTSGY--LLTVTAKD-------------------GGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD---RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP---LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVR---AASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHF----------------------PSGEIGRIPAFDADVSDK--LHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDG 1298          

HSP 4 Score: 101.679 bits (252), Expect = 2.711e-21
Identity = 97/354 (27.40%), Postives = 162/354 (45.76%), Query Frame = 1
Query: 1456 DINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLF---------KLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTP---LSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFE---ILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            ++ + +P FE+A+Y  S+ E  P  A V  V A D +   +  V Y + +L      +SLF +DS +G VT +  LDRE    +   +VA D    P+  T++  + + ++D ND+SP F   + +  I E    G+ V  L ATD D G N ++ +          L  +     F + + +G + +    DRET+D Y L +   D         + T +V + +LD NDN P+                   + + T+ +   +  G E   +    A+D D+G NAA  + I   N    FSID   G + + + L  E +  Y + I  +D G PS+ ++ ++LV + D
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPE---DSPVVYSMVSLLDSR-SQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTT--LQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF-----------------SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVID 681          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 193.741 bits (491), Expect = 1.070e-49
Identity = 197/717 (27.48%), Postives = 320/717 (44.63%), Query Frame = 1
Query:  292 KQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIR-----VEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNT-VTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQY-FSVSSK-GQIFLKRPLDFETTSLHLIDVQASDNEF---NANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAA-NGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTY-----EIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNEN--FFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKEL 2376
            +++  F +DS + ++ T++ +D E               +L+V   D  S +   R     V++ V D NDN P F   +    V E  +G  +   +      D  + +N  + Y +        F +   +     + L K LDYE  + Y L I A +  + ++     + + V++ ND  P+F   +++ SV EN+P+   II+V+A D DE  ++EITY  ++    +  +V  + G +   +PLD E        V A D      +A++ VVITV DVND  P FN       + E QP    +  +T  D D ++  + +++    R  +          + S+   G   +   + + +E+         ++          + T T+ + I D N+  PIFE A YS S+ E+ PV   V+ V+ATD D+G N  +TY      I+ L S +P    F I+  +G +     LDRE  S Y L + AKD G      T+   + I + DVNDN+P F  P  +  I E+   GT V  + A+D D G NG++ + L     E+  F     +G++++ K  DRE+   + L     D+G  PLS T  V I + DVND+PP                 T   + IT+ +      G  + +  A D DEG NA  H+ I   +D + FS+  + G  R +     EL
Sbjct:  516 QEMPIFRIDSRSGVISTRSSLDRET----------SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD---VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRF---------AITSQNGRGLITIAQSLDYKQEK-------RFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP----FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTD--VEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPP-----------------TFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTEL 1180          

HSP 2 Score: 189.119 bits (479), Expect = 3.234e-48
Identity = 211/808 (26.11%), Postives = 366/808 (45.30%), Query Frame = 1
Query:  175 AIKENQPGQTRIGKIS----EDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLK-GIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSK----EHNTVTYKLDADIYSDTFMLKVTNDSFP-ILVLKKALDYERCKLYNLAIWAWN---SPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENL---PINSMIIQVEAVDEDEDSEITYRSA----DFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIG----QITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDS--GWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI-GPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL------TIN---GSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDI----FSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            ++ E QP    +  +     ED P+   M+       ++ R Q   S F +DS T ++ T   +D  EL   H         + VV   D    + G   +++NV D ND+ PTF       S++E    VG ++   +A D+D+ K    E+        A +  D  M     DS   ++  + +LD E    Y+L + A +   + ++ +    S+ ++V++ ND  P+F ++ Y V V E+      ++ +  + A D D+ +    R A    +  SQ+   S  G + L +PLD+E+   + + ++A D      +  T++++ V+D ND AP+F  +    + +E   EN+ +G    ++  +D D E AN +++        +++   F   +D +T +    + T    DREE      +V+          P +++ ++ +T+ D+NDN P F    Y  ++ E+ P    V  VTATD D   +  + YEI    +    +  F I S +  G +T    LD ++E  + L + A D G     ++ + T++I I D N+ +P F   P    +FE+   GT V ++ ATD+D G N ++ + L   + E+   L      +IN   G++ +    DRETT  Y L +   D G   LS T  V I + DVNDN P    P Y             + SI  D  +    G  +++  ASD D G N    + +S   D DI    F IDP  G +R  + L +E +  +++  I  D G P    + ++ +R++D+
Sbjct:  367 SVLEEQPAGAAVTTVRARDPEDSPVVYSMV-----SLLDSRSQ---SLFKVDSRTGVVTTSASLD-RELMDVH--------YFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGAT-VGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTS----QFQESVLENVPVGYNIIRVQAYDSD-EGANAEIT-----YSISERDDNFPLAVDPRTGW----VQTIKPLDREEQGRFAFQVVAKD---GGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEI----TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG----RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL---NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLY-------------QASILEDALV----GTSVIQVAASDPDVGLNGRIKYLLS---DRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDV 1106          

HSP 3 Score: 171.4 bits (433), Expect = 1.048e-42
Identity = 188/711 (26.44%), Postives = 306/711 (43.04%), Query Frame = 1
Query:  412 LVVNVWDGLS--LKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILV--------LKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYR-SADFSSQYFSVSS---KGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVV-ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRD------------SEAANGKLSCWEPRNLYNKQ--AVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNP-LTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIF--ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAK-----EFDRETT-DRYCLQIEINDQGKTPLSITHTVCINILDVNDNPP-----RLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDN 2415
            LV+   DG S       ++ +NV D NDN P F TS   +SV E +  VG ++   +A D D            +A+I   T+ +   +D+FP+ V          K LD E    +   + A +     +    S+ I V ++ND +P F  + YE +V E+ P  + +  V A D DEDS + Y  +   +   F+++S   +G I + + LD++     L+ V A+D+   ++T  V I + D N+ AP F   P    + E  P    +  ++  D D             E+ NG L   +P ++ N Q  A++   PLD +T  G   L T    D                     NP L+ T  + + + D+NDN P F+  +Y  SI E+  V   VI+V A+D D+G NG + Y + +    + E   FVID  SG +     LDRE  + + L  +A DKG+ P    SS       ++  ++SP      K+ ++  EN   G+ VG + A D DEG N  + + ++   + N F L      + A+     E D E+T  R+ L +        PL     + I + DVNDN P     ++IF ++   +                      P  EI +  A D D  +    H+RI   N+ ++  ++   G L +  +L   +     +++ V D 
Sbjct:  657 LVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENV-PVGYNIIRVQAYDSDEGA---------NAEI---TYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESING-LGSPDPFSI-NPQTGAIVTNAPLDRETTSGY--LLTVTAKD-------------------GGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD---RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP---LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVR---AASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHF----------------------PSGEIGRIPAFDADVSDK--LHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDG 1298          

HSP 4 Score: 101.679 bits (252), Expect = 2.868e-21
Identity = 97/354 (27.40%), Postives = 162/354 (45.76%), Query Frame = 1
Query: 1456 DINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLF---------KLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTP---LSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFE---ILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            ++ + +P FE+A+Y  S+ E  P  A V  V A D +   +  V Y + +L      +SLF +DS +G VT +  LDRE    +   +VA D    P+  T++  + + ++D ND+SP F   + +  I E    G+ V  L ATD D G N ++ +          L  +     F + + +G + +    DRET+D Y L +   D         + T +V + +LD NDN P+                   + + T+ +   +  G E   +    A+D D+G NAA  + I   N    FSID   G + + + L  E +  Y + I  +D G PS+ ++ ++LV + D
Sbjct:  351 ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPE---DSPVVYSMVSLLDSR-SQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTT--LQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF-----------------SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVID 681          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 248.825 bits (634), Expect = 3.271e-68
Identity = 224/784 (28.57%), Postives = 369/784 (47.07%), Query Frame = 1
Query:  172 YAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVW----DGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVT----NDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NPS--FCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
            Y I+E       IG I +D+ +S        +  + YR   +        V+ +   I  T   ID E+LCP   P+ E  +    + V     D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N+V +K +       F L +      + +P L++++ LD E+   Y + +   +     + +   + + V ++ND  P FK+ + EV + EN P+ + ++Q++A D D   ++EI Y    + +  + + F++ ++ G I ++RPLD E T++H + V ASD   + A   + I V DVND AP  +L    +P+     + E  P N  I  IT+ D+D++  NGK+ C+  +++          P   K  Y  +Y L T    D E T + + K++      + K  L  T  + + + D NDN PIF + V  +++ ENN  D  +  ++ATD+D GRN  + Y+      + P  S F +D  +G +TA+   DRE++  +   + A+D GT   Q  S   + +TI+D NDNSPKF     +  + EN    + VG++  TD D G+N  +   +L N NENF     +G ++S   FDRE    Y   +   D G  P S    V IN++DVNDN P +I+P  +  +  +  S +              PG  + +  A D D G NA   + I   N   +F IDP  G + ++ K     IG + + + + D G P  +H+
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCP--GPSFEDSECSFEIEVVILPNDYFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFAIPSATDPDTGP--NSV-HKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDV-NGKVICFIEKDV----------PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQ------LGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQ--SQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSIL-NDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYPKSLHT 765          

HSP 2 Score: 129.028 bits (323), Expect = 8.393e-30
Identity = 162/585 (27.69%), Postives = 254/585 (43.42%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ-YFSV----SSKG----QIFLKRPLDFETTSLHLIDVQASD--NEFNANTKVV-ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      ++    + Q  F +    + +G    Q+ +++ LD E    +++ V+  D  N   ++T ++ +TV DVND  P F  +     I E  P    + Q+   D D   AN ++     + ++  Q      P   + F       L T  R  DREET      V+       + +P  +T+TI++T  D+NDN P      I      +V + E +P++ K+  +T +DKD   NG V   I+      P     V D+     T+ L LD E    Y   IVA D G     QT+   + + + D NDN P F  P  +L + EN      +  + ATD D G N +++++L PN   +FF L    G L +++ FDRE  +R+   +   D G   L     V + ILD NDN P+  F   H ++   +N           L  Y + G        +D D GENA    R+S+ ND + F +DP  G+++      +E    Y   +   DNG P    + K+ + + D+
Sbjct:  125 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADV-GANAEI-----KYMFGAQV----SPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASD---GSSSPARATITINVT--DVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDV---PFHLKAVYDNQYLLETSAL-LDYEGTKEYIFKIVASDSGKPSLNQTA--LVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPN--ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPK--FTHNHFQFFVSEN-----------LPKYSTVGV----ITVTDADAGENAVV--RLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDV 667          

HSP 3 Score: 119.398 bits (298), Expect = 7.636e-27
Identity = 126/488 (25.82%), Postives = 217/488 (44.47%), Query Frame = 1
Query: 1039 IDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPE-KSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKP--GTEVGILIATDNDEGDNGKLLF---KLLPNHNENFF---YLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEIL--KCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            I+V    N++    K+ I V D ND AP F   PS   I    PEN +I         ++   G  S  +   L N Q+      +++        L  +   DRE+    V KV +       K   +ST  + +T+ D+NDN P+F+++   V I EN+PV   V+++ ATD D+G N  + Y       ++P  + LF +++ +G +T    LDRE+ + ++L ++A D  + P + T +  +     +  +   ++ I P    +  +EK    T++ ++  +D D   NGK++    K +P H +  +   YL     L+++   D E T  Y  +I  +D GK  L+ T  V + + D NDNPP    P                    I+L++ E+   ++      A+D D G NA   +++  PN    F +D + G+L   R   +E    +   +   DNG  +      ++V I D
Sbjct:  112 IEVVILPNDYFRLIKIKIIVKDTNDNAPMF---PSPV-INISIPENTLINSRFAIPSATDPDTGPNSVHK-YELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQK---SSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFG--AQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYL-----LETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQP-------------------VIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLG-PN-ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILD 563          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 248.825 bits (634), Expect = 5.090e-68
Identity = 224/784 (28.57%), Postives = 369/784 (47.07%), Query Frame = 1
Query:  172 YAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVW----DGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVT----NDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NPS--FCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
            Y I+E       IG I +D+ +S        +  + YR   +        V+ +   I  T   ID E+LCP   P+ E  +    + V     D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N+V +K +       F L +      + +P L++++ LD E+   Y + +   +     + +   + + V ++ND  P FK+ + EV + EN P+ + ++Q++A D D   ++EI Y    + +  + + F++ ++ G I ++RPLD E T++H + V ASD   + A   + I V DVND AP  +L    +P+     + E  P N  I  IT+ D+D++  NGK+ C+  +++          P   K  Y  +Y L T    D E T + + K++      + K  L  T  + + + D NDN PIF + V  +++ ENN  D  +  ++ATD+D GRN  + Y+      + P  S F +D  +G +TA+   DRE++  +   + A+D GT   Q  S   + +TI+D NDNSPKF     +  + EN    + VG++  TD D G+N  +   +L N NENF     +G ++S   FDRE    Y   +   D G  P S    V IN++DVNDN P +I+P  +  +  +  S +              PG  + +  A D D G NA   + I   N   +F IDP  G + ++ K     IG + + + + D G P  +H+
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPG--PSFEDSECSFEIEVVILPNDYFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFAIPSATDPDTGP--NSV-HKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDV-NGKVICFIEKDV----------PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQ------LGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQ--SQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSIL-NDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYPKSLHT 765          

HSP 2 Score: 129.028 bits (323), Expect = 8.220e-30
Identity = 159/585 (27.18%), Postives = 255/585 (43.59%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ-YFSV----SSKG----QIFLKRPLDFETTSLHLIDVQASD--NEFNANTKVV-ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      ++    + Q  F +    + +G    Q+ +++ LD E    +++ V+  D  N   ++T ++ +TV DVND  P F  +     I E  P    + Q+   D D   AN ++     + ++  Q      P   + F       L T  R  DREET      V+       + +P  +T+TI++T  D+NDN P      I      +V + E +P++ K+  +T +DKD   NG V   I+     + +    V D+     T+ L LD E    Y   IVA D G     QT+   + + + D NDN P F  P  +L + EN      +  + ATD D G N +++++L PN   +FF L    G L +++ FDRE  +R+   +   D G   L     V + ILD NDN P+      H  + +          ++ +L  Y + G        +D D GENA    R+S+ ND + F +DP  G+++      +E    Y   +   DNG P    + K+ + + D+
Sbjct:  125 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADV-GANAEI-----KYMFGAQV----SPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASD---GSSSPARATITINVT--DVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKA---VYDNQYLLETSAL-LDYEGTKEYIFKIVASDSGKPSLNQTA--LVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPN--ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDADAGENAVV--RLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDV 667          

HSP 3 Score: 119.783 bits (299), Expect = 6.644e-27
Identity = 126/488 (25.82%), Postives = 217/488 (44.47%), Query Frame = 1
Query: 1039 IDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPE-KSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKP--GTEVGILIATDNDEGDNGKLLF---KLLPNHNENFF---YLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEIL--KCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            I+V    N++    K+ I V D ND AP F   PS   I    PEN +I         ++   G  S  +   L N Q+      +++        L  +   DRE+    V KV +       K   +ST  + +T+ D+NDN P+F+++   V I EN+PV   V+++ ATD D+G N  + Y       ++P  + LF +++ +G +T    LDRE+ + ++L ++A D  + P + T +  +     +  +   ++ I P    +  +EK    T++ ++  +D D   NGK++    K +P H +  +   YL     L+++   D E T  Y  +I  +D GK  L+ T  V + + D NDNPP    P                    I+L++ E+   ++      A+D D G NA   +++  PN    F +D + G+L   R   +E    +   +   DNG  +      ++V I D
Sbjct:  112 IEVVILPNDYFRLIKIKIIVKDTNDNAPMF---PSPV-INISIPENTLINSRFAIPSATDPDTGPNSVHK-YELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQK---SSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFG--AQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYL-----LETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQP-------------------VIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLG-PN-ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILD 563          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 248.825 bits (634), Expect = 5.090e-68
Identity = 224/784 (28.57%), Postives = 369/784 (47.07%), Query Frame = 1
Query:  172 YAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVW----DGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVT----NDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NPS--FCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
            Y I+E       IG I +D+ +S        +  + YR   +        V+ +   I  T   ID E+LCP   P+ E  +    + V     D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N+V +K +       F L +      + +P L++++ LD E+   Y + +   +     + +   + + V ++ND  P FK+ + EV + EN P+ + ++Q++A D D   ++EI Y    + +  + + F++ ++ G I ++RPLD E T++H + V ASD   + A   + I V DVND AP  +L    +P+     + E  P N  I  IT+ D+D++  NGK+ C+  +++          P   K  Y  +Y L T    D E T + + K++      + K  L  T  + + + D NDN PIF + V  +++ ENN  D  +  ++ATD+D GRN  + Y+      + P  S F +D  +G +TA+   DRE++  +   + A+D GT   Q  S   + +TI+D NDNSPKF     +  + EN    + VG++  TD D G+N  +   +L N NENF     +G ++S   FDRE    Y   +   D G  P S    V IN++DVNDN P +I+P  +  +  +  S +              PG  + +  A D D G NA   + I   N   +F IDP  G + ++ K     IG + + + + D G P  +H+
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPG--PSFEDSECSFEIEVVILPNDYFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFAIPSATDPDTGP--NSV-HKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDV-NGKVICFIEKDV----------PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQ------LGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQ--SQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSIL-NDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYPKSLHT 765          

HSP 2 Score: 129.028 bits (323), Expect = 8.220e-30
Identity = 159/585 (27.18%), Postives = 255/585 (43.59%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ-YFSV----SSKG----QIFLKRPLDFETTSLHLIDVQASD--NEFNANTKVV-ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      ++    + Q  F +    + +G    Q+ +++ LD E    +++ V+  D  N   ++T ++ +TV DVND  P F  +     I E  P    + Q+   D D   AN ++     + ++  Q      P   + F       L T  R  DREET      V+       + +P  +T+TI++T  D+NDN P      I      +V + E +P++ K+  +T +DKD   NG V   I+     + +    V D+     T+ L LD E    Y   IVA D G     QT+   + + + D NDN P F  P  +L + EN      +  + ATD D G N +++++L PN   +FF L    G L +++ FDRE  +R+   +   D G   L     V + ILD NDN P+      H  + +          ++ +L  Y + G        +D D GENA    R+S+ ND + F +DP  G+++      +E    Y   +   DNG P    + K+ + + D+
Sbjct:  125 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADV-GANAEI-----KYMFGAQV----SPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASD---GSSSPARATITINVT--DVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKA---VYDNQYLLETSAL-LDYEGTKEYIFKIVASDSGKPSLNQTA--LVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPN--ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDADAGENAVV--RLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDV 667          

HSP 3 Score: 119.783 bits (299), Expect = 6.644e-27
Identity = 126/488 (25.82%), Postives = 217/488 (44.47%), Query Frame = 1
Query: 1039 IDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPE-KSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKP--GTEVGILIATDNDEGDNGKLLF---KLLPNHNENFF---YLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEIL--KCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            I+V    N++    K+ I V D ND AP F   PS   I    PEN +I         ++   G  S  +   L N Q+      +++        L  +   DRE+    V KV +       K   +ST  + +T+ D+NDN P+F+++   V I EN+PV   V+++ ATD D+G N  + Y       ++P  + LF +++ +G +T    LDRE+ + ++L ++A D  + P + T +  +     +  +   ++ I P    +  +EK    T++ ++  +D D   NGK++    K +P H +  +   YL     L+++   D E T  Y  +I  +D GK  L+ T  V + + D NDNPP    P                    I+L++ E+   ++      A+D D G NA   +++  PN    F +D + G+L   R   +E    +   +   DNG  +      ++V I D
Sbjct:  112 IEVVILPNDYFRLIKIKIIVKDTNDNAPMF---PSPV-INISIPENTLINSRFAIPSATDPDTGPNSVHK-YELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQK---SSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFG--AQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYL-----LETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQP-------------------VIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLG-PN-ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILD 563          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: CR847522.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:4879379:1 gene:ENSDARG00000111493.1 transcript:ENSDART00000185190.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847522.1)

HSP 1 Score: 249.21 bits (635), Expect = 5.307e-68
Identity = 224/784 (28.57%), Postives = 369/784 (47.07%), Query Frame = 1
Query:  172 YAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVW----DGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVT----NDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NPS--FCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
            Y I+E       IG I +D+ +S        +  + YR   +        V+ +   I  T   ID E+LCP   P+ E  +    + V     D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N+V +K +       F L +      + +P L++++ LD E+   Y + +   +     + +   + + V ++ND  P FK+ + EV + EN P+ + ++Q++A D D   ++EI Y    + +  + + F++ ++ G I ++RPLD E T++H + V ASD   + A   + I V DVND AP  +L    +P+     + E  P N  I  IT+ D+D++  NGK+ C+  +++          P   K  Y  +Y L T    D E T + + K++      + K  L  T  + + + D NDN PIF + V  +++ ENN  D  +  ++ATD+D GRN  + Y+      + P  S F +D  +G +TA+   DRE++  +   + A+D GT   Q  S   + +TI+D NDNSPKF     +  + EN    + VG++  TD D G+N  +   +L N NENF     +G ++S   FDRE    Y   +   D G  P S    V IN++DVNDN P +I+P  +  +  +  S +              PG  + +  A D D G NA   + I   N   +F IDP  G + ++ K     IG + + + + D G P  +H+
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPG--PSFEDSECSFEIEVVILPNDYFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFAIPSATDPDTGP--NSV-HKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDV-NGKVICFIEKDV----------PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQ------LGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQ--SQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSIL-NDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYPKSLHT 765          

HSP 2 Score: 129.798 bits (325), Expect = 4.956e-30
Identity = 161/585 (27.52%), Postives = 255/585 (43.59%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ-YFSV----SSKG----QIFLKRPLDFETTSLHLIDVQASD--NEFNANTKVV-ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      ++    + Q  F +    + +G    Q+ +++ LD E    +++ V+  D  N   ++T ++ +TV DVND  P F  +     I E  P    + Q+   D D   AN ++     + ++  Q      P   + F       L T  R  DREET      V+       + +P  +T+TI++T  D+NDN P      I      +V + E +P++ K+  +T +DKD   NG V   I+     + +    V D+     T+ L LD E    Y   IVA D G     QT+   + + + D NDN P F  P  +L + EN      +  + ATD D G N +++++L PN   +FF L    G L +++ FDRE  +R+   +   D G   L     V + ILD NDN P+  F   H ++   +N           L  Y + G        +D D GENA    R+S+ ND + F +DP  G+++      +E    Y   +   DNG P    + K+ + + D+
Sbjct:  125 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADV-GANAEI-----KYMFGAQV----SPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASD---GSSSPARATITINVT--DVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKA---VYDNQYLLETSAL-LDYEGTKEYIFKIVASDSGKPSLNQTA--LVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPN--ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPK--FTHNHFQFFVSEN-----------LPKYSTVGV----ITVTDADAGENAVV--RLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDV 667          

HSP 3 Score: 119.783 bits (299), Expect = 6.235e-27
Identity = 126/488 (25.82%), Postives = 217/488 (44.47%), Query Frame = 1
Query: 1039 IDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPE-KSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKP--GTEVGILIATDNDEGDNGKLLF---KLLPNHNENFF---YLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEIL--KCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            I+V    N++    K+ I V D ND AP F   PS   I    PEN +I         ++   G  S  +   L N Q+      +++        L  +   DRE+    V KV +       K   +ST  + +T+ D+NDN P+F+++   V I EN+PV   V+++ ATD D+G N  + Y       ++P  + LF +++ +G +T    LDRE+ + ++L ++A D  + P + T +  +     +  +   ++ I P    +  +EK    T++ ++  +D D   NGK++    K +P H +  +   YL     L+++   D E T  Y  +I  +D GK  L+ T  V + + D NDNPP    P                    I+L++ E+   ++      A+D D G NA   +++  PN    F +D + G+L   R   +E    +   +   DNG  +      ++V I D
Sbjct:  112 IEVVILPNDYFRLIKIKIIVKDTNDNAPMF---PSPV-INISIPENTLINSRFAIPSATDPDTGPNSVHK-YELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQK---SSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFG--AQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYL-----LETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQP-------------------VIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLG-PN-ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILD 563          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 237.654 bits (605), Expect = 1.950e-64
Identity = 224/809 (27.69%), Postives = 373/809 (46.11%), Query Frame = 1
Query:   97 LLYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVL----DSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGL---SLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVT----NDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ-------YFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQ------FNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEK-SLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
            L+ +F CL          Q  D   Y +KE QP   RIG + +D+ L+    ++ LS  + ++   +     L     S   IL T   ID E+LC     +G   +      +   +    +  ++++   ++D+NDN P F ++ I  S+ E    +     +  A D D+   +    Y+L   +    F L +      D +P L+++++LD E    + + I   +     + +   + + V ++ND  P FK  + EV+V EN P+ + +  + A D D  S      + FS+Q       +F++ S+ G I +K+PLD E   +H + V ASD     +   V++ V D+ND  P        NL      + E  P N  I  IT+ DRDS+  NGK++C+   ++  +     KP      F  ++ L T    D E T +   +++      + K PL ++  + + I D NDN P+F +    +SI ENN    ++IK++ATD D G N L+ Y      S+ P+    F IDS SG ++   +LDREK+  Y   ++A+D GT P Q  S+ T+ + + D NDNSP F  P+    + EN      VG++  TD D GDN  +   ++ N  +NF      G ++    FDRE    Y   ++  D G    +    V IN++DVNDN P  + P  +  Y  + ++T              SPG  + +  A D D G NA   + I   +   +F+ID   G + ++ K+     G + + + V+D G+P  +H+
Sbjct:   10 LVVLFTCL----FLMCRAQEKD---YTVKEEQPENVRIGNLRKDLNLNLDPDIK-LSSALQFKPVYKTGDVPLVKVEASTGEILTTANRIDREKLC-----SGVFNEKRCYYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENT-AINSRYPVPSAFDPDIGI-NGIQHYELVKSVSE--FGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFS-FSNQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDL-NGKVTCYTDHDVPFR----LKP-----VFNDQFLLETAAPLDYETTREYAIRIVASD---SGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIY------SLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQ--SNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSII-NGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNT--------------SPGSVVTRVFAIDNDTGMNAELQYSIIGGSLRGLFTIDKTTGNITLQEKIVAADQGLHRLVVKVKDLGQPESLHA 764          

HSP 2 Score: 125.946 bits (315), Expect = 8.572e-29
Identity = 154/581 (26.51%), Postives = 247/581 (42.51%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSKG---QIFLKRPLDFETTSLHLIDVQASD--NEFNANTKVV-ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I   + +IND  P F+     +S+ EN  INS      A D D      +  E+    ++F              Q+ +++ LD ET    ++ ++  D  N   ++T ++ +TV DVND  P F  +     + E  P    +  +   D D   +N ++       +       F   +DS T      +  +   DRE    +    +IV     +  P  +T+ +++T  DINDN P      I      +V + EN P++ K+  +T TD+D   NG VT   D+       K +F   +D   +     LD E    Y + IVA D G  P    +S  + I I D NDN P F  P+ +L I EN  PGT++  + ATD D G N  +++ L P+  + F   + +G L   K  DRE  ++Y   +   D G TPL    TV + + D NDN P       HP+Y +          +  +L +Y + G        +D D G+NA     +S+ N  D F IDP+ G+++      +E    Y   +   D G        K+ + + D+
Sbjct:  123 VKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADL-GSNAQIHFSFSNQISPSTKRHFA--IDSTTGL----ITVKQPLDRE---VNPVHKLIVLASDGSSTPSRATVIVNVT--DINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFR-LKPVF---NDQFLLETAAPLDYETTREYAIRIVASDSGKPPLN--TSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFT----HPEYNFY---------VPENLPLYGTVGL----ITVTDADAGDNAV--VTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDV 666          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 254.218 bits (648), Expect = 1.047e-69
Identity = 235/810 (29.01%), Postives = 373/810 (46.05%), Query Frame = 1
Query:  100 LYIFQCLIN-LRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGE---MGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVT-YKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFSSQYFSVSSK--------GQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
             Y+   LI  LRL     Q  ++I Y I+E  P    IG I +D+ +S        S  + YR   +        V  S   I  T T ID E+LC     + E     +L +V+   D   L   I+++I V+D NDN P F ++ I  S+ E    +     +  A+D D     N V  Y+L     ++    +     + +P L++++ LD E+   Y + I   +     + +   + + V ++ND +P FK+ + EV + EN PI + ++Q+ A D D   ++EI Y    F +Q  S + +        G I ++RPLD E T++H + V A+D     A   V I V DVND  P  +L    +P      + E  P N  I  IT+ D+D++  N K+ C+  R +          P   K  Y  +Y L T    D E      +    +      K  L  T  + + + D NDN PIF + V  +S+ ENN     +  V+A+D+D G+N  + Y+      + P  S F +D  +G +TA+   DRE++  +   + A+D GT P Q  S   + +T++D NDNSPKF     +  + EN    + VG++ ATD+D G+N  +   +L N NENF     +G ++S   FDRE    Y   ++  D G+ P S T  V INI+D NDN P +I P  +  +  +  S +              PG  + +  A D D G NA   + I   N+  +F IDP  G + ++ K     +G + + + + D G P  +H+
Sbjct:    6 FYLLAALIACLRLDSAIAQ--ELI-YTIREELPENVPIGNIPKDLNISHINAATGSSTSLVYRLVSKAGDSPLVKVSSSTGEIFTTSTRIDREKLCAGSSNSDENECFFELEVVILPNDFFRL---IKIKIIVKDTNDNAPMFPSTVINISIPENTL-INSRFPIPSAVDPDTG--FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYI---FGAQVTSATKRLFALNNTTGLITVQRPLDREETAVHKLTVLATDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDV-NSKVICFIEREV----------PFHLKAVYDNQYLLETSSLLDYE---GIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQ------LGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSIL-NDNENFVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDNSPVVISPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDTDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPSAADVGLHRLVVNISDLGYPKPLHT 766          

HSP 2 Score: 122.865 bits (307), Expect = 1.155e-27
Identity = 157/582 (26.98%), Postives = 254/582 (43.64%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSK---GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            + I I V + ND  P F      +S+ EN  INS      AVD D      +  E+    + F              Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F  +    ++E   PEN  IG   +    ++A  G  S  E + ++  Q       L +        L T  R  DREET      V+       +  P  +T+TI++T  D+NDN P      I      +V + E +P++ K+  +T +DKD   N  V   I+  R + P     V D+     T++L LD E    +   IVA D G     QT+   + + + D NDN P F  P  +L + EN + G  +  + A+D D G N  ++++L PN   +FF L    G L +++ FDRE  +R+   +   D G  PL     V + +LD NDN P+      H  + +          ++ +L  Y + G       A+D D GEN A    +S+ ND + F +DP  G+++      +E    Y   +   D G+P +  + K+ + I D
Sbjct:  126 IKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKES----QVEVHIPENAPIGTSVVQLHATDADIG--SNAEIKYIFGAQVTSATKRLFA--LNNTTGLITVQRPLDREETAVHKLTVLATD---GSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFIE--REV-PFHLKAVYDNQYLLETSSL-LDYEGIKEFSFKIVAADTGKPSLNQTA--LVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPN--ASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFT----HNHFQFF---------VSENLPKYSTVGV----ITATDSDAGENKAV--TLSILNDNENFVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMD 667          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 229.18 bits (583), Expect = 2.111e-61
Identity = 223/810 (27.53%), Postives = 376/810 (46.42%), Query Frame = 1
Query:  103 YIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRN-LSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWA--WNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFN----LNP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEK-SLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIG-------PKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGD----YNVQIIVEDNGKPSKMHS 2439
            Y+   LI   ++    Q  +   Y ++E  P    IG + +D+ L+    L   L  K+ Y+        V ++   I  T   ID E+LC       +      V  + D   +  ++++   ++D+NDN P F ++ I  S+ E    V     +  AID DV   +    Y+L    +++    +     D +P L+++++LD E+   Y + I      +PA +    L +T  V ++ND  P FK++  EV++ E+  + + + Q+ A D D   +++I +    +  + + ++F++ ++ G I +K PLD E +  H + V ASD     +   V I + D+ND  P  +    +NP     ++ E  P N  I  IT+ D+D++  NGK++C+   ++  +     KP  D++     + L T    D E T +   K++      + K PL  +  + + I D NDN P+F   +  +S  ENNP   ++ K++ATD D GRN  ++Y       + P   ++F +D  +G +TA  KLDREK+  Y   ++AKD G  P  QT++      +   ++ SP F         P+ L ++     GT VG++  TD D G+N  +   L+ N  +NF    + G ++    FDRE    Y  Q++  D+G    S T  V I + DVNDN P  + P  +  Y  +  ST              SPG  + +  A D D G NA   + I   N   +F+I  + G + +K KL   L GD    Y + I V D+GKP   H+
Sbjct:   28 YLLAVLIACIVFESGAQEKN---YIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTENKCFYEVEVAVLPD--EVFRLVKIRFLIEDINDNSPLFPSTVINISIPENT-AVNSRYSVPSAIDPDVGV-NGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVT--VTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADL-NGKVTCFTDHDVPFR----LKPVFDNQ-----FLLETAAPLDYESTREYAIKIVASD---SGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSY------MLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGN-PSLQTNTTVTLSVLDQNDN-SPSFTHNEYNFYVPENLPMY-----GT-VGLITVTDADSGENAVVTLSLV-NARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTST--------------SPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKL---LAGDHGVLYKLVIKVNDSGKPEPFHT 783          

HSP 2 Score: 148.673 bits (374), Expect = 1.078e-35
Identity = 171/585 (29.23%), Postives = 256/585 (43.76%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDED-SEITYRSADFSSQYFSV----SSKG----QIFLKRPLDFETTSLHLIDVQASD--NEFNANTKVV-ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIG----QITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I   + +IND  P F      +S+ EN  +NS      A+D D   + I +         F +    + +G    Q+ +++ LD E    +++ ++  D  N   ++T ++ +TV DVND  P F        IE   PE+  +G    Q+   D D   +N K+  +    + N     F   +D+ T      +  +   DREE+      V+       +  P  +T+TI++T  DINDN P      I      +V + E  P++ K+  +T TDKD   NG VT   D+     P +   V D+     TA   LD E    Y + IVA D G  P  Q  S  + I I D NDN+P F  P   L   EN  PGTE+  + ATD D G N +L + L PN    F      G L + ++ DRE  DRY   +   D G   L    TV +++LD NDN P       H +Y +          +  +L +Y + G        +D D GENA     +SL N  D F IDP  G++R      +E  G Y  Q+   D G P K  + K+ + ++D+
Sbjct:  141 VKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEK----DIEVNIPEDAAVGTSVTQLHATDADL-GSNAKIHFYFGNQITNLAKRHFA--IDNNTGL----ITVKEPLDREESPYHKLTVLASD---GSSTPSRATVTINIT--DINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDV---PFRLKPVFDNQFLLETAA-PLDYESTREYAIKIVASDSGKPPLNQ--SAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFT----HNEYNFY---------VPENLPMYGTVGL----ITVTDADSGENAV--VTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDV 684          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 229.565 bits (584), Expect = 2.152e-61
Identity = 223/810 (27.53%), Postives = 376/810 (46.42%), Query Frame = 1
Query:  103 YIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRN-LSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWA--WNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFN----LNP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEK-SLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIG-------PKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGD----YNVQIIVEDNGKPSKMHS 2439
            Y+   LI   ++    Q  +   Y ++E  P    IG + +D+ L+    L   L  K+ Y+        V ++   I  T   ID E+LC       +      V  + D   +  ++++   ++D+NDN P F ++ I  S+ E    V     +  AID DV   +    Y+L    +++    +     D +P L+++++LD E+   Y + I      +PA +    L +T  V ++ND  P FK++  EV++ E+  + + + Q+ A D D   +++I +    +  + + ++F++ ++ G I +K PLD E +  H + V ASD     +   V I + D+ND  P  +    +NP     ++ E  P N  I  IT+ D+D++  NGK++C+   ++  +     KP  D++     + L T    D E T +   K++      + K PL  +  + + I D NDN P+F   +  +S  ENNP   ++ K++ATD D GRN  ++Y       + P   ++F +D  +G +TA  KLDREK+  Y   ++AKD G  P  QT++      +   ++ SP F         P+ L ++     GT VG++  TD D G+N  +   L+ N  +NF    + G ++    FDRE    Y  Q++  D+G    S T  V I + DVNDN P  + P  +  Y  +  ST              SPG  + +  A D D G NA   + I   N   +F+I  + G + +K KL   L GD    Y + I V D+GKP   H+
Sbjct:   28 YLLAVLIACIVFESGAQEKN---YIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTENKCFYEVEVAVLPD--EVFRLVKIRFLIEDINDNSPLFPSTVINISIPENT-AVNSRYSVPSAIDPDVGV-NGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVT--VTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADL-NGKVTCFTDHDVPFR----LKPVFDNQ-----FLLETAAPLDYESTREYAIKIVASD---SGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSY------MLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGN-PSLQTNTTVTLSVLDQNDN-SPSFTHNEYNFYVPENLPMY-----GT-VGLITVTDADSGENAVVTLSLV-NARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTST--------------SPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKL---LAGDHGVLYKLVIKVNDSGKPEPFHT 783          

HSP 2 Score: 148.673 bits (374), Expect = 1.124e-35
Identity = 171/585 (29.23%), Postives = 256/585 (43.76%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDED-SEITYRSADFSSQYFSV----SSKG----QIFLKRPLDFETTSLHLIDVQASD--NEFNANTKVV-ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIG----QITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I   + +IND  P F      +S+ EN  +NS      A+D D   + I +         F +    + +G    Q+ +++ LD E    +++ ++  D  N   ++T ++ +TV DVND  P F        IE   PE+  +G    Q+   D D   +N K+  +    + N     F   +D+ T      +  +   DREE+      V+       +  P  +T+TI++T  DINDN P      I      +V + E  P++ K+  +T TDKD   NG VT   D+     P +   V D+     TA   LD E    Y + IVA D G  P  Q  S  + I I D NDN+P F  P   L   EN  PGTE+  + ATD D G N +L + L PN    F      G L + ++ DRE  DRY   +   D G   L    TV +++LD NDN P       H +Y +          +  +L +Y + G        +D D GENA     +SL N  D F IDP  G++R      +E  G Y  Q+   D G P K  + K+ + ++D+
Sbjct:  141 VKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEK----DIEVNIPEDAAVGTSVTQLHATDADL-GSNAKIHFYFGNQITNLAKRHFA--IDNNTGL----ITVKEPLDREESPYHKLTVLASD---GSSTPSRATVTINIT--DINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDV---PFRLKPVFDNQFLLETAA-PLDYESTREYAIKIVASDSGKPPLNQ--SAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFT----HNEYNFY---------VPENLPMYGTVGL----ITVTDADSGENAV--VTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDV 684          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 229.18 bits (583), Expect = 2.453e-61
Identity = 223/821 (27.16%), Postives = 377/821 (45.92%), Query Frame = 1
Query:   70 MKQIKCSLFLLYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRN-LSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWA--WNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFN----LNP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEK-SLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIG-------PKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGD----YNVQIIVEDNGKPSKMHS 2439
            M  +  +  L  +  C++       F        Y ++E  P    IG + +D+ L+    L   L  K+ Y+        V ++   I  T   ID E+LC       +      V  + D   +  ++++   ++D+NDN P F ++ I  S+ E    V     +  AID DV   +    Y+L    +++    +     D +P L+++++LD E+   Y + I      +PA +    L +T  V ++ND  P FK++  EV++ E+  + + + Q+ A D D   +++I +    +  + + ++F++ ++ G I +K PLD E +  H + V ASD     +   V I + D+ND  P  +    +NP     ++ E  P N  I  IT+ D+D++  NGK++C+   ++  +     KP  D++     + L T    D E T +   K++      + K PL  +  + + I D NDN P+F   +  +S  ENNP   ++ K++ATD D GRN  ++Y       + P   ++F +D  +G +TA  KLDREK+  Y   ++AKD G  P  QT++      +   ++ SP F         P+ L ++     GT VG++  TD D G+N  +   L+ N  +NF    + G ++    FDRE    Y  Q++  D+G    S T  V I + DVNDN P  + P  +  Y  +  ST              SPG  + +  A D D G NA   + I   N   +F+I  + G + +K KL   L GD    Y + I V D+GKP   H+
Sbjct:    1 MDLLSGTYLLAVLIACIV-------FESGAQEKNYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTENKCFYEVEVAVLPD--EVFRLVKIRFLIEDINDNSPLFPSTVINISIPENT-AVNSRYSVPSAIDPDVGV-NGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVT--VTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADL-NGKVTCFTDHDVPFR----LKPVFDNQ-----FLLETAAPLDYESTREYAIKIVASD---SGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSY------MLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGN-PSLQTNTTVTLSVLDQNDN-SPSFTHNEYNFYVPENLPMY-----GT-VGLITVTDADSGENAVVTLSLV-NARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTST--------------SPGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKL---LAGDHGVLYKLVIKVNDSGKPEPFHT 763          

HSP 2 Score: 148.288 bits (373), Expect = 1.158e-35
Identity = 171/585 (29.23%), Postives = 256/585 (43.76%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDED-SEITYRSADFSSQYFSV----SSKG----QIFLKRPLDFETTSLHLIDVQASD--NEFNANTKVV-ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIG----QITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I   + +IND  P F      +S+ EN  +NS      A+D D   + I +         F +    + +G    Q+ +++ LD E    +++ ++  D  N   ++T ++ +TV DVND  P F        IE   PE+  +G    Q+   D D   +N K+  +    + N     F   +D+ T      +  +   DREE+      V+       +  P  +T+TI++T  DINDN P      I      +V + E  P++ K+  +T TDKD   NG VT   D+     P +   V D+     TA   LD E    Y + IVA D G  P  Q  S  + I I D NDN+P F  P   L   EN  PGTE+  + ATD D G N +L + L PN    F      G L + ++ DRE  DRY   +   D G   L    TV +++LD NDN P       H +Y +          +  +L +Y + G        +D D GENA     +SL N  D F IDP  G++R      +E  G Y  Q+   D G P K  + K+ + ++D+
Sbjct:  121 VKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEK----DIEVNIPEDAAVGTSVTQLHATDADL-GSNAKIHFYFGNQITNLAKRHFA--IDNNTGL----ITVKEPLDREESPYHKLTVLASD---GSSTPSRATVTINIT--DINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDV---PFRLKPVFDNQFLLETAA-PLDYESTREYAIKIVASDSGKPPLNQ--SAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFT----HNEYNFY---------VPENLPMYGTVGL----ITVTDADSGENAV--VTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDV 664          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 227.254 bits (578), Expect = 1.162e-60
Identity = 232/830 (27.95%), Postives = 374/830 (45.06%), Query Frame = 1
Query:   67 TMKQIKCSLFLLYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDV--PLSTQMILRNLSEKINYRFQKQLSYFVLDSNTS-ILKTKTLIDLEEL--CPDHCPTGEMGQLYLVVNVWDGLS-LKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYS-DTFMLKVTNDS---FPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITY---RSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFN---ANTKVVITVVDVNDEAP-----QFNL---NPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDIL 2472
             MK+   + FL   FQ  I              + Y + E QP    IG ++ D   P S  +          Y+ +    Y  +D  T  I  T+T ID E L  C +  P GE   L   V++ D +S +  ++  +I + D+NDN P F +  I  S+ E    +G    +  A DRD S  +   +Y+L     + D F L+V  D     P L++   LD E+   Y+L I   +     + +   + I +++ ND  PKF++  YE  + EN P+   ++QV+A D D+  ++EI Y   +++D   +   +  S G I ++ P+D E        V A D   N   A T+V IT+ D ND  P      F L         I E  P    +  + + D D E  N  ++C    ++  +   +     DSK    KY L T    D E   +   +++ V    +   PL+ST ++ + + D+NDN P+F +++  V   ENN ++  V++V+ATD D G N  + Y I    S    + +F I+ DSG +     LDRE+   Y   +VA DKG    + T+S    IT++D NDN PKF +      + EN    + VG++   D D+G+N  +   + P   E F      G++ S+  FDRE    Y  +++  D G  P S    V IN+LD NDN P ++ P  +  Y ++   T               PG  +    A D+D G NA   + I+  N  ++F I    G + +++ + ++  G + + + V D GKPS+  +  +   I + L
Sbjct:   44 AMKRTATACFLWLFFQLPI--------LGSSTKVAYRVPEEQPPNILIGSLASDYGYPDSKHL----------YKLELGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEP-GEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENT-NIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDID-EGVNAAVTCVVAGDVPFQLKQVSDTGSDSKK---KYFLQTTTALDYESVKEYTIEIVAVD---SGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSA---RGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASV--VITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGE-FVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPS-NISYKYLTPQT--------------HPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETL 824          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 253.447 bits (646), Expect = 2.167e-70
Identity = 234/807 (29.00%), Postives = 375/807 (46.47%), Query Frame = 1
Query:  100 LYIFQCLIN-LRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGE---MGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVT-YKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
             Y+   LI  LRL     Q  ++I Y I+E  P    IG I +D+ +S        S  + YR   +        V  S   I  T   ID E+LC       E     +L +V+   D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N V  Y+L     ++    +     + +P L++++ LD E+   Y + I   +     + +   + + V ++ND  P FK+ + EV + EN P+ + +IQ+ A D D   ++EI Y    + A  + + F+++ + G I ++R LD E T++H + V ASD     A   V I V DVND  P  +L    +P      + E  P N  I  IT+ D+D++  NGK+ C+  R +          P   K  Y  +Y L T    D E T +   K++      + K  L  T  + + + D NDN PIF + V  +S+ ENN     +  ++ATD+D G+N  + Y+      + P  S F +D  +G +TA+   +RE++  +   + A+D GT P Q  S   + +T++D NDNSPKF     +  + EN    + VG++  TD D G+N  +   +L N NENF     +G ++S   FDRE    Y   ++  D G+ P S T  V IN++DVNDN P +I P  +  +  +  S +              PG  + +  A D+D G NA   + I   N+  +F IDP  G + ++ K     +G + + + + D G P  +H+
Sbjct:    6 FYLLAALIACLRLDSAIAQ--ELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPDTG--FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDV-NGKVICFIEREV----------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASD---SGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ------LGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSIL-NDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHT 766          

HSP 2 Score: 127.102 bits (318), Expect = 2.685e-29
Identity = 160/585 (27.35%), Postives = 254/585 (43.42%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSK---GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      +  E+    + F              Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F       ++E   PEN  +G   I    ++A  G  S  E R ++  Q      P   + F       L T  R  DREET      V+       +  P  +T+TI++T  D+NDN P      I      +V + E +PV+ K+  +T +DKD   NG V   I+  R + P     V D+     T++L LD E    +   IVA D G     QT+   + + + D NDN P F  P  +L + EN + G  +  + ATD D G N  ++++L PN   +FF L    G L +++ F+RE  +R+   +   D G  PL     V + +LD NDN P+  F   H ++   +N           L  Y + G        +D D GEN A    +S+ ND + F +DP  G+++      +E    Y   +   D G+P +  + K+ + + D+
Sbjct:  126 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEG----QVEVHIPENAPVGTSVIQLHATDADIG--SNAEIRYIFGAQVA----PATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD---GSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REV-PFHLKAVYDNQYLLETSSL-LDYEGTKEFSFKIVASDSGKPSLNQTA--LVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN--ASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPK--FTHNHFQFFVSEN-----------LPKYSTVGV----ITVTDEDAGENKAV--TLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDV 668          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 253.832 bits (647), Expect = 3.448e-69
Identity = 235/808 (29.08%), Postives = 375/808 (46.41%), Query Frame = 1
Query:  100 LYIFQCLIN-LRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGE---MGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVT-YKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIF--ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
             Y+   LI  LRL     Q  ++I Y I+E  P    IG I +D+ +S        S  + YR   +        V  S   I  T   ID E+LC       E     +L +V+   D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N V  Y+L     ++    +     + +P L++++ LD E+   Y + I   +     + +   + + V ++ND  P FK+ + EV + EN P+ + +IQ+ A D D   ++EI Y    + A  + + F+++ + G I ++R LD E T++H + V ASD     A   V I V DVND  P  +L    +P      + E  P N  I  IT+ D+D++  NGK+ C+  R +          P   K  Y  +Y L T    D E T +   K++      + K  L  T  + + + D NDN PIF + V  +S+ ENN     +  ++ATD+D G+N  + Y+      + P  S F +D  +G +TA+   +RE++  +   + A+D GT P Q  S   + +T++D NDNSPKF      + F  EN    + VG++  TD D G+N  +   +L N NENF     +G ++S   FDRE    Y   ++  D G+ P S T  V IN++DVNDN P +I P  +  +  +  S +              PG  + +  A D+D G NA   + I   N+  +F IDP  G + ++ K     +G + + + + D G P  +H+
Sbjct:    6 FYLLAALIACLRLDSAIAQ--ELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPDTG--FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDV-NGKVICFIEREV----------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASD---SGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ------LGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTH-NHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSIL-NDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHT 766          

HSP 2 Score: 127.872 bits (320), Expect = 2.447e-29
Identity = 158/585 (27.01%), Postives = 254/585 (43.42%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSK---GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      +  E+    + F              Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F       ++E   PEN  +G   I    ++A  G  S  E R ++  Q      P   + F       L T  R  DREET      V+       +  P  +T+TI++T  D+NDN P      I      +V + E +PV+ K+  +T +DKD   NG V   I+  R + P     V D+     T++L LD E    +   IVA D G     QT+   + + + D NDN P F  P  +L + EN + G  +  + ATD D G N  ++++L PN   +FF L    G L +++ F+RE  +R+   +   D G  PL     V + +LD NDN P+      H  + +          ++ +L  Y + G        +D D GEN A    +S+ ND + F +DP  G+++      +E    Y   +   D G+P +  + K+ + + D+
Sbjct:  126 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEG----QVEVHIPENAPVGTSVIQLHATDADIG--SNAEIRYIFGAQVA----PATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD---GSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REV-PFHLKAVYDNQYLLETSSL-LDYEGTKEFSFKIVASDSGKPSLNQTA--LVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN--ASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDEDAGENKAV--TLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDV 668          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 253.832 bits (647), Expect = 4.179e-69
Identity = 235/808 (29.08%), Postives = 375/808 (46.41%), Query Frame = 1
Query:  100 LYIFQCLIN-LRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGE---MGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVT-YKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIF--ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
             Y+   LI  LRL     Q  ++I Y I+E  P    IG I +D+ +S        S  + YR   +        V  S   I  T   ID E+LC       E     +L +V+   D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N V  Y+L     ++    +     + +P L++++ LD E+   Y + I   +     + +   + + V ++ND  P FK+ + EV + EN P+ + +IQ+ A D D   ++EI Y    + A  + + F+++ + G I ++R LD E T++H + V ASD     A   V I V DVND  P  +L    +P      + E  P N  I  IT+ D+D++  NGK+ C+  R +          P   K  Y  +Y L T    D E T +   K++      + K  L  T  + + + D NDN PIF + V  +S+ ENN     +  ++ATD+D G+N  + Y+      + P  S F +D  +G +TA+   +RE++  +   + A+D GT P Q  S   + +T++D NDNSPKF      + F  EN    + VG++  TD D G+N  +   +L N NENF     +G ++S   FDRE    Y   ++  D G+ P S T  V IN++DVNDN P +I P  +  +  +  S +              PG  + +  A D+D G NA   + I   N+  +F IDP  G + ++ K     +G + + + + D G P  +H+
Sbjct:    6 FYLLAALIACLRLDSAIAQ--ELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPDTG--FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDV-NGKVICFIEREV----------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASD---SGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ------LGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTH-NHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSIL-NDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHT 766          

HSP 2 Score: 127.872 bits (320), Expect = 2.888e-29
Identity = 158/585 (27.01%), Postives = 254/585 (43.42%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSK---GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      +  E+    + F              Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F       ++E   PEN  +G   I    ++A  G  S  E R ++  Q      P   + F       L T  R  DREET      V+       +  P  +T+TI++T  D+NDN P      I      +V + E +PV+ K+  +T +DKD   NG V   I+  R + P     V D+     T++L LD E    +   IVA D G     QT+   + + + D NDN P F  P  +L + EN + G  +  + ATD D G N  ++++L PN   +FF L    G L +++ F+RE  +R+   +   D G  PL     V + +LD NDN P+      H  + +          ++ +L  Y + G        +D D GEN A    +S+ ND + F +DP  G+++      +E    Y   +   D G+P +  + K+ + + D+
Sbjct:  126 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEG----QVEVHIPENAPVGTSVIQLHATDADIG--SNAEIRYIFGAQVA----PATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD---GSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REV-PFHLKAVYDNQYLLETSSL-LDYEGTKEFSFKIVASDSGKPSLNQTA--LVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN--ASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDEDAGENKAV--TLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDV 668          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 253.832 bits (647), Expect = 4.179e-69
Identity = 235/808 (29.08%), Postives = 375/808 (46.41%), Query Frame = 1
Query:  100 LYIFQCLIN-LRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGE---MGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVT-YKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIF--ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
             Y+   LI  LRL     Q  ++I Y I+E  P    IG I +D+ +S        S  + YR   +        V  S   I  T   ID E+LC       E     +L +V+   D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N V  Y+L     ++    +     + +P L++++ LD E+   Y + I   +     + +   + + V ++ND  P FK+ + EV + EN P+ + +IQ+ A D D   ++EI Y    + A  + + F+++ + G I ++R LD E T++H + V ASD     A   V I V DVND  P  +L    +P      + E  P N  I  IT+ D+D++  NGK+ C+  R +          P   K  Y  +Y L T    D E T +   K++      + K  L  T  + + + D NDN PIF + V  +S+ ENN     +  ++ATD+D G+N  + Y+      + P  S F +D  +G +TA+   +RE++  +   + A+D GT P Q  S   + +T++D NDNSPKF      + F  EN    + VG++  TD D G+N  +   +L N NENF     +G ++S   FDRE    Y   ++  D G+ P S T  V IN++DVNDN P +I P  +  +  +  S +              PG  + +  A D+D G NA   + I   N+  +F IDP  G + ++ K     +G + + + + D G P  +H+
Sbjct:    6 FYLLAALIACLRLDSAIAQ--ELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPDTG--FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDV-NGKVICFIEREV----------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASD---SGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ------LGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTH-NHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSIL-NDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHT 766          

HSP 2 Score: 127.872 bits (320), Expect = 2.888e-29
Identity = 158/585 (27.01%), Postives = 254/585 (43.42%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSK---GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      +  E+    + F              Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F       ++E   PEN  +G   I    ++A  G  S  E R ++  Q      P   + F       L T  R  DREET      V+       +  P  +T+TI++T  D+NDN P      I      +V + E +PV+ K+  +T +DKD   NG V   I+  R + P     V D+     T++L LD E    +   IVA D G     QT+   + + + D NDN P F  P  +L + EN + G  +  + ATD D G N  ++++L PN   +FF L    G L +++ F+RE  +R+   +   D G  PL     V + +LD NDN P+      H  + +          ++ +L  Y + G        +D D GEN A    +S+ ND + F +DP  G+++      +E    Y   +   D G+P +  + K+ + + D+
Sbjct:  126 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEG----QVEVHIPENAPVGTSVIQLHATDADIG--SNAEIRYIFGAQVA----PATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD---GSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REV-PFHLKAVYDNQYLLETSSL-LDYEGTKEFSFKIVASDSGKPSLNQTA--LVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN--ASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDEDAGENKAV--TLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDV 668          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 253.447 bits (646), Expect = 4.596e-69
Identity = 235/808 (29.08%), Postives = 375/808 (46.41%), Query Frame = 1
Query:  100 LYIFQCLIN-LRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGE---MGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVT-YKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIF--ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
             Y+   LI  LRL     Q  ++I Y I+E  P    IG I +D+ +S        S  + YR   +        V  S   I  T   ID E+LC       E     +L +V+   D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N V  Y+L     ++    +     + +P L++++ LD E+   Y + I   +     + +   + + V ++ND  P FK+ + EV + EN P+ + +IQ+ A D D   ++EI Y    + A  + + F+++ + G I ++R LD E T++H + V ASD     A   V I V DVND  P  +L    +P      + E  P N  I  IT+ D+D++  NGK+ C+  R +          P   K  Y  +Y L T    D E T +   K++      + K  L  T  + + + D NDN PIF + V  +S+ ENN     +  ++ATD+D G+N  + Y+      + P  S F +D  +G +TA+   +RE++  +   + A+D GT P Q  S   + +T++D NDNSPKF      + F  EN    + VG++  TD D G+N  +   +L N NENF     +G ++S   FDRE    Y   ++  D G+ P S T  V IN++DVNDN P +I P  +  +  +  S +              PG  + +  A D+D G NA   + I   N+  +F IDP  G + ++ K     +G + + + + D G P  +H+
Sbjct:    6 FYLLAALIACLRLDSAIAQ--ELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPDTG--FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDV-NGKVICFIEREV----------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASD---SGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ------LGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTH-NHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSIL-NDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHT 766          

HSP 2 Score: 127.487 bits (319), Expect = 3.711e-29
Identity = 158/585 (27.01%), Postives = 254/585 (43.42%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSK---GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      +  E+    + F              Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F       ++E   PEN  +G   I    ++A  G  S  E R ++  Q      P   + F       L T  R  DREET      V+       +  P  +T+TI++T  D+NDN P      I      +V + E +PV+ K+  +T +DKD   NG V   I+  R + P     V D+     T++L LD E    +   IVA D G     QT+   + + + D NDN P F  P  +L + EN + G  +  + ATD D G N  ++++L PN   +FF L    G L +++ F+RE  +R+   +   D G  PL     V + +LD NDN P+      H  + +          ++ +L  Y + G        +D D GEN A    +S+ ND + F +DP  G+++      +E    Y   +   D G+P +  + K+ + + D+
Sbjct:  126 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEG----QVEVHIPENAPVGTSVIQLHATDADIG--SNAEIRYIFGAQVA----PATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD---GSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REV-PFHLKAVYDNQYLLETSSL-LDYEGTKEFSFKIVASDSGKPSLNQTA--LVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN--ASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDEDAGENKAV--TLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDV 668          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 253.832 bits (647), Expect = 2.347e-68
Identity = 235/808 (29.08%), Postives = 375/808 (46.41%), Query Frame = 1
Query:  100 LYIFQCLIN-LRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGE---MGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVT-YKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIF--ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
             Y+   LI  LRL     Q  ++I Y I+E  P    IG I +D+ +S        S  + YR   +        V  S   I  T   ID E+LC       E     +L +V+   D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N V  Y+L     ++    +     + +P L++++ LD E+   Y + I   +     + +   + + V ++ND  P FK+ + EV + EN P+ + +IQ+ A D D   ++EI Y    + A  + + F+++ + G I ++R LD E T++H + V ASD     A   V I V DVND  P  +L    +P      + E  P N  I  IT+ D+D++  NGK+ C+  R +          P   K  Y  +Y L T    D E T +   K++      + K  L  T  + + + D NDN PIF + V  +S+ ENN     +  ++ATD+D G+N  + Y+      + P  S F +D  +G +TA+   DRE++  +   + A+D GT P Q  S   + +T++D NDNSPKF      + F  EN    + VG++  TD D G+N  +   +L N N+NF     +G ++S   FDRE    Y   ++  D G+ P S T  V IN++DVNDN P +I P  +  +  +  S +              PG  + +  A D+D G NA   + I   N+  +F IDP  G + ++ K     +G + + + + D G P  +H+
Sbjct:    6 FYLLAALIACLRLDSAIAQ--ELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRL---IKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPDTG--FNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDV-NGKVICFIEREV----------PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASD---SGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ------LGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQ--SQAAVIVTVLDENDNSPKFTH-NHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSIL-NDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHT 766          

HSP 2 Score: 132.494 bits (332), Expect = 6.429e-30
Identity = 160/585 (27.35%), Postives = 254/585 (43.42%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSK---GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      +  E+    + F              Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F       ++E   PEN  +G   I    ++A  G  S  E R ++  Q      P   + F       L T  R  DREET      V+       +  P  +T+TI++T  D+NDN P      I      +V + E +PV+ K+  +T +DKD   NG V   I+  R + P     V D+     T++L LD E    +   IVA D G     QT+   + + + D NDN P F  P  +L + EN + G  +  + ATD D G N  ++++L PN   +FF L    G L +++ FDRE  +R+   +   D G  PL     V + +LD NDN P+      H  + +          ++ +L  Y + G        +D D GEN A    +S+ ND D F +DP  G+++      +E    Y   +   D G+P +  + K+ + + D+
Sbjct:  126 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEG----QVEVHIPENAPVGTSVIQLHATDADIG--SNAEIRYIFGAQVA----PATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASD---GSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REV-PFHLKAVYDNQYLLETSSL-LDYEGTKEFSFKIVASDSGKPSLNQTA--LVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPN--ASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDADAGENKAV--TLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDV 668          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.544e-66
Identity = 234/815 (28.71%), Postives = 378/815 (46.38%), Query Frame = 1
Query:   82 KCSLFLLYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLS---TQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCP-----DHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFSS----QYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEF-NANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKIL 2451
            KC L   YIF  L+   +++   Q  +   Y I+E  P    IG + +D+ LS    + +   +  K+ Y+        + +    I  T   ID E+LC      +HC        Y V        +  ++++   ++D+NDN P F  + I  S+ E    +     L  A+D DV   +    Y+L    +I+    +     D  P L+++K LD E    Y + +   +     + +   + + V + ND  P FK+ + EVS+ EN P+ + + Q+ A D D  E+++I +  ++  S    + F + ++ G I +K PLD E T  H + V ASD     A   V++ V DVND  P  ++    NP      + E  P N  I  IT+ D+D++  NG+++C+    +  +     +P      F  ++ L      D E T +   K++      A K PL  +  + + + D NDN P+F ++  +VSI ENN    +++KV+ATD D G N  + Y +       PE   F +D  +G +T   KLDREKE  Y   I+AKD G  P   TS+ T+ ++IID NDNSP F   + K  + EN      VG++  TD D GDN  +   +L + N++F   +  G ++    FDRE  + Y   ++  D G+   S +  V IN++DVNDN P  I P Y+  Y  +  ST              +PG  + +  A D D G NA   + I   N  D+F+ID + G + +  K     +G + V +   D G+P  + S  I+
Sbjct:   33 KCLLSGTYIFAVLLVCVVFHSGAQEKN---YTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-------FYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVGI-NGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADH-NGRVTCFTDHEIPFR----LRP-----VFSNQFLLENAAYLDYESTKEYAIKLLAAD---AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLG--PDAPPE---FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPP--LTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSIL-DENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPST--------------NPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIV 800          

HSP 2 Score: 146.747 bits (369), Expect = 3.034e-34
Identity = 105/359 (29.25%), Postives = 176/359 (49.03%), Query Frame = 1
Query: 1423 TSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI-GP--KKLEIFENEKPGTEVGILIATDNDEGDNGKLL--------FKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            +ST  + +++ D NDN P+F++    VSI EN PV   V ++ ATD DIG N  + +   NL S N  + LF +++ +G +T    LDRE+   ++L+++A D G MP +      +     +V     ++I  P    + + EN    T++ ++  TD D   NG++         F+L P  +  F        L++A   D E+T  Y +++   D GK PL+ +  + I + D NDN P  +F                +  +T+ +    SPG +++K  A+D D G NA  ++ +  P+ P  FS+D + G+L V +KL +E    Y   I+ +DNG P    +  + V I D
Sbjct:  262 SSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVS-NIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFL-------LENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAP--VF---------------TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLG-PDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIID 594          

HSP 3 Score: 122.479 bits (306), Expect = 8.214e-27
Identity = 152/581 (26.16%), Postives = 241/581 (41.48%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSKG---QIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVI---TVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I   + +IND  P F      +S+ EN  INS      AVD D      ++ E+      F              Q+ +++ LD E    +++ V+  D  F   +   I   +V D ND  P F        I E  P    + Q+   D D    N K+       + N    +F   L++ T      +  +   DREET +    V+      +    + +   + + + D+NDN P      I      +V + EN P++ K+  +T TDKD   NG VT   D+         L  + S+   +     LD E    Y + ++A D G  P  Q  S  + I + D NDN+P F      + I EN  PG ++  + ATD D G N ++ + L P+    F      G L   K+ DRE  D+Y   I   D G  PL+   TV ++I+D NDN P     +Y  K+   +N           L  + + G        +D D G+N+A    +S+ ++ D F+ID Q G++R      +E    Y   +  ED G+ S+  S K+ + + D+
Sbjct:  155 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADI-GENAKIHFSFSNLVSNIARRLFH--LNATTGL----ITIKEPLDREETPNHKLLVL-----ASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFR----LRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQ--SAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEY--KFYVPEN-----------LPRHGTVGL----ITVTDPDYGDNSA--VTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDV 698          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.365e-64
Identity = 230/808 (28.47%), Postives = 373/808 (46.16%), Query Frame = 1
Query:  103 YIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLS---TQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCP-----DHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFSS----QYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEF-NANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKIL 2451
            YIF  L+   +++   Q  +   Y I+E  P    IG + +D+ LS    + +   +  K+ Y+        + +    I  T   ID E+LC      +HC        Y V        +  ++++   ++D+NDN P F  + I  S+ E    +     L  A+D DV   +    Y+L    +I+    +     D  P L+++K LD E    Y + +   +     + +   + + V + ND  P FK+ + EVS+ EN P+ + + Q+ A D D  E+++I +  ++  S    + F + ++ G I +K PLD E T  H + V ASD     A   V++ V DVND  P  ++    NP      + E  P N  I  IT+ D+D++  NG+++C+    +  +     +P      F  ++ L T    D E T +   K++      A K PL  +  + + + D NDN P+F ++  +VSI ENN    ++ KV+ATD D G N  + Y +       PE   F +D  +G +T   KLDREKE  Y   I+AKD G  P   TS+ T+ ++IID NDNSP F   +    + EN      VG++  TD D GDN  +   +L + N++F   +  G ++    FDRE  + Y   ++  D G+   S +  V IN++DVNDN P  I P  +  Y  +  ST              +PG  + +  A D D G NA   + I   N  D+F+ID + G + +  K     +G + V +   D G+P  + S  I+
Sbjct:    8 YIFAVLLACVVFHSGAQEKN---YTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-------FYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVGT-NGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADH-NGRVTCFTDHEIPFR----LRP-----VFSNQFLLETAAYLDYESTKEYAIKLLAAD---AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLG--PDAPPE---FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPP--LTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSIL-DENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPST--------------NPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIV 768          

HSP 2 Score: 145.206 bits (365), Expect = 7.694e-34
Identity = 105/359 (29.25%), Postives = 175/359 (48.75%), Query Frame = 1
Query: 1423 TSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI-GP--KKLEIFENEKPGTEVGILIATDNDEGDNGKLL--------FKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            +ST  + +++ D NDN P+F++    VSI EN PV   V ++ ATD DIG N  + +   NL S N  + LF +++ +G +T    LDRE+   ++L+++A D G MP +      +     +V     ++I  P    + + EN    T++ ++  TD D   NG++         F+L P  +  F        L++A   D E+T  Y +++   D GK PL+ +  + I + D NDN P  +F                +  +T+ +    SPG ++ K  A+D D G NA  ++ +  P+ P  FS+D + G+L V +KL +E    Y   I+ +DNG P    +  + V I D
Sbjct:  230 SSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVS-NIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFL-------LETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAP--VF---------------TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLG-PDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIID 562          

HSP 3 Score: 123.635 bits (309), Expect = 4.025e-27
Identity = 154/581 (26.51%), Postives = 245/581 (42.17%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ-YFSV----SSKG----QIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVI---TVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I   + +IND  P F      +S+ EN  INS      AVD D  +          SQ  F +    + +G    Q+ +++ LD E    +++ V+  D  F   +   I   +V D ND  P F        I E  P    + Q+   D D    N K+       + N    +F   L++ T      +  +   DREET +    V+      +    + +   + + + D+NDN P      I      +V + EN P++ K+  +T TDKD   NG VT   D+         L  + S+   +     LD E    Y + ++A D G  P  Q  S  + I + D NDN+P F      + I EN  PG ++  + ATD D G N ++ + L P+    F      G L   K+ DRE  D+Y   I   D G  PL+   TV ++I+D NDN P  +F   H +Y +     + +   T+ L               +D D G+N+A    +S+ ++ D F+ID Q G++R      +E    Y   +  ED G+ S+  S K+ + + D+
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADI-GENAKIHFSFSNLVSNIARRLFH--LNATTGL----ITIKEPLDREETPNHKLLVL-----ASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFR----LRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQ--SAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSP--VF--THNEYNFYVPENLPRHG-TVGL------------ITVTDPDYGDNSA--VTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDV 666          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.493e-64
Identity = 230/808 (28.47%), Postives = 373/808 (46.16%), Query Frame = 1
Query:  103 YIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLS---TQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCP-----DHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFSS----QYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEF-NANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKIL 2451
            YIF  L+   +++   Q  +   Y I+E  P    IG + +D+ LS    + +   +  K+ Y+        + +    I  T   ID E+LC      +HC        Y V        +  ++++   ++D+NDN P F  + I  S+ E    +     L  A+D DV   +    Y+L    +I+    +     D  P L+++K LD E    Y + +   +     + +   + + V + ND  P FK+ + EVS+ EN P+ + + Q+ A D D  E+++I +  ++  S    + F + ++ G I +K PLD E T  H + V ASD     A   V++ V DVND  P  ++    NP      + E  P N  I  IT+ D+D++  NG+++C+    +  +     +P      F  ++ L T    D E T +   K++      A K PL  +  + + + D NDN P+F ++  +VSI ENN    ++ KV+ATD D G N  + Y +       PE   F +D  +G +T   KLDREKE  Y   I+AKD G  P   TS+ T+ ++IID NDNSP F   +    + EN      VG++  TD D GDN  +   +L + N++F   +  G ++    FDRE  + Y   ++  D G+   S +  V IN++DVNDN P  I P  +  Y  +  ST              +PG  + +  A D D G NA   + I   N  D+F+ID + G + +  K     +G + V +   D G+P  + S  I+
Sbjct:    8 YIFAVLLACVVFHSGAQEKN---YTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-------FYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVGT-NGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADH-NGRVTCFTDHEIPFR----LRP-----VFSNQFLLETAAYLDYESTKEYAIKLLAAD---AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLG--PDAPPE---FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPP--LTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSIL-DENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPST--------------NPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIV 768          

HSP 2 Score: 145.206 bits (365), Expect = 8.031e-34
Identity = 105/359 (29.25%), Postives = 175/359 (48.75%), Query Frame = 1
Query: 1423 TSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI-GP--KKLEIFENEKPGTEVGILIATDNDEGDNGKLL--------FKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            +ST  + +++ D NDN P+F++    VSI EN PV   V ++ ATD DIG N  + +   NL S N  + LF +++ +G +T    LDRE+   ++L+++A D G MP +      +     +V     ++I  P    + + EN    T++ ++  TD D   NG++         F+L P  +  F        L++A   D E+T  Y +++   D GK PL+ +  + I + D NDN P  +F                +  +T+ +    SPG ++ K  A+D D G NA  ++ +  P+ P  FS+D + G+L V +KL +E    Y   I+ +DNG P    +  + V I D
Sbjct:  230 SSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVS-NIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFL-------LETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAP--VF---------------TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLG-PDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIID 562          

HSP 3 Score: 123.635 bits (309), Expect = 4.421e-27
Identity = 154/581 (26.51%), Postives = 245/581 (42.17%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ-YFSV----SSKG----QIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVI---TVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I   + +IND  P F      +S+ EN  INS      AVD D  +          SQ  F +    + +G    Q+ +++ LD E    +++ V+  D  F   +   I   +V D ND  P F        I E  P    + Q+   D D    N K+       + N    +F   L++ T      +  +   DREET +    V+      +    + +   + + + D+NDN P      I      +V + EN P++ K+  +T TDKD   NG VT   D+         L  + S+   +     LD E    Y + ++A D G  P  Q  S  + I + D NDN+P F      + I EN  PG ++  + ATD D G N ++ + L P+    F      G L   K+ DRE  D+Y   I   D G  PL+   TV ++I+D NDN P  +F   H +Y +     + +   T+ L               +D D G+N+A    +S+ ++ D F+ID Q G++R      +E    Y   +  ED G+ S+  S K+ + + D+
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADI-GENAKIHFSFSNLVSNIARRLFH--LNATTGL----ITIKEPLDREETPNHKLLVL-----ASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFR----LRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQ--SAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSP--VF--THNEYNFYVPENLPRHG-TVGL------------ITVTDPDYGDNSA--VTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDV 666          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|Q6WXV7|PC11X_PONPY (Protocadherin-11 X-linked OS=Pongo pygmaeus OX=9600 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.699e-64
Identity = 230/808 (28.47%), Postives = 373/808 (46.16%), Query Frame = 1
Query:  103 YIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLS---TQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCP-----DHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL--DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFSS----QYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEF-NANTKVVITVVDVNDEAPQFNL----NP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKIL 2451
            YIF  L+   +++   Q  +   Y I+E  P    IG + +D+ LS    + +   +  K+ Y+        + +    I  T   ID E+LC      +HC        Y V        +  ++++   ++D+NDN P F  + I  S+ E    +     L  A+D DV   +    Y+L    +I+    +     D  P L+++K LD E    Y + +   +     + +   + + V + ND  P FK+ + EVS+ EN P+ + + Q+ A D D  E+++I +  ++  S    + F + ++ G I +K PLD E T  H + V ASD     A   V++ V DVND  P  ++    NP      + E  P N  I  IT+ D+D++  NG+++C+    +  +     +P      F  ++ L T    D E T +   K++      A K PL  +  + + + D NDN P+F ++  +VSI ENN    ++ KV+ATD D G N  + Y +       PE   F +D  +G +T   KLDREKE  Y   I+AKD G  P   TS+ T+ ++IID NDNSP F   +    + EN      VG++  TD D GDN  +   +L + N++F   +  G ++    FDRE  + Y   ++  D G+   S +  V IN++DVNDN P  I P  +  Y  +  ST              +PG  + +  A D D G NA   + I   N  D+F+ID + G + +  K     +G + V +   D G+P  + S  I+
Sbjct:    8 YIFAVLLACVVFHSGAQEKN---YTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLTRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-------FYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPEN-SAINSKYTLPAAVDPDVGI-NGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADH-NGRVTCFTDHEIPFR----LRP-----VFSNQFLLETAAYLDYESTKEYAIKLLAAD---AGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLG--PDAPPE---FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPP--LTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSIL-DENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPST--------------NPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIV 768          

HSP 2 Score: 145.206 bits (365), Expect = 7.760e-34
Identity = 105/359 (29.25%), Postives = 175/359 (48.75%), Query Frame = 1
Query: 1423 TSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI-GP--KKLEIFENEKPGTEVGILIATDNDEGDNGKLL--------FKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            +ST  + +++ D NDN P+F++    VSI EN PV   V ++ ATD DIG N  + +   NL S N  + LF +++ +G +T    LDRE+   ++L+++A D G MP +      +     +V     ++I  P    + + EN    T++ ++  TD D   NG++         F+L P  +  F        L++A   D E+T  Y +++   D GK PL+ +  + I + D NDN P  +F                +  +T+ +    SPG ++ K  A+D D G NA  ++ +  P+ P  FS+D + G+L V +KL +E    Y   I+ +DNG P    +  + V I D
Sbjct:  230 SSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVS-NIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFL-------LETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAP--VF---------------TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLG-PDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIID 562          

HSP 3 Score: 122.479 bits (306), Expect = 8.034e-27
Identity = 152/581 (26.16%), Postives = 242/581 (41.65%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSKG---QIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVI---TVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I   + +IND  P F      +S+ EN  INS      AVD D      ++ E+      F              Q+ +++ LD E    +++ V+  D  F   +   I   +V D ND  P F        I E  P    + Q+   D D    N K+       + N    +F   L++ T      +  +   DREET +    V+      +    + +   + + + D+NDN P      I      +V + EN P++ K+  +T TDKD   NG VT   D+         L  + S+   +     LD E    Y + ++A D G  P  Q  S  + I + D NDN+P F      + I EN  PG ++  + ATD D G N ++ + L P+    F      G L   K+ DRE  D+Y   I   D G  PL+   TV ++I+D NDN P  +F   H +Y +     + +   T+ L               +D D G+N+A    +S+ ++ D F+ID Q G++R      +E    Y   +  ED G+ S+  S K+ + + D+
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADI-GENAKIHFSFSNLVSNIARRLFH--LNATTGL----ITIKEPLDREETPNHKLLVL-----ASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFR----LRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQ--SAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSP--VF--THNEYNFYVPENLPRHG-TVGL------------ITVTDPDYGDNSA--VTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDV 666          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A4S2KYT3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010451 PE=4 SV=1)

HSP 1 Score: 443.351 bits (1139), Expect = 1.943e-132
Identity = 331/963 (34.37%), Postives = 476/963 (49.43%), Query Frame = 1
Query:   88 SLFLLYIFQCLINLRLYYG--FTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQ--------MILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTG-EMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTF---LTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL-----DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKT--------------KLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIF---------KPP--------LDSKT-----FYGKYDLYTRVRFDREETXXXXXX----------XXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPK-------------QQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLL--------PNHNENF-------FYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKT-PLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQK-----ESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDP-----------DIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD-------ILRLEERSKRQKSEHWTKSNKFQX---XXXXXXXXXXXXXXXXXTVLCIIKPC 2616
            S  L+Y+       +L  G   +     I+YAIKENQP   RIGK+ ED+  + +        +I       + YR ++  +YF L  +TS L TK  IDLE LCP  C  G    QL L V VW       +I VE+ + DV+DN P F   L+   +  +KEVIY  GK +EL KAID+D+  E+  + Y+L     D+    DTF L   NDS  +LVL+K LDYER + Y   + A +SP   ++               +L I + V+NIND+EP F Q  Y V + E+  I + +  ++A D D +S I Y S + S+  F V + G++ L   LDFE  + +    +ASD EF A T++ ITV DVNDE P+F  NP   ++EE QP    +GQ+ I DRDS   NG+++C EP  L  +Q ++F          PP        +DS        Y ++ LYTR+ FDRE   +  +           +       AA  P TST+TI LT+ D NDN P FEK  Y   ++EN PV  KVI+V A D D   +    Y +  LR+     S F ++S++GW+  +  +DRE ++ YQL ++A D G +P+             Q T++  + I I+D NDN+P+F GP++  + EN+ P   +G L   D DEG N  + F +            N+ F         LT NGSL + +  DRE    YC ++ + D+  + PLS T T+C+ +LD+NDN P+  F +       ++N T  K       IT+ L+  E+PG+  L  EA D DEG NA   + I    D            D F +D Q G L + R L    IG Y + ++VED G PS    + I + I+D       +    ERS          +N+       I +S  SA L  + IS +LC+IKPC
Sbjct:    2 SKLLMYLLVLGSASQLISGDLLSAVQHRIRYAIKENQPENLRIGKLDEDLLQTPENENSELFSLIQSTKRSTLKYRLREPSNYFRLHESTSELSTKLSIDLEALCPRFCREGLSAAQLNLFVAVWYEERPFSVIHVEVTILDVDDNSPQFPSTLSRPYVLQLKEVIYKAGKQVELPKAIDKDIQPENAEIQYRLQSHLDDSSHALDTFHLVTRNDSRVMLVLQKDLDYERVQQYRFYLVA-SSPVSEERRPFGYVLGPQSAFHDQLEIQVDVLNINDIEPVFSQSLYTVEIPEDTKIGTTVHVLQATDRDANSTIEY-SLENSNDLFQVQADGKVILTNKLDFEKRNKYTFTARASDGEFYALTRLDITVTDVNDEPPEFVTNPPILKVEENQPSQTSVGQLLIVDRDSPEVNGRVTCHEPPTLAGRQPLLFFPETSSALPMPPGISLDGAIIDSSANPEHHVYQRFGLYTRMEFDRESDSNKHRSLIICTDGQDVLTSHTSTTAAIQPRTSTLTIMLTVTDQNDNAPFFEKTHYEAELQENCPVGTKVIQVHANDADSETHAKPQYHL--LRNAL-FTSPFDVESETGWIITSADIDRETQALYQLTVLAID-GHLPRTNHRNGQTNFRGQQHTATTHVQIKILDDNDNAPEFRGPRQFAVEENQAPSKWIGDLQVLDRDEGINRDVEFSMANLQSTAASEEQNKTFRVRSIAPIKLTNNGSLYTTEVLDREVQAHYCFEVAVKDKSPSKPLSSTDTICVRVLDINDNTPK--FVNIRGMSQDLNNRTDAKALEDLRDITVSLTFREAPGYCALIAEAEDSDEGRNALLRYTIKFDGDAMKPESVSHTPLDAFMMDTQSGRLMLTRTLSGNEIGAYPLTLVVEDGGIPSLKSEKDIYIIIEDGPPRGNWLFPESERSIASSVSAKDGNNEAHTILVVIGLSGVSAFLAAVLISAILCMIKPC 956          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A3R7CGZ3 (Protocadherin Fat 4 OS=Clonorchis sinensis OX=79923 GN=Fat4 PE=4 SV=1)

HSP 1 Score: 440.654 bits (1132), Expect = 2.239e-131
Identity = 324/935 (34.65%), Postives = 471/935 (50.37%), Query Frame = 1
Query:  166 IKYAIKENQPGQTRIGKISEDVPLSTQ--------MILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTG-EMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTF---LTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL-----DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKT--------------KLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIF---------KPP--------LDSKT-----FYGKYDLYTRVRFDREETXXXXXX----------XXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMP-------------KQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKL--LPN------HNENF-------FYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKT-PLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQK-----ESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDP-----------DIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD-------ILRLEER---SKRQKSEHWTKSNKFQXXXXXXXXXXXXXXXXXXTVLCIIKPC 2616
            I+YAIKENQP   RIGK+ ED+  + +        +I       + YR ++  +YF L  +TS L TK  IDLE LCP  C  G    QL L V VW       +I VE+ + DV+DN P F   ++   +  +KEVIY  GK +EL KAID+D+  E+  + Y+L     D+    DTF L   NDS  +LVL+K LDYER + Y   + A +SP   ++               +L I + V+NIND+EP F Q  Y V + E+  I + +  ++A D D +S I Y S + S+  F V + G++ L   LDFE  + +    +ASD EF A T++ ITV DVNDE P+F  NP   ++EE QP    +GQ+ I DRDS   NG+++C EP  L  +Q ++F          PP        +DS        Y ++ LYTRV FDRE   +  +           +        A  P TST+TI LT+ D NDN P FEK  Y   ++EN PV  KV++V A D D   +    Y +  LR+     S F ++S++GW+  +  +DRE ++ YQL ++A D G +P             +Q T++  + I I+D NDN+P+F GP++  + EN+ P   +G L   D DEG N  + F +  LP+       N+ F         LT NGSL + +  DRE    YC ++ + D+  + PLS T T+C+ +LD+NDN P+ +  +       ++N T  K       IT+ L+  E+PG+  L  EA D DEG NA   + I    D            D F +D Q G L + R L    +G Y + ++VED G PS    + I + I+D       +    ER   S     E   +++   + I +S  SA L  + IS +LC+IKPC
Sbjct:   30 IRYAIKENQPENLRIGKLDEDLLQTPENENSELFSLIQSTKRSTLKYRLREPSNYFRLHESTSELSTKVSIDLEALCPRFCRDGLSAAQLNLFVAVWYEERPFSVIHVEVTILDVDDNSPQFPPTISRPYVLQLKEVIYKAGKQVELPKAIDKDIQPENAEIQYRLQSHLDDSSHALDTFHLVTRNDSRVMLVLQKDLDYERVQQYRFYLVA-SSPVSEERRPFGYVLDPQSAFHDQLEIQVDVLNINDIEPVFSQSIYNVEIPEDAKIGTTVHVLQATDRDANSTIEY-SLENSNDLFKVQADGKVILINKLDFEKRNKYTFTARASDGEFYALTRLDITVTDVNDEPPEFVTNPPILKVEENQPSQTSVGQLLIVDRDSPEVNGRVTCHEPPTLAGRQPLLFFPETSNALPMPPGISLDGAIIDSSANPEHHVYQRFGLYTRVEFDRESDSNKHRSLIICTDGQDILTSHTSTNVAIQPRTSTLTILLTVTDQNDNAPFFEKTHYEAELQENCPVGTKVVQVHANDADSETHAKPQYHL--LRNAL-FTSPFDVESETGWIITSADIDRETQALYQLTVLAID-GHLPGTNHRNGRSNFRGQQHTATTHVQIKILDDNDNAPEFRGPRQFAVEENQAPSKWIGDLQVLDRDEGINRDVEFSMANLPSTAASEEQNKTFRVRSVIPIKLTNNGSLYTTEVLDREIQAHYCFEVVVKDKSPSKPLSSTDTICVRVLDLNDNTPKFV--NIRGMSQDLNNRTDAKAFEDLRDITVSLTFREAPGYCALIAEAEDSDEGRNALLRYTIKFDGDTMKTESVAHTPLDAFMMDAQSGRLMLTRTLSGNELGAYPLTLVVEDGGSPSLKSEKNIYIIIEDGPPRGNWLFPENERSIASSMSAKEGNNEAHTILVVIGLSGVSAFLAAVLISAILCMIKPC 956          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A068YEP3 (Protocadherin gamma OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000828800 PE=4 SV=1)

HSP 1 Score: 436.802 bits (1122), Expect = 3.748e-130
Identity = 312/916 (34.06%), Postives = 474/916 (51.75%), Query Frame = 1
Query:   97 LLYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSE---------KINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDN---VPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFM----LKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSP--ADNQKT-----KLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFS-----SQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDS--KTFYG------KYDLYTRVRFDREETXXXXXXXXXXXXXGAAKN---------------------PLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMP-------KQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLL----------PNHNENF-FYLTINGSLQSAKEFDRETTDRYCLQIEINDQ-GKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQK------ESI------------TIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPND-------------------------------PDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            LL++F  +  L L  G  Q    + YA++EN+P   R+G + ED  L  Q +L N S+          + +R ++   +  LD  T++L TK++ID E+LC   C +     L + VNVW    L   I V I V DV+DN    P  +    +  +KEVIY  GK++EL +A+DRDV+ + +++TY+L+      T M    L VTNDS P+LVLK+ LDYE  K Y  ++ A+N    AD+ KT     +LS+ I+V+NINDMEP F Q  Y V V E++    +II+++A+D D D+ +TY S + S     S  F V   G++ L+   DFE  + + + ++ASD +F A+T++ I ++D+NDEAP F +NP+   +EE QP NIIIGQ+ + D D+ A NG L C EP     +Q + F+  ++S   T          +DLYTR   DREE        ++  D G   +                      LTST+TIS+ + D NDN PIF ++ ++  +EENN +  +++++T+ D D   N +  Y    L   N + SLF ++ D+G + A    DRE    Y L +VA D    P        Q  S+  + + I DVND++P      +L + EN++PG  VG ++ATD D G NG++ F ++          P H + F F +T NGS+ S ++FDRET  RYC Q++  D+  +  LS T  VC+NILDVNDN P +I     P   +  ++ VQ       E+I            ++ +S+ E+PG+  L  +A DLDEGENA   + ++L  +                               P  F ID + G L + R+L  + +G Y + ++VED G P     Q I + I+D+
Sbjct:    4 LLFLFSSVFLLSLSKG-EQLQFQLHYAVRENEPSGHRVGYLDED--LRRQQVL-NFSQLCGGGGGCKDLRFRLREPSFHLELDETTALLTTKSIIDFEKLCIGQCRSTLDAHLSVTVNVWQERKLTAFIHVRIQVIDVDDNSVEFPEDIPRPFILCLKEVIYRKGKTIELPRAVDRDVTPKFSSITYRLEFATSQWTSMKMVELSVTNDSRPLLVLKEDLDYEDVKEYGFSLVAYNPSLQADSPKTVVQEAQLSVVIQVLNINDMEPVFPQSVYTVEVPEDIQPGMVIIELKAIDRDADAVLTY-SINSSPGMNLSTPFEVEPDGKVRLRERFDFEQRTDYNLPIRASDGDFAASTRLHIHLLDINDEAPTFIVNPTHLTVEENQPPNIIIGQVVVRDADTFAVNGYLECAEPPEDAERQPLRFERRVESVQSTLESTAVPELHFDLYTRHSLDREEGAAVRLARLVCWDGGGGDSGAEADEVLYGERSTATAGRSVSLTSTLTISIHVQDKNDNAPIFTQSTFAADLEENNDIRKEILQLTSKDYDTEENAITRY---RLTDENEDASLFYLNEDTGHLYAMAHFDRETRDTYHLQVVAYDASQNPLEIPGADHQSISTAMVIVRITDVNDHAPLIQETGELILPENKEPGFLVGQVVATDLDTGVNGEVTFDIVPADPRAVFNGPQHTQVFGFRMTPNGSIFSTRQFDRETQSRYCFQVQAKDKSSEASLSSTTRVCVNILDVNDNSP-IIHSIEGPDARYERDALVQTPPLVGMETIETQHSLASYELPSLRISMNEAPGYCTLLIQAVDLDEGENAELRYSLNLAANCTPSSMPTSRFGHNVEKERKENAEREFRQFSPHTFRIDERTGKLLLVRRLSNKELGSYCLGLVVEDQGHPPLKSIQLIELVIEDV 910          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A075A251 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_00457 PE=4 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 9.516e-129
Identity = 316/934 (33.83%), Postives = 462/934 (49.46%), Query Frame = 1
Query:  166 IKYAIKENQPGQTRIGKISEDVPLSTQ--------MILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTG-EMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTF---LTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL-----DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKT-------------KLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKT----------------------FYGKYDLYTRVRFDREETXXXXXXX----------XXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPK-------------QQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLL--------PNHNENF-------FYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKT-PLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQK-----ESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDP-----------DIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD-------ILRLEERSKRQKSEHWTKSNKFQX---XXXXXXXXXXXXXXXXXTVLCIIKPC 2616
            I+YAIKENQP   RIGK+ ED+  + +        ++       + YR ++  +YF L  +TS L TK  IDLE LCP  C  G    QL L V VW       +I VE+ + DV+DN P F   L+   +  +KEVIY  GK +EL KAID+D+  E+  + Y+L     D+    DTF L + NDS  +LVL+K LDYER + Y   + A +  +D ++              +L I + V+NIND+EP F Q  Y + + E+  I +++  ++A D D +S I Y S + S++ F V + G++ +   LDFE  + +    +ASD EF A T++ ITV DVNDE P+F  NP   ++EE QP    +GQ+ I DRDS   NG+++C EP  L  +Q ++F P   S                         Y ++ LYTRV FDRE   +  + +                  A  P TST+TI LT+ D NDN P FEK  Y   ++EN P   KV++V A D D   +    Y +  LR+     S F ++ ++GW+  +  +DRE ++ YQL ++A D G +P+             Q T++  + I IID NDN+P+F GP++  + EN+     +G L   D DEG N  + F +            N+ F         LT NGSL + +  DRE    YC ++ + D+  + PLS T T+C+ +LD+NDN P+ +  +       + N T  K       IT+ L+  E+PG+  L  EA D DEG NA   + I    D            D F +D Q G L + R L    IG Y + ++VED G PS    + I + I+D       +    ERS          +N+       I +S  SA L  + IS +LC+IKPC
Sbjct:   30 IRYAIKENQPENLRIGKLDEDLLQTPENENSELFSLLQSTKRSTLKYRLREPSNYFRLHESTSELSTKVSIDLEALCPRFCREGLSAAQLNLFVAVWYEERPFSVIHVEVTILDVDDNSPQFPPTLSRPYVLQLKEVIYKAGKQVELPKAIDKDIQPENAEIQYRLQSHLDDSSHALDTFHLVIRNDSRVMLVLQKDLDYERVQQYRFYLVASSPVSDERRPFGYVLDPQSAFHDQLEIQVDVLNINDIEPVFSQSTYNIEIPEDTKIGTIVHVLQATDRDANSTIEY-SLENSNELFKVQADGKVIITNKLDFEKRNKYTFTARASDGEFYALTRLDITVTDVNDEPPEFVTNPPILKVEENQPSQTSVGQLLIVDRDSPEVNGRVTCHEPPTLAGRQPLLFFPETSSALPMSPGISLDGAIIDSSANPEHHVYQRFGLYTRVEFDRESDSNKHRSLIICTDGQDIPNSHASTSVAIQPRTSTLTILLTVTDQNDNAPFFEKTHYEAELQENCPFGTKVVQVHANDADSETHAKPQYHL--LRNAL-FTSPFDVEPETGWIITSADIDRETQALYQLTVLAID-GHLPRTNNRNGRTNFRGQQHTATTHVQIKIIDDNDNAPEFRGPRQFAVEENQVSSKWIGDLQVLDRDEGINRDVEFSMANFQSTIASEEQNKTFRVRSIAPIKLTNNGSLYTTEMLDREIQAHYCFEVVVKDKSPSKPLSSTDTICVRVLDLNDNTPKFV--NIRGMSQDLSNRTDVKAFEDLRDITVSLTFREAPGYCALIAEAEDSDEGRNALLRYTIKFDGDTMKPESVSHTPLDAFMMDAQSGRLMLTRTLSGNEIGAYPLTLVVEDGGSPSLKSEKNIYIIIEDGPPRGNWLFPENERSVASSMSAKDGNNEAHTILVVIGLSGVSAFLAAVLISAILCMIKPC 956          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A068WBV3 (Protocadherin gamma c4 OS=Echinococcus granulosus OX=6210 GN=EgrG_000828800 PE=4 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 3.535e-126
Identity = 307/915 (33.55%), Postives = 463/915 (50.60%), Query Frame = 1
Query:   88 SLFLLYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLS------EKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDN---VPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFM----LKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSP--ADNQKT-----KLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYR--SADFS--SQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDS--KTFYG------KYDLYTRVRFDREETXXXXXXXXXXXXXGAAKN---------------------PLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMP-------KQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPN----------HNENF-FYLTINGSLQSAKEFDRETTDRYCLQIEINDQ-GKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQ------------------KESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPND-------------------------------PDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
             LFLL  F  +  L L  G  Q    + YA++EN+P   R+G + ED+     +    L       + + +R ++   +  LD  T++L TK++ID E+LC   C +     L + VNVW    L   I V I V DV+DN    P  +    +  +KEVIY  GK++EL +A+DRDV+ + +++TY+L+        M    L VTNDS P+LVLK+ LDYE  K Y  ++ A N    AD+ KT     +LS+ I+V+NINDMEP F Q  Y V V E++    +II+++A+D D D+ +TY   SA     S  F V   G++ L+   DFE  + + + ++ASD +F A+T++ I ++D+NDEAP F +NP+   +EE QP NIIIGQ+ + D D+ A NG L C EP     +Q + F+  ++S   T          +DLYTR   DREE        ++  D G   +                      LTST+TIS+ + D NDN PIF ++ ++  +EENN +  +++++T+ D D   N +  Y    L   N + SLF ++ D+G + A    DRE    Y L +VA D    P        Q  S+  + + I DVND++P      +L + EN++P   VG ++ATD D G NG++ F ++P           H +   F +T NGS+ S ++FDRET  RYC Q++  D+  +  LS T  VC+NILDVNDN P +I     P   +  +S VQ                   E  ++ +S+ E+PG+  L  +A DLDEGENA   + + L  +                               P  F ID + G L + R+L  + +G Y + ++VED G P     Q I + I+D+
Sbjct:    3 GLFLL--FSSIFLLSLSKG-EQLQFQLHYAVRENEPSGHRVGYLDEDLRRQQSLNFSQLCGGGGGCKDLRFRLREPSFHLELDETTALLTTKSIIDFEQLCIGQCRSTLDAYLSVTVNVWQERKLTAFIHVRIQVIDVDDNSVEFPGDIPRPFILCLKEVIYRKGKTIELPRAVDRDVTPKFSSITYRLEFATSQWASMKMVELSVTNDSRPLLVLKEDLDYEDVKEYGFSLVACNPSLQADSPKTVVQEAQLSVVIQVLNINDMEPVFPQSVYTVEVPEDIQPGMVIIELKAIDRDADAVLTYSINSAPGMNLSTPFEVEPDGKVRLRERFDFEQCTDYNLPIRASDGDFTASTRLHIHLLDINDEAPTFIVNPTHLTVEENQPPNIIIGQVVVRDADTFAVNGYLECAEPPEDAERQPLRFERRVESVQSTLESTAVPELHFDLYTRHSLDREEGAAVRLARLVCWDGGGGDSGAEADEVLYGDRSTATAGRSVSLTSTLTISIHVQDKNDNAPIFTQSTFAADLEENNGIRKEILQLTSKDYDTEENAITRY---RLTDENADASLFYLNEDTGHLYAMAHFDRETRDTYHLQVVAYDASQNPLEIPGTDHQSISTAMVIVRITDVNDHAPLIQETGELILPENKEPDFLVGQVVATDLDTGVNGEVTFDIVPTDPRAVFNGPQHTQVIGFRMTPNGSIFSTRQFDRETQSRYCFQVQAKDKSSEASLSSTARVCVNILDVNDNSP-IIHSIEGPDARYERDSLVQTPPLVGMETIETQYSLASHELPSLRISMNEAPGYCALLIQAVDLDEGENAELRYSLKLAANCTPPSMPTSRFGHNLEKERKENAEREFRQFSPHTFRIDERTGKLLLVRRLSDKELGSYCLGLVVEDQGHPPLKSIQLIELVIEDV 910          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 259.225 bits (661), Expect = 1.094e-71
Identity = 229/784 (29.21%), Postives = 371/784 (47.32%), Query Frame = 1
Query:  172 YAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVW----DGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVT----NDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASD-NEFNANTKVVITVVDVNDEAPQFNL----NPS--FCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
            Y I+E       IG I +D+ +S        S  + YR   +        V+ +   I  T   ID E+LCP   P+ E  +    + V     D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D+    N+V YK +       F L +      + +P L++++ LD E+   Y + I   +  +  + +   + + V ++ND  P FK+ + EV + E+ P+ + ++Q++A D D   ++EI Y    + +  + + F++ S+ G I ++RPLD E T+ H + V ASD +  +A   V I V DVND AP  +L    +P+     + E  P N  I  IT+ D+D++  NGK+ C+  +++          P   K  Y  +Y L T    D E T + + K++      + K  L  T  + + + D NDN PIF + V  +++ ENN  D  +  +TATD+D GRN  + Y+      + P  S F +D  +G +TA+   DRE +  +   + A+D GT   Q  S   + +TI+D NDNSPKF     +  + EN    + VG++  TD D G+N  +   +L N NENF      G ++S   FDRE    Y   +   D G  P S    V IN++DVNDNPP +I+P  +  +  +  S +              PG  + +  A D D G NA   + I   N+  +F IDP  G + ++ K  +   G + + + + D G P  +H+
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPG--PSYEDSECSFEIEVVILPNDYFRL---IKIKIVVKDTNDNAPMFPSPVINISIPENTL-INSRFAIPSATDPDMGP--NSV-YKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDV-NGKVICFIEKDV----------PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQ------LGPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQ--SQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSIL-NDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYPKSLHT 765          

HSP 2 Score: 126.331 bits (316), Expect = 5.334e-29
Identity = 155/583 (26.59%), Postives = 250/583 (42.88%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ-YFSV----SSKG----QIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      Y+    + Q  F +    + +G    Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F  +     I E  P    + Q+   D D   AN ++       +      +F   L+S T      L T  R  DREET +    V+      ++     +  T+++ + D+NDN P      I      +V + E +PV+ K+  +T +DKD   NG V   I+      P     V D+     T+ L LD E    Y   IVA D G     QT+   + + + D NDN P F  P  +L + EN K    +  + ATD D G N +++++L PN   +FF L    G L +++ FDRE  +R+   +   D G   L     V + ILD NDN P+      H  + +          ++ +L  Y + G        +D D GENA     +S+ ND + F +DP  G+++      +E    Y   +   D+G P    + K+ + + D+
Sbjct:  125 IKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADV-GANAEIKYMFGTQVSPATRRLFA--LNSTT-----GLITVQRPLDREETANHKLSVLASDGSSSS-----ARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDV---PFHLKAVYDNQYLLETSAL-LDYEGTKEYIFKIVASDSGKPSLNQTA--LVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPN--ASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDADAGENAVV--SLSILNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDV 667          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 259.225 bits (661), Expect = 1.442e-71
Identity = 229/784 (29.21%), Postives = 371/784 (47.32%), Query Frame = 1
Query:  172 YAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVW----DGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVT----NDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASD-NEFNANTKVVITVVDVNDEAPQFNL----NPS--FCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
            Y I+E       IG I +D+ +S        S  + YR   +        V+ +   I  T   ID E+LCP   P+ E  +    + V     D   L   I+++I V+D NDN P F +  I  S+ E    +     +  A D D+    N+V YK +       F L +      + +P L++++ LD E+   Y + I   +  +  + +   + + V ++ND  P FK+ + EV + E+ P+ + ++Q++A D D   ++EI Y    + +  + + F++ S+ G I ++RPLD E T+ H + V ASD +  +A   V I V DVND AP  +L    +P+     + E  P N  I  IT+ D+D++  NGK+ C+  +++          P   K  Y  +Y L T    D E T + + K++      + K  L  T  + + + D NDN PIF + V  +++ ENN  D  +  +TATD+D GRN  + Y+      + P  S F +D  +G +TA+   DRE +  +   + A+D GT   Q  S   + +TI+D NDNSPKF     +  + EN    + VG++  TD D G+N  +   +L N NENF      G ++S   FDRE    Y   +   D G  P S    V IN++DVNDNPP +I+P  +  +  +  S +              PG  + +  A D D G NA   + I   N+  +F IDP  G + ++ K  +   G + + + + D G P  +H+
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPG--PSYEDSECSFEIEVVILPNDYFRL---IKIKIVVKDTNDNAPMFPSPVINISIPENTL-INSRFAIPSATDPDMGP--NSV-YKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDV-NGKVICFIEKDV----------PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQ------LGPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQ--SQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSIL-NDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAI--------------PGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYPKSLHT 765          

HSP 2 Score: 126.331 bits (316), Expect = 5.193e-29
Identity = 155/583 (26.59%), Postives = 250/583 (42.88%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ-YFSV----SSKG----QIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      Y+    + Q  F +    + +G    Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F  +     I E  P    + Q+   D D   AN ++       +      +F   L+S T      L T  R  DREET +    V+      ++     +  T+++ + D+NDN P      I      +V + E +PV+ K+  +T +DKD   NG V   I+      P     V D+     T+ L LD E    Y   IVA D G     QT+   + + + D NDN P F  P  +L + EN K    +  + ATD D G N +++++L PN   +FF L    G L +++ FDRE  +R+   +   D G   L     V + ILD NDN P+      H  + +          ++ +L  Y + G        +D D GENA     +S+ ND + F +DP  G+++      +E    Y   +   D+G P    + K+ + + D+
Sbjct:  125 IKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADV-GANAEIKYMFGTQVSPATRRLFA--LNSTT-----GLITVQRPLDREETANHKLSVLASDGSSSS-----ARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDV---PFHLKAVYDNQYLLETSAL-LDYEGTKEYIFKIVASDSGKPSLNQTA--LVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPN--ASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDADAGENAVV--SLSILNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDV 667          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 238.81 bits (608), Expect = 7.071e-65
Identity = 230/780 (29.49%), Postives = 361/780 (46.28%), Query Frame = 1
Query:  166 IKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTS-ILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKG--IIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADI-YSDTFMLKVTND---SFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY---RSADFSSQYFSVS-SKGQIFLKRPLDFETTS---LHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCR--------IEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSK 2430
            I Y ++E QP  T IG ++ D  L     L        Y+ +    Y  +D  T  I  T+  ID E L  D    G+   L   V+V D +  +   +I   I VQD+NDN P F +  +  SV+E  + +G +  + +A DRD  + +  + Y L A    S  F L++ ND     P L++   LD E    Y+L I A +    ++ +   + + + + ND  P+F++  YE  V EN P+   ++QV+A D D   + EI Y   +++D   +   +  S G I +K PLD E  S    H+I      +  ++ T V I V D ND AP   +     R        I E  P    +  + + D+D E  N  ++C    ++  +        +D+K    KY L T    D E   D   +++ V     A   L+ST ++ + + D NDN+PIF   ++ V   E N    KV+ V A D D G N  + Y I    S    + LF ID  SG V A   LDRE +  Y+  + A DKG    + T++    I ++D NDN PKF +      + EN  P + VG++   D D+G+N ++   + P+   NF      G++ S+  FDRE    Y  +++  D G+ P S    V IN+LD NDN P +  P          NS+ ++      LS   +P   +   EA D+D G NA   + I+  N  ++F I P  G +++ ++L ++  G + + + V D GKPS+
Sbjct:   25 ILYHVREEQPPNTLIGSLAADQGLPDSGHL--------YKLEVGAPYLRVDGKTGEIFTTEIPIDRETLK-DCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAH-MGATFAIPQATDRDTER-NGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKD-EGENAVVTCVVAGDVPFQLRPAGDSSVDNKK---KYFLQTTTPLDYERIRDYRVEIVAVDSGNPA---LSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSST---RGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATV--VIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVG-NFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKP---------SNSSFRR------LSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSR 765          

HSP 2 Score: 130.954 bits (328), Expect = 1.945e-30
Identity = 148/578 (25.61%), Postives = 244/578 (42.21%), Query Frame = 1
Query:  859 VEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFSVSSK-GQIFLKR-PLDFETTSLHLI---------DVQASDNEFNANTKVV---ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKL-----SCWEPRNLYNKQAVIFKP-PLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTS--SCXXXXXXXXXXXXSPKFIGPKK-----LEIFENEKPGTEVGILIATDNDEGDN--------GKLLFKLLP------NHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFR-ISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            V E  P N++I  + A     DS   Y+  +  + Y  V  K G+IF    P+D ET     I         +V  +D   N + +++   I V D+ND  PQF        ++E              DRD+E  NG L     +  E   L++ Q    +   L      G  D   +  +D          + I   DG   +  +S + + + I D NDN P FEK+ Y   + EN+PV   V++V A D D+G NG + Y I   ++ +P   +  I+  +G ++    LDRE+ S ++  ++A+DKG  PK  T+  S  +     +      + IG +        I E+   GT V ++  +D DEG+N        G + F+L P      ++ + +F       LQ+    D E    Y ++I   D G   LS T+++ + + D NDN P    P +                  ++ +    PG ++L   A D D G NA   +  I+  +   +F IDP  G +R +  L +E    Y  ++   D G PS   +  +++++ D
Sbjct:   29 VREEQPPNTLIGSLAADQGLPDSGHLYK-LEVGAPYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTER-NGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYD----------LTINAVDGGTPSRYSSAL-LRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIH--QASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYF-------LQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFE-----------------VEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLD 567          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 239.965 bits (611), Expect = 1.092e-64
Identity = 231/781 (29.58%), Postives = 359/781 (45.97%), Query Frame = 1
Query:  166 IKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTS-ILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKG--IIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADI-YSDTFMLKVTND---SFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY---RSADFSSQYFSVS-SKGQIFLKRPLDFETTS---LHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCR--------IEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKT-FYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSK 2430
            I Y ++E QP  T IG ++ D  L     L        Y+ +    Y  +D  T  I  T+  ID E L  D    G+   L   V+V D +  +   +I   I VQD+NDN P F +  +  SV+E  + +G +  + +A DRD  + +  + Y L A    S  F L++ ND     P L++   LD E    Y+L I A +    ++ +   + + + + ND  P+F++  YE  V EN P+   ++QV+A D D   + EI Y   +++D   +   +  S G I +K PLD E  S    H+I      +  ++ T V I V D ND AP   +     R        I E  P    +  + + D+D E  N  ++C     +        +P  DS      KY L T    D E   D   +++ V     A   L+ST ++ + + D NDN+PIF   ++ V   E N    KV+ V A D D G N  + Y I    S    + LF ID  SG V A   LDRE +  Y+  + A DKG    + T++    I ++D NDN PKF +      + EN  P + VG++   D D+G+N ++   + P+   NF      G++ S+  FDRE    Y  +++  D G+ P S    V IN+LD NDN P +  P          NS+ ++      LS   +P   +   EA D+D G NA   + I+  N  ++F I P  G +++ ++L ++  G + + + V D GKPS+
Sbjct:   61 ILYHVREEQPPNTLIGSLAADQGLPDSGHL--------YKLEVGAPYLRVDGKTGEIFTTEIPIDRETLK-DCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAH-MGATFAIPQATDRDTER-NGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKD-EGENAVVTCV----VAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPA---LSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSST---RGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATV--VIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVG-NFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKP---------SNSSFRR------LSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSR 801          

HSP 2 Score: 130.568 bits (327), Expect = 2.942e-30
Identity = 149/578 (25.78%), Postives = 244/578 (42.21%), Query Frame = 1
Query:  859 VEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFSVSSK-GQIFLKR-PLDFETTSLHLI---------DVQASDNEFNANTKVV---ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKL-----SCWEPRNLYNKQ-AVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTS--SCXXXXXXXXXXXXSPKFIGPKK-----LEIFENEKPGTEVGILIATDNDEGDN--------GKLLFKLLP------NHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFR-ISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            V E  P N++I  + A     DS   Y+  +  + Y  V  K G+IF    P+D ET     I         +V  +D   N + +++   I V D+ND  PQF        ++E              DRD+E  NG L     +  E   L++ Q A      L      G  D   +  +D          + I   DG   +  +S + + + I D NDN P FEK+ Y   + EN+PV   V++V A D D+G NG + Y I   ++ +P   +  I+  +G ++    LDRE+ S ++  ++A+DKG  PK  T+  S  +     +      + IG +        I E+   GT V ++  +D DEG+N        G + F+L P      ++ + +F       LQ+    D E    Y ++I   D G   LS T+++ + + D NDN P    P +                  ++ +    PG ++L   A D D G NA   +  I+  +   +F IDP  G +R +  L +E    Y  ++   D G PS   +  +++++ D
Sbjct:   65 VREEQPPNTLIGSLAADQGLPDSGHLYK-LEVGAPYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTER-NGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYD----------LTINAVDGGTPSRYSSAL-LRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIH--QASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYF-------LQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFE-----------------VEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLD 603          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 236.884 bits (603), Expect = 4.359e-64
Identity = 227/808 (28.09%), Postives = 372/808 (46.04%), Query Frame = 1
Query:   97 LLYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILR---NLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGL---SLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVT----NDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ-------YFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFN----LNP--SFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEK-SLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
            L+ I  CL++L     + Q  D   Y +KE QP   RIG +  D+ L+    ++    L  K  Y+        V  S   I  T   ID E LC     +G   +      +   +    +  ++++   ++D+NDN P F ++ I  S+ E    +     +  A D DV   +    Y+L   +    F L +      D +P L++++ LD E    + + I   +     + +   + + V ++ND  P FK  + EV+V EN P+ + + Q+ A D D  S      + FS+Q       +F++ SS G I +K+PLD E+  +H + V ASD     +   V++ V DVND  P  +    +NP      + E  P N  I  IT+ DRD++  NGK++C+   ++  +     KP      F  ++ L T    D E T +   K++      + K PL ++  + + I D NDN P+F +    +SI ENN    ++IK+TATD D G N L+ Y      S+ P+    F ID  SG ++ + +LDREK+  Y   ++A+D G+ P Q  S+ T+ + + D NDNSP F   +    + EN      VG++  TD D GDN  +   ++ N  +NF      G ++    FDRE    Y   ++  D G    +    V IN++DVNDN P  + P  +  Y  +  +T              +PG  + +  A D D G NA   + I   +   +F+ID   G + ++ K+     G + + + V+D G+P  +HS
Sbjct:   50 LVLILTCLVSL----CWAQEKD---YTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLC-----SGVFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENT-AINNRYPVPSAFDPDVGI-NGIQHYELVKSVSE--FGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFS-FSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADL-NGKVTCYTDHDVPFR----LKP-----VFNDQFLLETAAPLDYETTREYAIKIVASD---SGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIY------SLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQ--SNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSII-NGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTT--------------NPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHS 804          

HSP 2 Score: 124.79 bits (312), Expect = 1.836e-28
Identity = 151/581 (25.99%), Postives = 245/581 (42.17%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED------EDSEITYRSADFSSQYFSVSSKG---QIFLKRPLDFETTSLHLIDVQASD--NEFNANTKVV-ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I   + +IND  P F+     +S+ EN  IN+      A D D      +  E+    ++F              Q+ +++ LD ET    ++ ++  D  N   ++T ++ +TV DVND  P F  +     + E  P    + Q+   D D   +N ++       +       F   +DS T      +  +   DRE        V+     G+A     S  T+ + + D+NDN P      I      +V + EN P++ K+  +T TD+D   NG VT   D+       K +F   +D   +     LD E    Y + IVA D G  P    +S  + I I D NDN+P F  P+ +L I EN  PGT++  + ATD D G N  +++ L P+  + F     +G L  +K  DRE  ++Y   +   D G  PL    TV + + D NDN P       H +Y +          +  +L +Y + G        +D D G+NA     +S+ N  D F IDP+ G+++      +E    Y   +   D+G        K+ + + D+
Sbjct:  163 VKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADL-GSNAQIHFSFSNQISPATKRHFA--IDSSTGL----ITVKQPLDRESNPVHKLIVLASD--GSAT---PSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFR-LKPVF---NDQFLLETAAPLDYETTREYAIKIVASDSGKPPLN--TSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFT----HAEYNFY---------VPENLPLYGTVGL----ITVTDADAGDNAI--VTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDV 706          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 215.312 bits (547), Expect = 6.839e-58
Identity = 210/736 (28.53%), Postives = 349/736 (47.42%), Query Frame = 1
Query:  352 IDLEELCPDHCPTGE--MGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL---DADIYSDTFMLKVT----NDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDS--EITYR---------SADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDN------------EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEK-SLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTI-NGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKIL 2451
            +D E LC    P  E  +     V+ V  G   K +I V INV+D+NDN P F    +  SV E     GK   +Q A D D S+ +    Y+L   D    S  F L VT     +  P LV++K+LD E  +LY + + A +  +        + I V + ND  P F Q +  V + EN P+ + ++Q+ A D D  S  E+ YR         S     + F +  + G + +   L+ E + ++ I + A+D                 +       +++ D     N       I E    N+ +  IT+ D D   ANG ++C+    +YN + V F+  L   T+  +Y L TR   D E T ++    I   D GA    L+ TM++++ + D NDN P+F +  Y VS+ ENN +   +I V+ATD+D+ +N  + Y       + P+  ++F +D ++G ++ T +LDREK++ Y   I+AKD+G +P  +  + T+ + ++DVNDN P+F +      + EN    + VG++   D+DEG+NG++   +L   N   F +   +G ++S   FDRE    Y L+++  D G+   S T  V I+++D+NDN P ++ P  +  Y ++   T+              PG  + +  A D D   NA   + I   N  ++F IDP IG + +   L +   G + + + V D G   + H+  ++
Sbjct:  102 MDREALCGGQDPGDECHVDVQVGVLPVQPGPFFK-LIEVRINVEDINDNAPAFAAPVLTVSVPENAPA-GKRFPIQPANDPD-SEANGVRRYELLPSDPATVS-AFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVN---GVIYISEASHVNLPVALITVSDPDI-GANGAVTCY----IYNPE-VPFQ--LKKLTYPNQYLLETRETLDYE-TKNEYVVQIKAADAGATS--LSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVY------FLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQG-IPVLE-GNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTL--------------PGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGIAVQHHAVALV 797          

HSP 2 Score: 98.9821 bits (245), Expect = 3.100e-21
Identity = 94/327 (28.75%), Postives = 149/327 (45.57%), Query Frame = 1
Query: 1501 VSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEK--SLFVIDSDSGWVTATLK-LDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I E + V+  V  +T +D DIG NG VT  I      NPE    L  +   + ++  T + LD E ++ Y + I A D G     +T S TI +   + N  +P F  P  K+ + EN   G  +  + ATD D   N ++++ L P+    F      G +   ++ DRE    Y   I   DQG   L    TV +N+LDVNDN PR    ++     +  N  V K S    +++             +D DEGEN      I   ++  +FSIDP+ G++R      +E    Y +++   D G+P +  + K+++ + DI
Sbjct:  393 IYISEASHVNLPVALITVSDPDIGANGAVTCYI-----YNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDN--APVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEF----DFYVNENVPKHSTVGMVTV-------------ADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDI 695          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 200.675 bits (509), Expect = 1.614e-52
Identity = 200/710 (28.17%), Postives = 327/710 (46.06%), Query Frame = 1
Query:  448 GIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFS--SQYFSVSSKGQ---IFLKRPLDFE-----TTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIW----DRDSEAANGKLSCWEPRNLYNKQAVI-FKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWV-TATLKLDREK------ESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIG-PKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWID-NSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDILRLEERSKR 2496
            G  RV I + + NDN P F       SV E    +G S+    A D D +     V+Y    D  SD F L   + +  ++ +  ALD+E    + + + A +     Q+T   + I ++++ND  P F++  Y  +  EN    + +++V A DED   +++ITY     S  S YFS++  G    + L R LD+E     T SL ++ +       N+    ++ V D ND +P F+ N     I    PENI+ G   ++    D D     G+LS      +Y+ +    F+  +++++     D+ +    DRE     +  V  V   G   +  T   T+++T+ D+NDN P +    Y+V+I EN P    +  V+A D D+  NG + Y ID      P    + I++ SG + T  L+LDRE        S   +++   D+G+ P++ T+S T+ + + DVNDN P F+G P  L++ E     + +  + ATD DEG NG + + +        F L    G + +  + DRE    Y L++   D+G   LS T T+ + +LDVNDN P      +HP  + +    +V ++S+ I            L C  +D D G NA   F I+  N    FS+  + G++R    L +E    Y++ I   DNG      S++      D+L L+    R
Sbjct:   12 GSARVHITLINENDNRPIFSLPLYNVSVWENAT-LGTSVVQVLATDLD-AGVFGQVSYHFSDD--SDKFSL---DPASGLISVAAALDFEATPRFTVTVMARD--GGGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAI----PENILAGATVLYVNATDGDQSPEYGQLSL-----IYSLEGSTQFR--INARSG----DITSTTLLDREAVSQYILIVRAVDG-GDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAID------PPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPT-----FHPARSAVSLMESVARDSVVIS-----------LNC--TDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAG---SRRTGTTTLDVLVLDVNDNR 669          

HSP 2 Score: 191.815 bits (486), Expect = 1.110e-49
Identity = 207/784 (26.40%), Postives = 354/784 (45.15%), Query Frame = 1
Query:  271 KINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYK-LDADIYSDTFMLKVTNDSFPILVLKKALDYERC--KLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFS---SQYFSVSSK-GQIFLKRPLDFETTSLHLIDVQASDNEFNANTK-----VVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREET-----XXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTI-NGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCIN--ILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYE--SPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGIL-RVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDILRLEERSKR-----QKSEHWTKSNKFQ 2535
            +++Y F      F LD  + ++     +D E             +  + V   DG   +   RV IN+ DVNDN P F   S + + +E    +   + + +A D D S  +N +TY  L    YS  F + V+   + ++ L +ALDYE+      +L I A +  +    + ++  + V + ND  P F +  Y +++ EN+   + ++ V A D D+  E    S  +S   S  F ++++ G I     LD E  S +++ V+A D     + K     V IT++DVND  P +   P    I E  P    I  ++  D D       +   +P N + +               GK    T ++ DRE+            V+   D G+     T++ T+++ + D+NDN P F    Y++ + E  P ++ + +VTATD D G NG VTY   ++ +  P    F +D+ +G +T  ++LDRE  + YQL +VA D+GT     +S+ T+++ ++DVNDN+P F   +  + + E+    + V  L  TD D G N +L F +   + +  F +   +G +++    DRET   Y L IE  D G      T T  ++  +LDVNDN P  +   Y                   ++S+ E  + G  IL+ +A+D+DEG N    +RI   N    F ++   G++ R    L +E +  + +Q+   +N            V +  ++R+  R  R     + S H + S+ F+
Sbjct:   64 QVSYHFSDDSDKFSLDPASGLISVAAALDFEATP----------RFTVTVMARDGGGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRV-RATDED-SPPNNQITYSILPTSAYSSYFSITVSG-GYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRI----------NAASGKIRT-TGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTY---SMTAALPRPD-FQLDAATGLITTLVQLDREAVAAYQLRLVATDRGT--PALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSY-------------------EVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLISRGATPLDRETVALHALQVEAFNNDS----------VGLSSVIRVRSRWGRWGLITRPSHHTSISSPFK 788          

HSP 3 Score: 162.155 bits (409), Expect = 1.953e-40
Identity = 182/728 (25.00%), Postives = 313/728 (42.99%), Query Frame = 1
Query:  400 GQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSK-EHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFS---------------VSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVV---------ITVVDVNDEAPQFNL-NPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIF-EKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLR----SMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAA-----FHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS-QKILVRIQDI 2469
            G+L L + V DG      +R+ + V DVNDN PTF  +S    V E    VG S+ + KA+DRD+   +  TV Y + A   +DTF +   ++S  ++V    +DYE    Y L + A +           + + + N  D +  F    Y+ ++ E     +++++V A       ++    A    ++                  + +G+I  +  LD E T  +++ V + D        V+         + V D ND +P+F   + +   + E      ++  +   DRD+  +NG +S     +   +    +   + +++     D+    + D  E         IV  DG +  P ++T  +S+ + D+NDN PIF     Y+VS+ E       V  V ATD D G NG VT+ I++      S+ P   +         V     +DRE  + Y L++VA D+G  P   + S  + + + DVND  P F+ P + + + E+   G+ V  + AT+N +G N K  +K+       F     +G + S +    ++ +R+ L     D G+ PL     + + +LDVND+ P  + P   P  T ++ + V    I             I++  A D DEG+N A      H       D + F I+   GI+   R L +E    Y++ ++  D G+P    S Q + V + DI
Sbjct: 1576 GRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSI-ASGGNDTFGI---DESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDA-GSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDV---AKADFVEKTSQFILFRIVALDGGSP-PRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGII-------RVAPGANIDRETRAAYTLMVVAVDRGNPP--LSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLL--KSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLP---PNGTVVNITEVMPVVI------------RIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDI 2268          

HSP 4 Score: 127.102 bits (318), Expect = 1.167e-29
Identity = 108/349 (30.95%), Postives = 171/349 (49.00%), Query Frame = 1
Query: 1411 KNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEEN-NPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDRE-KESFYQLIIVAKDKGTMPKQQ-TSSCXXXXXXXXXXXXSPKFI----GPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLT-INGSLQSAK--EFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLI-FPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAF---HFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDN 2415
              P  +T ++ + I D NDN P F  A Y V + E  +     V  VTA+D D G N  V Y I +  +     + F ID+ +G +TA   LD E     Y L++ A D+   P ++ TS+ T+++ + DVND +P F+    GP  +++ E + PG  +   +A+D D G NG+L + ++     N F ++  +G L+  +  E DRET   Y L I   D G  PL+ T TV + +LDV+DN P  +  P          N+++ + +  + +         + +  ASD +EG N A    H   S  N    F  D Q G++ V R L +E + +Y + + V DN
Sbjct: 1149 ATPAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNT----AATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGP--IDVSEGQ-PGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLP---------ANASLSEAAAVLAI---------VSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDN 1472          

HSP 5 Score: 123.25 bits (308), Expect = 1.783e-28
Identity = 168/600 (28.00%), Postives = 257/600 (42.83%), Query Frame = 1
Query:  763 ADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQ-VEAVDEDE--DSEITYR--SADFSSQYFSVSSKGQIFLKRPLDFETTS-LHLIDVQASDN------EFNANTKVVITVVDVNDEAPQFNLN-PSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSC----WEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPK-QQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGIL----IATDNDEGDNGKLLFKLLPNHNENFFYLTING--SLQSAKEFDRET--TDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESP--GFEILKCEASDLDEGENAAFHFRISLPNDP-DIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDIL 2472
            A   +   S+ IR+ + ND  P F    YEV + E      + +  V A D DE  ++ + Y   S + ++ +   +  G +   + LDFE ++ L+L+ V A+D          +   V + V DVND  P F  +      + EGQP    I      D+DS   NG+L       +PRN +         P D      +Y     V  DRE T       I+  D G    PL ST+T+ + + D++DN P+F     + S+ E   V A V +V A+D + GRN     +       N E++ F  DS +G V     LDRE+ + Y+L +  +D    P   +  S  + +TI+D NDNSP F     + EI EN   GT + +L     A+D D G N  L + LL   +  F      G  S+   +  DRE     R  L I + D G+   + T  + + +LDVNDN P               N T Q   +     +  SP  G  ++  +A D D G   A   R S+ +   D F ID   G++     +  E   +Y + ++  D   P    S ++ V +Q+ L
Sbjct: 1149 ATPAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQP-GPRIATFMASDQDS-GLNGELEYSIIDGDPRNEF------VISPADGDLRVRRY-----VELDRE-TQAFYNLTIMAKDMGTP--PLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERA-FYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRR--NATVRLGVTVLDVNDNTPTF-------------NVTSQTAHV-----LENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNEL 1711          

HSP 6 Score: 116.316 bits (290), Expect = 2.327e-26
Identity = 170/722 (23.55%), Postives = 284/722 (39.34%), Query Frame = 1
Query:  307 FVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWD-----GLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYG-VGKSMELQKAIDRDVSKEHNTVTYKL-DADIYSDTFMLKVTNDSFPILVLKK--ALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDED----SEITYRSADFSS---QYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTK------VVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQIT--IWDRDSE-AANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNP-VDAKVIKVTATDKDIG--RNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKPGTEV------------------GILIAT-------DNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHT------VCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESIT-IDLSIYESPGFEILKCEASDLDEGENAAFHFR 2289
            F +D+ T +L     +D E            G   LVV   D        L     V ++V DVND  P FL S   +   +V  G  G  +    A D+D S  +  + Y + D D  ++  +     D    L +++   LD E    YNL I A +       + L++ +RV++++D +P F       S+ E   + +++ +V A D +E     + + +    F +    +++ S  G +++ RPLD E  + + + +   DN  N +        +++T++D ND +P F+       I E  P   ++  +   I+  D++   N  L+     +L    +  F    D     G   +      DRE       ++ I+  DG  +N   +T+ + +T+ D+NDNTP F     +  + EN+P V   VI V A D+D+G    G V Y I      +     F ID  +G +     +D E    Y L++VA D+   P   T+SC + +++ +  D    F +   +  + E   PGT V                   IL+            E DN +L+  L              G + +    DRE TD Y L +   D G        T      V +N+ D NDN P                   +  S T +++    +PG  +    A+D D G N     R
Sbjct: 1221 FGIDNGTGVLTAVKALDFEV---------SAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRS--YEGPIDVSEGQPGPRIATFMASDQD-SGLNGELEYSIIDGDPRNEFVISPADGD----LRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAY----SLLGGSSAYFLIDRDR----GNVSMALGQGLDREGIPGGRLELTILVQDGGRRN---ATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSI-----ASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQA--PPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAAL-------------QGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEF-----------------EAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSAR 1878          

HSP 7 Score: 115.931 bits (289), Expect = 2.428e-26
Identity = 168/652 (25.77%), Postives = 284/652 (43.56%), Query Frame = 1
Query:  460 VEINVQDVNDNVPTF-LTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDT-----FMLKVTNDSFPILV-LKKALDYERCKLYNL-AIWAWNSPADNQKTKLSITIRVVNINDMEPKF-KQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQYFSVSSKGQIFLKRP---LDFETTSLHLIDVQASDNE---FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIF--EKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEK-SLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI------GP-KKLEIFENEKPGTEVG-ILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGK-TPLSIT------------HTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRI 2292
            V +NV D NDN P F   S+ L  V+E     G  + +  A DRD +  + TV+ +  A  ++ T     ++L + N+S   +V + KA   E+   + L  I A +  +  + T  ++++ V+++ND  P F     Y VSV E     +++  V A D D   + ++T+R         S+     I    P   +D ET + + + V A D      + +  V + V DVNDE P F        + E    ++ +G      + +E   G  + +       K A I K   ++ T +    L T  R  +     ++  V         + PL     + + + D+ND+ P+F        V+I E  PV  ++++V A D D G+NG V Y   +   +       F I++ SG ++    LDRE ++ Y LI++A D+G  P    S+  + + + D++DN P FI       P +   I E+  PGT VG +  A D D G N  + + +   +  N F L+  G L    + DRE +  Y + ++ +     TP   T              V + + D+ND  P  +F ++  +YT           + +D  +    G E+L+ EA D D G N+   +RI
Sbjct: 1825 VYVNVTDENDNSPEFEAGSATLVEVRESA-APGTLLTVLHATDRD-AGSNGTVSAR--AHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLE----SLSVGSFVATVKATENYKGHNTKYT-----YKIAGIGK---NAFTVHATSGLVTSTRLLKSYERFNLTAVATDH----GRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQG-QPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWP--VFTNH--EYT---------AGVAVDAKV----GSELLQLEAVDRDVGNNSIVLYRI 2438          

HSP 8 Score: 108.612 bits (270), Expect = 4.986e-24
Identity = 141/559 (25.22%), Postives = 243/559 (43.47%), Query Frame = 1
Query:  460 VEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYE-RCKLYNLAIWAWNSPADNQK---TKLSITIRVVNINDMEPKFKQQKYE--VSVEENLPINSMIIQVEAVDEDE--DSEITYR--SADFSSQYFSVSSKGQIFLKR--PLDFETTSLHLIDVQASDNE---FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVT-----ATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATL--KLDREK--ESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKP-GTEVGILIATDNDEG--DNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQG 2052
            V I + D NDN P F  ++    + E     G ++    A D D   ++  V Y + +   + TF +   ++   +L   KALD+E    LY L + A + P D  +   +  ++++ V ++ND+ P F  + YE  + V E  P    I    A D+D   + E+ Y     D  +++    + G + ++R   LD ET + + + + A D      N+   V + V+DV+D  P F   P+   + E      I+ ++   D +       L    P +  N +   +    DS+T      +Y     DRE   +    + +  +          +  + +TI D NDN+P+F +  Y   I EN+P +  V+ V      A+D D G N  + Y +     +    + F+ID D G V+  L   LDRE       +L I+ +D G    ++ ++  + +T++DVNDN+P F +  +   + EN    GT V ++ A D D G  D G + + +    N+ F      G + +    D ET   Y L +   DQ 
Sbjct: 1158 VLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPD-EGDNARVVYAIVSGNTAATFGI---DNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWF-LRSYEGPIDVSEGQP-GPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYA---DSQTGL----VYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSP-NGTVLTVLNGPIYASDADFGVNATLAYSL-----LGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGG----RRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQA 1693          

HSP 9 Score: 96.2857 bits (238), Expect = 2.676e-20
Identity = 150/619 (24.23%), Postives = 258/619 (41.68%), Query Frame = 1
Query:  697 KKALDYERCKLYNLAIWAWNSPADNQKTKLS------ITIRVVNINDMEPKFKQQKYE-VSVEENLPINSMIIQVEAVDEDEDS-------EITYRSADFSSQYFSV---SSKGQIFLKRPLDF-ETTS----LHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNP---SFCRIEEGQPENIIIGQITIWDRDSEAA-NGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVR----FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKK---LEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHN------ENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINIL--DVNDNPPR-LIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCE-ASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKP 2424
            + ALD E    Y L + + +         L+      + + V + ND  P+F+      V V E+    +++  + A D D  S         T+       QY  +    S   I      DF E TS      ++ +       +    + + V+DVND  P F L+P   +   +E G P  ++    ++W  D++A  NG+++        +K ++            G  D   RV      DRE T      +++  D G    PL+ +  + + + D+ND  P F   V +VS+ E+  V + V  V AT+   G N   TY+I  +      K+ F + + SG VT+T +L +  E F  L  VA D G  P    +   + +  ++ +   P F+ P     + I E       +  ++A D DEG NG + +  L          E+F     +G + +A+  DRE+   Y L +  +DQG+ P+S   T  + ++  D++DN P  ++ PD    Y             +  +  +  PG  +     A D D G NA  ++ I+  N+ + F++  + G+L V   L +E+   Y   IIV+ +  P
Sbjct: 1788 QAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIF-LSPGGYAVSVVELGAPGTLVA---SVWATDADAGPNGQVTFRIESGGGDKLSI------------GPSDGIIRVAPGANIDRE-TRAAYTLMVVAVDRG--NPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGI-----GKNAFTVHATSGLVTST-RLLKSYERF-NLTAVATDHGRPPLWGQAGLYVEVLDVNDHR--PVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQ-PVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQ------------SFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLS-RWGLLVVLSDLDREVSPYY--AIIVKASSNP 2362          

HSP 10 Score: 60.077 bits (144), Expect = 3.069e-9
Identity = 79/280 (28.21%), Postives = 122/280 (43.57%), Query Frame = 1
Query:  442 LKGIIRVEINVQDVNDNVPTFL----TSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNT-VTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKF--KQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYR----------SADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN----EFNANTKVVITVVDVNDEAPQFNLNP-------SFCRIEEGQPENIIIGQIT 1197
            L G   V + V DVND  P FL    T S+L+S+      VG  +   KA +    K HNT  TYK+ A I  + F +  T+       L K+  YER  L  +A      P   Q     + + V+++ND  P F        V++ E +P+   I++V AVD DE      R          S D+ S   + +S G I   R LD E+ +++ + + ASD      + +   + + + D++D  P F + P       SF  I E  P    +G ++
Sbjct: 2040 LSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLS-----VGSFVATVKATEN--YKGHNTKYTYKI-AGIGKNAFTVHATSGLVTSTRLLKS--YERFNLTAVATDHGRPPLWGQA---GLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATS-GIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFS-IPEHSPPGTAVGNVS 2304          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.512 bits (493), Expect = 1.406e-50
Identity = 199/761 (26.15%), Postives = 338/761 (44.42%), Query Frame = 1
Query:  256 RNLSEKINYRF-QKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLY-LVVNVWDG--LSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADF-SSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNE---FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDRE----ETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI-GPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDI-FSIDPQIGILRVKRKLKKELIGD-YNVQIIVEDNGKPSKMHSQKILVRIQDILRLEE 2484
            R  +  + Y+      + F +++ T  + T+  +D EE             +Y L V   DG  L  +    V I V D  D  PTF        V E +        L  ++       +  VTY + +     +F ++ +      +    A+D E    Y L + A +        + S+++ V ++N+  P F +  YEVS+ E+ P+NS    V A D+D  ++ E+ Y   +    + F +   GQ++++  LD ET   + + V A D      +++  V +TV+DVND  P FN +       E Q    ++G +   D D+ +  G    +E      K  V F+  LDS+T  G+     RV FDRE    +         +V  DG    PL    T+ + + D+NDN P F K+VY  S+ E+     ++++VTA+D D G NG + Y I+       E   F +D+ +G +T    LDRE+ + Y L++ A D GT P    +SCT+ + ++D NDN P+F      ++  E+ + G  +  L A+D D G +G + + ++  +    F +    GS+  A+  D ET   Y L +   D G+ P S    + +++ D NDNPP  +  D               E+I I        G  ++   A D D   N   H+ I+    P   F+IDP+ G +    ++ +E+ G  + V +   D   P  +H+++  ++   +L  +E
Sbjct:  583 RGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERA-----------VYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENV----APGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGGR---IFTANAIDREEQAFYQLRVVANSG---GVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE------KPQVNFE--LDSET--GRI-ASLRV-FDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINE----GNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSP--LAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIM---------ENIPI--------GTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIP--VHTRRSALKNVTVLVTDE 1285          

HSP 2 Score: 193.356 bits (490), Expect = 2.844e-50
Identity = 159/587 (27.09%), Postives = 258/587 (43.95%), Query Frame = 1
Query:  790 ITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNP-SFCRIEEGQPEN----IIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLY--------TRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXX-XXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPN----------HNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I V ++ND  P F   + E+ VEEN     +I  + A D D+  ++ +TY     S   F V ++ G +   R LD E  + +L+ V+ASD     + ++ + V D ND +P+F+ +  SF   E+  P+      +IG +   D DS               + +      P  DS    G + L+        TR   DRE     V +       G     L +T  + + + D NDN P  +    +  + E+ P    +++++ATD D G N  + + I    S +PE   F + +D G ++    LDRE++SFY L++   D+   P  + SS       + DVNDN+P F  P+     E+   G  V  + A D D G N  + + L  +              F   T+ G ++  +E DRE    Y L +   D+G+ PL+ T T+ + + D NDN PR    +Y             + +I  D    E PG E+L+  A D DEG N    + I+  +    F +DP +G L V R L +E    Y + +   D G P++  +  + V + D+
Sbjct: 1502 VEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADS-------------GPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTR-PLDRESRACYVLRARATDGGG-----LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSIS---SGDPEGR-FAVGND-GQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREY-------------EAAIAED----EPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDV 2047          

HSP 3 Score: 174.096 bits (440), Expect = 2.829e-44
Identity = 194/674 (28.78%), Postives = 297/674 (44.07%), Query Frame = 1
Query:  457 RVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLP-----INSMIIQVEAVDEDED--SEITYRSA-----DFSSQYFSVSS-KGQIFLKRPLDFETTSLHLIDVQASDNE-FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKL----SCWEPRNLY---NKQAVIFKPPLDS--KTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNP---LTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDN-----LRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKK---LEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKE 2373
            +VEI+V+DVNDN P F    +   V+E   G G+ +    A D D   ++  VTY     + S +    V + +  +L   + LD E    Y L + A +       T   +++ V + ND  P+F +  Y   V E+         ++I  V A D D     E+TY  A     D++   F +    G + + RPLD E+ + +++  +A+D     A  ++ + V+D ND AP    +     + E  P    + +I+  D D E  N +L    S  +P   +   N   +     LD   ++FY   +L  RV  DR                  A++P   L+S + +SL + D+NDN P F     +++  E++PV A V  V A D D GRN  V Y +                 F +++ +G V    +LDRE    Y L ++A DKG  P   TS+ T+ +T+ D NDN+P+F  P++     I E+E PGTEV  L A D DEG NG+L + +        F L  + G+L  A+  DRE T  Y L +   D G    S T +V + + DVND  P      Y          TV     T      + P   IL+  A D D G +    +  +  ND   FS+ P  G + + R L +E
Sbjct: 1501 QVEISVEDVNDNPPVFAVPEMELEVEENT-GEGEVIFTLSATDAD-QGQNALVTYS----VLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATD-DDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFY---NLVVRVS-DR------------------ARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALA-PEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPP--LTSTATLAVTVGDANDNAPRF--PRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPY----------TVHARENT------QGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPD-GHVHLLRSLDRE 2120          

HSP 4 Score: 172.555 bits (436), Expect = 9.129e-44
Identity = 177/687 (25.76%), Postives = 297/687 (43.23%), Query Frame = 1
Query:  460 VEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEH-NTVTYKLDADIYSDTFM--LKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAP--QFNLNPSFCR---IEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLT--IADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLE-IFENEKPGTEVGILIATDNDEGDNGKLLFKLLPN----HNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            V + V DVNDN P+F    +++   +    VG+ + L  A+DRDV     N   YK+ +       +    VT  +F  L     LD E    Y LA+ A +  +  +  +L + + V + ND  P F++  Y  SV E+ P+ + +            ++ +R     +  F   + G +  ++PLDFE    + + ++A+D      +     VI ++DVND  P  +F   P   R   ++E      +   +T+ D DS  ANG+LS            V+  P +      G   L    + DRE        ++   +      P+  + T SL   + D+ND+ P F  + Y+ ++ E  P  + V  VTA D D G N  + Y I +   +      F +D  +G VT   K+DRE  S   L I A+D+G  PK  T+  ++ +T++DVND  P F   K +    EN  PG  V  + A D+D G+NG + +   P+    + E F   ++ G + + K  DRE  + Y L ++  D+G  PL  T  V + + D+NDN      P ++P   +   S ++ E               +    A+D D G N    ++++   D   F ++   G +  +  L +E    Y +Q+   D G         + + + D
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-----------RDLLHRGRGPLAVPFDPKT-GMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVP-----GLRVLKVASQLDRERIPMYNLTILASDN----GKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLG----WFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPK--TAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDN-----HPVFYPVQYFA--SILENEPGGT----------AVTTVTATDPDRGANGTVRYQLTA-GDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVAD 650          

HSP 5 Score: 149.828 bits (377), Expect = 9.569e-37
Identity = 162/602 (26.91%), Postives = 260/602 (43.19%), Query Frame = 1
Query:  307 FVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKS----MELQKAIDRDVSKEHNTVTYKL----DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE----DSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN------EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDRE-ETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKPGTEVGIL--IATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEIND 2046
            FV+D+ + +L+    +D EE               L V   DG       R+ + V+D NDN P F   +    V E     GK+    +    A D D S     VTY L    D+D     F L     +   L + + LD E    Y L   A +        +L +   V++ ND  P  +       V E+ P  + ++++ A D+DE    + E +  S D   + F+V + GQ+ + R LD E  S + + V+ SD         ++  +V + + DVND AP F  +P      E  P   ++  +   D DS    G+ S  E   L                 +    +   VR  RE +        + V      + PLTST T+++T+ D NDN P F +  Y  +I E+ P   +V++++A D D G NG + Y+I    S +P    F +D   G +     LDRE+ + Y+L + A+D G   +  T+S    +T+ DVND SP F + P  +   EN + G  V IL  +A D+D G +G++ +     ++   F ++ +G +   +  DRE   ++ L I   D
Sbjct: 1563 FVVDAASGVLRASRRLDREERA----------SYLLTVRASDGTHATDA-RLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDAD-SGPFGEVTYALAPSEDSDWADGAFGLHPVTGA---LNVTRPLDRESRACYVLRARATDGGGLAATARLYVN--VLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGR-FAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT-SPRSALAPEDSPVGAVVATVQAVDPDS----GRNSYVE-YALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDI---ASGDPTGD-FRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASV--RVTLSDVNDCSPAFQLSPYTVHARENTQ-GPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 6 Score: 147.902 bits (372), Expect = 3.952e-36
Identity = 198/773 (25.61%), Postives = 320/773 (41.40%), Query Frame = 1
Query:  214 KISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLS--LKGIIRVEINVQDVNDNVPT----FLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTN-DSFPILVLKKALDYERCKLYNLAIWAWNSPADNQK-----TKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ---YFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEF---NANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGS-LQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
             ++ED P+     LR+L     +R +  L+    D  T ++ T+  +D E             Q  L +   DG +  L G     I + DVNDN P     +L  +   +  +     G    L    D D    +  ++  +        F+L         +L +   LD ER  +YNL I A    +DN K        S+ + V ++ND  P+F    Y  ++ E  P  S +  V A+D D       R +  S     +FSV  S G +     +D E  S  ++++ A D       A T + +T++DVNDE P F          E     + +  ++  D D    NG +      ++  +   +F+  LDS T  GK  + T    DREE  +    V           PL ST  +++ + D+NDN P+F    Y  SI EN P    V  VTATD D G NG V Y++        + + F +++ +G V+  + LDRE+ + YQL + A D G +  +  S   + IT+ D  D  P F        +FEN  PGT VG + A+  D   N  + + ++       F +  +G  + +A   DRE    Y L++  N  G   ++   +V + + DVN++ P  +F                + S  + ++  E          A+D D G+N    + I   N  + F I P  G L V+ +L +E   +Y++ +   D G      S  + V + D+
Sbjct:  144 SVAEDSPVGAA--LRDLL----HRGRGPLA-VPFDPKTGMVSTRQPLDFEARR----------QYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILA----SDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDL-GENGTVRYNFDPDMPAQYREMFR--LDSLT--GK--VTTLKSLDREELEEYPLVVQAQDR---GSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQL-----TAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHL--RARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL--NANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAP--VF---------------DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPD-GQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDV 855          

HSP 7 Score: 146.747 bits (369), Expect = 9.444e-36
Identity = 180/678 (26.55%), Postives = 293/678 (43.22%), Query Frame = 1
Query:  403 QLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFP--ILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSE--ITYRSADFSSQYFSVSSKGQIFLKRPLDFET------TSLHLIDVQASDNE----FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI-GPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNH--NENFFYLTINGSLQSAKEFDRETTDR-YCLQIEINDQG---KTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKE 2373
            QL +V N      + G   V + V DVN++ P F  +S   S+ E    V       +A D+D S ++  V Y++      + F +      FP   L ++  LD E  + Y+L + A ++  +   + +++ + V+++ND +P F    Y     E   + S++  V+A D D  S   +TY        +   S  G+I   R  D E        +     V A+D            V + V DVND  PQF  +     + E       + ++T  D D E  NG L     R   N+     K  +D+ T  G+  L      DREET      V       +  +PL ++ T+++ + D NDN P F +++ SV   E+  V   +I +TA+D+D G +G V Y I          + F ID  +G V    +LD E +  Y+L + A+D G  P+  +S+  + + + D NDN P F+ G     I EN   GT V  + A D D   NG+L + +        +F     +G + +A E DRE T   + + +   D+     T  S    V + + D NDN PR + P                 +I +D  +  + G  +   +ASD DE ENAA  + ++  +   +F +D + GI+    +L +E
Sbjct:  728 QLRVVANSG---GVAGEASVSVLVHDVNNHAPVFDRASYEVSIAE-DEPVNSRFFSVRATDKD-SGKNGEVKYEIGEGNGGEKFGI------FPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVD-EGVNGAL-----RYAINEGNEGGKFTVDAST--GQITLLGS--LDREETASYTLVVSATD---SGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAI----VAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPR--SSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTP----------------TAILVD-GLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETSTELDRE 1358          

HSP 8 Score: 137.502 bits (345), Expect = 5.481e-33
Identity = 106/367 (28.88%), Postives = 180/367 (49.05%), Query Frame = 1
Query: 1411 KNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTE-----VGILIATDNDEGDNGKLLFKLLPNHNEN-----FFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGK--PSKMHSQKILVRIQDIL 2472
            + P++S   + +++ D+NDN P+F      + +EEN      +  ++ATD D G+N LVTY +     ++  +  FV+D+ SG + A+ +LDRE+ + Y L + A D GT      +   +++ + D NDNSP+F       ++ E+  P  +     +G ++A D D G  G++ + L P+ + +     F    + G+L   +  DRE+   Y L+    D G   L+ T  + +N+LD NDN P                 +VQ +S+  ++     PG  +L+  A+D DEG NA   F IS  +    F++    G L V R L +E    YN+ + V D  +  P+++ S    VR+  IL
Sbjct: 1493 RPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSV-----LSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASD-GT----HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAP-----------------SVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVG-NDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSA---VRVSLIL 1826          

HSP 9 Score: 94.3597 bits (233), Expect = 9.832e-20
Identity = 120/480 (25.00%), Postives = 186/480 (38.75%), Query Frame = 1
Query: 1078 TKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQI----TIWDRDSEAANGKLSCWEPRNLYNKQAVIFKP-PLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI----GPKKLEIFENEKPGTEVGILIATDNDE-GDNGKLLFKLLPNHNENFFYLTING-----SLQSAKEFDRETTDRYCLQIEINDQGK-TPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            T+V + V DVND AP F   P    +E    E+  +G+     T  DRD    NG           N++  +  P P+  + F     L T    DRE        V         +      + +++T+ D NDN P FEK  Y  S+ E++PV A +       +D+             R   P    F  D  +G V+    LD E    Y L + A D G  P    ++  I +  ++ ND + +F+      +   + E+  PGT   ++  TD D    NG+L   ++  +    F L   G      L+ A + DRE    Y L I  +D GK    S T ++ + + DVND+ PR         +     +    E            G  +    A D D G NA   + I   ND   FS+D   G++    K+ +E+     + I  +D G   K     + V + D+
Sbjct:    7 TEVRVVVGDVNDNAPSF---PEPGVMEVAFKEDAAVGRQVLLDTAVDRDV-GPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFL---HLATTGPLDREANPSYALAVQAEDGGSPRR---YGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-------RDLLH-----------RGRGPLAVPF--DPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPR---------FALSAYAAALSEGAPA--------GSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDV 439          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.548 bits (423), Expect = 1.254e-42
Identity = 196/772 (25.39%), Postives = 322/772 (41.71%), Query Frame = 1
Query:  334 LKTKTLIDLEELC---PDHC-PTGEMGQLYLVVNV-WDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDV---SKEHNTVTYKLDADIYSDTFML----------------KVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYE-VSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQYFSVSSKGQIFL-----------KRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFN--------LNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIF--------EKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-------KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL---TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKI 2448
            L     +D E LC   PD C  TG M  + +       G S   ++ V++ V+D+ND+ P F    +  S+ E    VG+ + L +AID D    S +H  ++      +    F L                        +L L++ LD E    Y L +W  +         + +TI VV+ ND  P F       V + E+  + + ++Q+ A D D   +  I Y    F ++  S++++  + +              LD ET  +H + V A D      +A+  V + + D ND AP F         L     +I E  P    +  I++ D D     G     + R  +   A +  P   +K    ++ L T    D EE       V+     G  K  L+  + + +++ DINDNTP+F        + AVY VS+ EN P    V+ + ATD D G NG +T+ +  L        LF ++  +G +T    LDREK   Y+L + A D G+   Q+ +   + +T++D NDN+P F+G         +  + E    GT VG +  +D DEGDN ++   L+     ++      T  G +++    DRE   +Y L +   D G+  LS +  V I + D NDN P +  P+ +   TW    T     + + +S+            A+D+D G+N    + I   N   IF ++   G L + R +     G + + + V D G       + +
Sbjct:   83 LSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISES-EAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAY---SFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDL----GSSGTVDVRLEFPTGAELASP---NKV---QFLLKTTRLLDYEEAQQYNVSVLAADR-GTPK--LSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGS--PQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTND--TWKHVRTFSPAGMLVGVSV-----------TANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGGSGSRRVRAV 822          

HSP 2 Score: 108.227 bits (269), Expect = 3.234e-24
Identity = 142/548 (25.91%), Postives = 235/548 (42.88%), Query Frame = 1
Query:  271 KINYRFQKQLSYFV------LDSNTSILKTKTLIDLE-ELCPDHCPTGEMGQLYLVVNVWDG--LSLKGIIRVEINVQDVNDNVPTF---------LTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLD----ADIYSDT---FMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQK--------YEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFS-----SQYFSVSSK-GQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQF--NLNPSFCR----IEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYD-----LYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVS---IEENNPVDAKV-IKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKG 1737
             I Y F  +L+         +D  T ++  +    L+ E  P H          LVV   DG  LS    + V + + D NDN P F         L    +K V+ +  G    + L    D D+     TV  +L+    A++ S     F+LK T          + LDYE  + YN+++ A +         L++ I VV+IND  P F            YEVS+ EN P  ++++ + A D D   +  IT+  ++ +     ++ FS++ + GQ+ L  PLD E    + + V+A D    +  A   V +TV+D ND AP F    N + C     +EE       +G ++  D D E  N +++     NL  +               G  D     + T V  DRE+ +     V  V    + +  L+++  +S+T++D NDN P+      + +   +   +P    V + VTA D D G NG   YEI      NP K +F++++DSG ++    +    E  ++L++  +D+G
Sbjct:  307 AIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVH---------RLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSG--TPVVLISVSDPDLGSS-GTVDVRLEFPTGAELASPNKVQFLLKTT----------RLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLD-EGDNARVAL----NLVREAG--------PDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVD---SGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIG---GNP-KGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRG 812          

HSP 3 Score: 106.686 bits (265), Expect = 9.856e-24
Identity = 103/379 (27.18%), Postives = 176/379 (46.44%), Query Frame = 1
Query: 1408 AKNP-LTSTMTISLTIADINDNTPIF-EKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDN-LRSMNPEKSLFVIDSDSGWVTA--TLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF---------IGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKL-LPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYE-------SPGFEILKCEASDLDEGENAAFHFRIS-LPND---PDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
              NP L+ ++ +++ + D NDN P+F +     V I E++ V   V+++ A D D G NG + Y     L S+  + +L V D  +G VT     KLDRE    ++L++VA+D G +   +++S T+ + + D NDN+P F         +    ++I EN   GT V ++  +D D G +G +  +L  P   E      +   L++ +  D E   +Y + +   D+G   LS    + I+++D+NDN P  + P                 SI  D+++YE         G  +L   A+D D G N A  F +S L       ++FS++ + G L +   L +E    Y + +   D G P +     + V + D
Sbjct:  247 GGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHV-DGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQL--SRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNP----------------ASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLD 606          

HSP 4 Score: 82.8037 bits (203), Expect = 2.785e-16
Identity = 98/376 (26.06%), Postives = 162/376 (43.09%), Query Frame = 1
Query: 1432 MTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLF-VIDSDSGWVTATL------------------KLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP--KKLEIFENEKPGTEVGILIATDNDEGDNGKLLF----KLLPNHNENFFYLTINGSL---QSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYES--PGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + + L + DIND+ P F     +VSI E+  V  +V    A D D G N +  Y I        +   F +++SD       +                  +LDRE    Y+L++  +D G  PK  + S  + I ++D NDN+P F+ P  + + I E+ K GT V  L A D D G NG + +    KL     +   ++     L   ++A++ DRET   + L +   D G+   S + TV + + D NDN P  +F     +  ++ +  V+         I E+   G  ++    SD D G +     R+  P   ++ S +    +L+  R L  E    YNV ++  D G P       +++ + DI
Sbjct:  128 LDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGN-PK-LSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAP--VFEVIALQGEYLPDGGVK---------IVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDI 490          

HSP 5 Score: 50.447 bits (119), Expect = 2.482e-6
Identity = 86/380 (22.63%), Postives = 159/380 (41.84%), Query Frame = 1
Query:  214 KISEDVPLSTQMILRNLSE-------KINYRFQKQLSYFVLDSNTS--ILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILK---SVKEVIY---GVGKSMELQK-AIDRDVSKEHNTVTYKL----DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKF------KQQKYEVSVEENLPINSMIIQVEAVDEDEDSE-------ITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQF---NLNPSFCRIEEGQPENIIIGQITIWDRDSEAA-NGK 1233
            KI E++P  T ++L ++S+        ++ R +      +   N    +LKT  L+D EE         +   + ++        L  ++ + I+V D+NDN P F+  + ++   +V EV     G   ++ L   A D D S  +  +T+ L      +  ++ F L +       L L   LD E+   Y L++ A +  +  +K +  + + V++ ND  P F          Y+  VEE   + + +  V   D DE          +     D+       +  G +     LD E    + + V+A D+     +A+ +V ITV D ND AP     N N ++  +    P  +++G +++   D +A  NG+
Sbjct:  400 KIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEE--------AQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDAD-SGPNGAITFTLSELAGGESVAELFSLNMRTGQ---LTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGD-TPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVG-VSVTANDIDAGDNGR 765          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.081 bits (414), Expect = 4.163e-41
Identity = 169/675 (25.04%), Postives = 296/675 (43.85%), Query Frame = 1
Query:  454 IRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKL-DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLT-INGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQ 2463
            +++E++V D+NDN P F +S     V E      +++ +  A+D+D S  +  V Y + D +I +   + +V  +S  I  +   LD E    Y L + A +  +  Q   + + I V + ND  P+F Q  +   V E+  +   +++V  +D DE  ++ IT+   D S  +    S G+I + R L+ E  S + + V+ASD  +  +T V I V DVND AP+F     +    E      ++ +++  D D + ANG++  +        Q   F+   DS   +    L  R         +  K   +V      + PL+S  T+++ I   N N P F +  YS  +        +++ ++A D D   NG + Y +    +       F +D+  G++     L  +  S + + + A+D+G  P   +S  T  I++ + N  +P+F  P  +L + EN   G+ +  + ATD D G NG +++ +        F ++  +G +    E D ET   Y L +   D G    +    V I++ DVNDNPP L   DY+P     +N+      + +D    +SP   +       LD+GE              D+F ++ + G+L  +  L  E    Y  ++ V     P   H     V +Q
Sbjct:  320 LKLEVDVLDINDNAPEFSSSRFWAKVPENT--PPRTIVVLTAVDKD-SGINGQVDYSIIDGNIGN---VFRVNPNSGEIRSVST-LDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQ-IFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDAD-DGANGQVFFF-----MRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNA----SRRFDVDA-GGFLHLRASLAGDAGSIFSVTVEARDRGRPP--LSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYP--VIPENAPSGTTVLVMDAVDADSPSNAVTM---YSLDDGEA-------------DLFVLNQKTGVLTTQGFLDYETKQTY--ELTVRAFNYPDTFHYSTAQVHVQ 953          

HSP 2 Score: 151.369 bits (381), Expect = 3.351e-37
Identity = 155/580 (26.72%), Postives = 253/580 (43.62%), Query Frame = 1
Query:  787 SITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNE----FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLS-----------CWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTIN-GSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            ++T+ V + ND  P+F   +   +V E+ PI S +  V A D D   ++ I+YR       +    S GQI     LD E    ++++V A D       +++  +V+ V DVND  P+F   P         P    +  +T  D D+   NG L              +PR      A   + P D        DL   VR                  DG A  P ++  T+++   D  +  P F     S S  E+ P    +  V A  +   R G V+Y + +  ++     +F +D  SG V+    LD E +  Y+L++ A+D G  P   ++   + + ++D+NDN+P+F   +   ++ EN  P T V +L A D D G NG++ + ++  +  N F +  N G ++S    DRE    Y L ++  D+G      T  V I++ D NDN PR         +T I ++ V++++           GF +L+    D DEG NAA  F +  P+ P  FSI P  G + V R+L +E    Y V++   D   P+   S  + + + D+
Sbjct:   11 TVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADA-GPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGPRD--------DLTLTVRVS----------------DGGAP-PRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNLG---DVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPF--SAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIV-VLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPR---------FTQIFSAHVREDAAV---------GFPVLRVSTLDADEGPNAAITFSLLDPSLP--FSIHPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDV 532          

HSP 3 Score: 130.568 bits (327), Expect = 9.273e-31
Identity = 170/678 (25.07%), Postives = 282/678 (41.59%), Query Frame = 1
Query:  460 VEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKA-IDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYR--SADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTK---VVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLT---STMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEI-DNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPK----QQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTIN---GSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGEN-AAFHFRISLPNDP---DIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKP 2424
            V IN+   N N P FL       V   +    + +++     DRDV+ +   + Y +     S  F +    D+   L L+ +L  +   ++++ + A +       ++ +  I V   N   P+F     E+S+ EN P  S + +V A D D   +  I Y   S D S  +    + G + L   LD+ET  L+ + V A+D  + A T+   V I+V DVND  P  N +  +  I E  P    +  +   D DS +    +      +L + +A +F   L+ KT      L T+   D E        V       A   P T   ST  + + I  +N+  P F +  Y+  + E+ PV A V  V ATD+D G +G V Y +    RS       F ++  +G +  + +LDRE+E+   L ++AK+ G++      +   +  I         +S  + G     + E    GT V  + A D D    G   F  L          +IN   G +  A   DRE+   Y L +   D G+ P + T  V + + DVNDN P L+                   + +  ++  +  G  +L  EA D D   N   + F++ L +DP     FS+    G+L+  R + +E   ++++ + + D G P
Sbjct:  637 VTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQ---IAYSVVGGNASRRFDV----DAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTM-----YSLDDGEADLFV--LNQKTGV----LTTQGFLDYETKQTYELTVR------AFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKG-----FSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFSSALYHG----RVSEAASVGTHVVGVSAHDFDS-PPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLL-------------------TSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQL-LGSDPAWRGYFSLS-SSGLLKTARPIDREQKPEFHLPVAIADAGSP 1259          

HSP 4 Score: 127.872 bits (320), Expect = 5.252e-30
Identity = 160/690 (23.19%), Postives = 274/690 (39.71%), Query Frame = 1
Query:  460 VEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSF------PILVLKKALDYERCKL--YNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDED--SEITYRSADF-SSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQ-QTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTIN-GSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCIN--ILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGEN-AAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            V I V DVNDN P F  ++      E   G      +  A D D         +     + S T   +V  DS       P+     A       L  Y+  + A +       +  ++TI +V  N   P+F +++Y   V   +   + I+ + AVD D D   +I Y      +S+ F V + G + L+  L  +  S+  + V+A D      ++    +I+V + N  AP+F   P    + E  P    + ++T  D D+   NG +       +Y+  +       D     G   L   + ++ E+  +                  T    +S+++ D+NDN P+   + Y   I EN P    V+ + A D D   N +  Y +D+      E  LFV++  +G +T    LD E +  Y+L + A +    P     S+  +++ I  VN+  P+F+  +    + E+   G  VG + ATD D G +G + + L        F +  + G +  + + DRE      L++   + G         V +N  I D ND PP      YH +                 +S   S G  ++   A D D       F F I   N    FSI+   G++ V   L +E +  YN+ ++  D G+P    +  ++V ++D+
Sbjct:  525 VTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARV-SASDADDGANGQVFFF-----MRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDA-GVNGAI-------VYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAAD-----GGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDG-----EADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFN---YPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGR-----------------VSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDV 1169          

HSP 5 Score: 127.872 bits (320), Expect = 6.551e-30
Identity = 142/575 (24.70%), Postives = 245/575 (42.61%), Query Frame = 1
Query:  466 INVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTF-MLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEIT--YRSADFSSQYFSVSSK-GQIFLKRPLDFETTSLHLIDVQA---SDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKY---------------DLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDN-GKLLFKLLPNHN--ENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNP 2115
            I+V + N   P F    +  S+ E  +  G S+    A D D    +  + Y + +   S  F + + + D    ++L   LDYE  KLYNL++ A +     +     ++I V ++ND  P      Y   + EN P  + ++ ++AVD D  S     Y   D  +  F ++ K G +  +  LD+ET   + + V+A    D    +  +V + +  VN+  P+F        + E  P    +G +   DRD+                          +D   FY  +               ++    + DRE         +I  + G+ +      + +++ I D ND  P+F  A+Y   + E   V   V+ V+A D D    G  T+    ++S N  ++ F I++ +G +     LDRE    Y L +VA D G  P   T+   + +  ++  +++  F+     ++ EN+  G  V  L A D D   N G   F+LL +      +F L+ +G L++A+  DRE    + L + I D G  PL+ T T+ +++LD NDNP
Sbjct:  743 ISVTEENQYAPRFAHPPLELSLPE-NHPAGSSLARVTATDTDAGV-NGAIVYSIASGDGSGLFDISRASGD----VLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAG-------------------------IDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDRER-EASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFD-SPPGWRTFSF-LIQSGNAGRA-FSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTT---VVVVALEDVNDNGPFLLTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNP 1278          

HSP 6 Score: 125.176 bits (313), Expect = 3.934e-29
Identity = 155/630 (24.60%), Postives = 259/630 (41.11%), Query Frame = 1
Query:  442 LKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNS-PADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVND--EAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSE---------AANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHF 2286
            L G   V + V+D NDN+P F  + +  +V E    +G  + L  A D D    +  ++Y+L        F +   N S   ++   +LD E  + Y L + A +  P     +  ++ + V ++ND  P+F    Y      + P  + +  V A D D   + ++ +  +  +S  FSV   +G I   R L      L L  V+ SD      + V    V   D  E P+F   P      E QP    I    +  R S          A+ G L      +  + +  + +  LD + +   Y+L    R                    +   P ++ + + + + DINDN P F  + +   + EN P    V+ +TA DKD G NG V Y I +    N    +F ++ +SG + +   LDRE  + Y+L + A D+G+    Q  +  + I++ D NDNSP+F       + E+   G  V  +   D DEG N  + F LL + +  F      G +  ++  +RE    Y +++  +D   T   ++  V I + DVNDN PR     Y+ ++        + E++             + +  ASD D+G N    F
Sbjct:    6 LTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAP-IGSDVALVNATDADAGL-NAIISYRLRGG--DGHFSV---NPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGPRDDLTLT-VRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTI--TVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHR-ALDHE-YQHHYELVVEAR-------------------DSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGNIGN----VFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGS--PTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLL-DPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWT---VSTDVTIVVDDVNDNAPRFGQTAYYIEFP----EPSEGEAL-------------VARVSASDADDGANGQVFF 576          

HSP 7 Score: 123.635 bits (309), Expect = 1.128e-28
Identity = 141/612 (23.04%), Postives = 259/612 (42.32%), Query Frame = 1
Query:  694 LKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFS-SQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEF---NANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPL-TSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESF---------YQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYES--PGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + +ALD+E    Y L + A +S        L + + V++IND  P+F   ++   V EN P  ++++ + AVD+D   + ++ Y   D +    F V+ + G+I     LD E  + + + V+A+D      +   KV+I+V D ND +P+F    S   + E       + +++  D D E  N  ++             +  P L         ++    R +RE+      KV        A +P  T +  +++ + D+NDN P F +  Y +   E +  +A V +V+A+D D G NG V +       M  +   F +  DSG + +   L     +          Y  ++ A D+G  P   +S  T+ I I+  N N+P+F+  +    +    + GT +  + A D D   NG++ + ++  +    F +   G L        +    + + +E  D+G+ PLS   T  I++ + N   PR   P                    ++LS+ E+   G  + +  A+D D G N A  + I+  +   +F I    G + +  +L  E    YN+ +   D G  +K     + + + D+
Sbjct:  290 VHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFS-AHVREDAAVGFPVLRVSTLDAD-EGPNAAITF-----------SLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVR-------ASDPAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFF------FMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPP--LSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHP-------------------PLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDV 853          

HSP 8 Score: 115.161 bits (287), Expect = 4.554e-26
Identity = 100/356 (28.09%), Postives = 155/356 (43.54%), Query Frame = 1
Query: 1405 AAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKP-GTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            A +  LT T T+++ + D NDN P F  A    ++ E+ P+ + V  V ATD D G N +++Y    LR  +     F ++  +G +  T  LDRE    Y L + A D G  P   +SS T+ + + DVND++P+F+    +    +  P GT V  + A D D G NG L F L  + +  F      G + +A+   +   D   L + ++D G  P S   TV +   D  +      FP + P               +      + PG  I    A         ++H   S  N  D+F++DPQ G + V R L  E    Y + +   D+G P      K+ V + DI
Sbjct:    1 AGEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYR---LRGGD---GHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPG-LSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARAL-QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE------FPRFAPG------------PRSFSFREDQPPGTTITVVAARSSRRAGPVSYHL-ASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDI 329          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 229.18 bits (583), Expect = 2.421e-61
Identity = 210/730 (28.77%), Postives = 333/730 (45.62%), Query Frame = 1
Query:  307 FVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDG--LSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDS--EITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLP-NHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            F +D  T  + T+  +D E +              L +N  DG  +       V I++ D NDN PTF   S     ++     G  +    A DRD+   +  VTY + +    ++F L   +    IL ++  LD E    Y L + A ++ +  Q    SI + V+++ND  P+F++  +   + E+  ++S ++QV+  D+DE S   IT   +   S  F++ S G +  K PLD+ETT+ + + V A D      +A  +V IT+++VND  P F        I E    N  + ++   D D       +       +       FK  +D  +      +    R DRE T  +   V+   + G+    + +  TI   + D+NDN P+F    Y+ S+ EN P+   V KVTATD+D G N  VTYE+    S+  + S F ++  +G VT    LDRE ++ Y L + A D G     Q++   I +TI D+NDNSP+F   K  L + EN   G+ +  ++A+D D G NG++ + ++  NH   F   +  G +      DRE    Y L I   D G  P   T  V I + D NDN P  IF      Y  ID      E ++I        G  +    A+D DEG NA   + I +  D   F+I+   G+L VK+++ +E +  Y + I   D G P     +++ V + D+
Sbjct:  733 FAMDRFTGEITTRVPLDRETIA----------SYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISED--SPTGTRVGQLTATDRDIGP-NGAVTYAIISGNQGNSFQLDPRSG---ILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDI-------VEGNAGSSFK--IDQSSGL----ISVAKRLDRE-TTANYTLVVRATETGSQGESVYNNATIR--VLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYEL----SVG-DTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHG--KPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSP--IFASNETSY-GID------EGVSI--------GSRVAVVTATDRDEGSNAQVFYSI-VRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDV 1405          

HSP 2 Score: 220.32 bits (560), Expect = 1.424e-58
Identity = 209/683 (30.60%), Postives = 323/683 (47.29%), Query Frame = 1
Query:  460 VEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITY------RSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNE---FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKL-EIFENEKPGTEVGILIATDNDEGDNGKLLFKLL-PNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            V I +QD+NDN P F    + + V E     G  +    A D D S   + V Y L  +  +D F +   N S  ++ LK  LDYE+   Y + + A +    ++ +   + + V ++ND  P+F +  Y  +V ENL     +  V A D D   + +I+Y       +  F+   F+    G+I  + PLD ET + + + + A D     F A T V I++ D ND  P F   PS   I E  P    +GQ+T  DRD    NG ++      +   Q   F+  LD ++      L  R   DRE TI     V+   D G+ +  +T+++ +S  + D+NDN P FEK+++S  I E+  V + V++V   DKD G NG +T  +    S N     F IDS +G+V +   LD E  + YQL + A+D G+  K  T+   I I  ++ N   P F+ P ++  I E+    T V  L ATD+   D   L F ++  N   +F     +G +  AK  DRETT  Y L +   + G    S+ +   I +LDVNDN P +  P  + K            S+  +L I    G  + K  A+D DEGENA   + +S+  D   F ++P  G++  KR L +E    Y++++   D+GKPS+     I + I D+
Sbjct:  569 VTIALQDINDNSPIFQGPYVFR-VSES-SSPGHQIGQVAATDADDSSNGD-VRYALSDN--TDVFSI---NTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFT----GEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFT-GPSRFNISEDSPTGTRVGQLTATDRDI-GPNGAVTYAI---ISGNQGNSFQ--LDPRSGI----LSVRSTLDRE-TIPSYTLVVKASDAGSPQQSITASIHVS--VLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDN-----FTIDS-TGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNV--PSFVSPAQVTSIPEDVAINTHVVKLNATDS---DGTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAP-VFNPGSYAK------------SLHENLPI----GQTVAKVTATDRDEGENAKVTYELSV-GDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDL 1196          

HSP 3 Score: 217.238 bits (552), Expect = 1.581e-57
Identity = 212/775 (27.35%), Postives = 344/775 (44.39%), Query Frame = 1
Query:  169 KYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQ--DVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYR--SADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANT---KVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            ++ I E+ P  TR+G+++     + + I  N +         Q + F LD  + IL  ++ +D E + P +          LVV   D  S +  I   I+V   DVNDN P F  S     ++E       S  LQ  ++      +  +T  L  +  SD F +    DS   ++ K  LDYE    Y L + A +  + ++     + I ++N+ND  P F       S+ E++ IN+ ++++ A D D  + +T+     +  S +    S G I + + LD ETT+ + + V+A++      +      I V+DVND AP FN       + E  P    + ++T  DRD E  N K++        +K  V     L          + T+   DRE+      +V  +      K   ++   I+LTI D+NDN+P F ++ Y++++ EN    + +++V A+D D G NG VTY I +    N     F IDS +G +T    +DRE  + Y L I AKD G  P    S+  + IT+ D NDNSP F   +    I E    G+ V ++ ATD DEG N ++ + ++      F    +NG L   KE +RET   Y L I  +D+G   ++    + + + DVNDNPP      Y      +  ++ Q  S              +L   A D D G NA   + I   ND   F I+   G++     L  E    Y +++   D+   +K +    ++ + DI
Sbjct:  795 RFNISEDSPTGTRVGQLTA----TDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETI-PSYT---------LVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIRE--DASVHSTVLQVKVEDKDEGSNGAITLSLSGE-GSDNFTI----DSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD-GTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRD-EGENAKVTYELSVGDTSKFEVNPATGL----------VTTKRPLDREDQASYSLRVTAMDH---GKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNA----FRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPP--WVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSY---IGSVRENSAQSTS--------------VLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLNDI 1510          

HSP 4 Score: 191.43 bits (485), Expect = 1.874e-49
Identity = 211/775 (27.23%), Postives = 349/775 (45.03%), Query Frame = 1
Query:  205 RIGKISEDVPLSTQMILRNLSEKINYRFQKQL------SYFVLDSNTSILKTKTLIDLEE-----LCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYR--SADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNE---FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            ++  I EDV ++T ++  N ++         +      S F +D ++ ++     +D E      L      TG  G+     +V++  +++        V DVNDN P F   S  KS+ E +  +G+++    A DRD   E+  VTY+L      DT   +V N +  ++  K+ LD E    Y+L + A +    +Q    +IT+ + ++ND  P+F Q KY ++V EN    S I++V A D D   +  +TY   S +  + +   S+ G+I +   +D E  + + + + A D+    + +   V ITV D ND +P F  N +   I+EG      +  +T  DRD E +N ++        Y+    I +    +        + T  +    ET+      I   D G+    +TS   +++ + D+NDN P+F    Y  S+ EN+     V+ V A D D+G N ++ Y I    S N EK  F I+S SG +  T  LD E++S Y L + A D      + T+   + I +I++ND +P F        + EN    T V  + A+D D    G L + ++   + + F +   +G + +A   DRE    Y +Q+ + D G  PLS    V I ILD NDN P+  F       + ++NS               +P     K  A+D DEG NA   + +S     D F I    G++ + + L +E    Y++ I   D+G P +  S  I V + DI
Sbjct: 1002 QVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGE-----SVYNNATIR--------VLDVNDNAPVFNPGSYAKSLHENLP-IGQTVAKVTATDRD-EGENAKVTYELSV---GDTSKFEV-NPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRD-EGSNAQV-------FYS----IVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPM--MTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSI---ISGNDEKR-FKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS-----KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPK--FDSSSYSSSILENS---------------APSSFSFKLAATDADEGTNARITYNLSR---NDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDI 1712          

HSP 5 Score: 191.43 bits (485), Expect = 2.098e-49
Identity = 194/683 (28.40%), Postives = 313/683 (45.83%), Query Frame = 1
Query:  445 KGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKL--EIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTIN-GSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            KG   V I+V+D NDN P F  +S + +++E        + +  A DRD S  +  +TY L +    + FM+   N     +     LD+E    Y + I A+    D + T     I V ++ND  P F    Y+  V E++ + S++ Q+ AVD D   ++ ++Y      + YF+V S+G I  K   D ET + + + ++A D      +    V I ++DVND  P F    S  +      E++ IG   +    S+  NG     + R  +          LD+ T  G   +   + F++  +      V           PLT T  + + + DINDN P+F  + Y   ++EN P      +V+ATD+D   NG + + I        +  +F ID  +G ++     D E ++ Y L + A+D+G   K  T+     I I DVND+SP F  P     +I E+   G+ V  + ATD D G  G+L ++L+  + +  F +  N GS++ + E DRETT  Y LQ+E  D G T  S +  V I + D+NDN P    P     Y +              +S   SPG +I +  A+D D+  N     R +L ++ D+FSI+   G++ +K +L  E    Y V +  +D G PS+     + V + D+
Sbjct:   51 KGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAA--QVAIVTATDRD-SGTNAAITYSLFSG--ENKFMM---NSKTGEIRTVTPLDHETKDSYTMRISAF----DGKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVF----SSAQYTASVDEDVAIGAAMVTVTASDKDNGN--NADLRYSFTSGNTNHAFTLDAVT--GVVTVSRSLDFEQRSSYALGLSVTDR-----GSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGI----IKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQV--TIFIEDVNDHSPVF-SPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGP-----YVF-------------RVSESSSPGHQIGQVAATDADDSSNG--DVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDV 678          

HSP 6 Score: 186.037 bits (471), Expect = 8.688e-48
Identity = 207/768 (26.95%), Postives = 329/768 (42.84%), Query Frame = 1
Query:  223 EDVPLST---QMILRNLSEKINYRFQKQL-----SYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ---YFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFNA---NTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKL---EIFENEKPGTEVGILIATDNDEGDNGKLLFKLLP-NHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            EDV + +   Q+   +L   IN R    L     SYF +DS   +++TK   D E        T    Q+ L        S  G   VEI + DVNDN P F ++    SV E +  +G +M    A D+D +  +  + Y   +   +  F L        ++ + ++LD+E+   Y L +   +  +        + I V +IND  P F    Y+  V+EN P  +   QV A D D  +                F++  S G I + +  D+E  + + + VQA D          +V I + DVND +P F+ +    +I    PE+ +IG   +    ++  +G     E R +       F    +S +     +L      DRE T     +V             +S+  +++ + DINDN+PIF+   Y   + E++    ++ +V ATD D   NG V Y      +++    +F I++ +G +T   +LD EK++ Y + + AKD GT    ++S   + + + DVNDN P+F   K L    + EN   G  V  + ATD D G NGK+ + +L  N N  F      G + +    DRET   Y L I  +D          TV I+I D NDN P    P             + ++S T         G  + +  A+D D G N A  + I   N  + F +DP+ GIL V+  L +E I  Y + +   D G P +  +  I V + D+
Sbjct:  179 EDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQ-GVIRTKGAFDRE--------TKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDV-AIGAAMVTVTASDKD-NGNNADLRYSFTSGNTNHAFTLDAVTG---VVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQI----PESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSEL------DRETTPSYSLQVEARD---GGSTSRSSSTRVTIALQDINDNSPIFQGP-YVFRVSESSSPGHQIGQVAATDADDSSNGDVRY------ALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGT--PSRSSLTVVKVMVDDVNDNPPQF--AKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRF---------NISEDSPT---------GTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDV 887          

HSP 7 Score: 182.57 bits (462), Expect = 1.017e-46
Identity = 172/574 (29.97%), Postives = 270/574 (47.04%), Query Frame = 1
Query:  460 VEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSS---QYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAA------NGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLE--IFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYH 2142
            V I V D NDN P F ++     + E +  +G  + +  A DRD    +  V Y +   +  DT    + N    +L +KK ++ E    Y L I A +  +    +   +T+ V ++ND  P F  Q Y  SV EN   ++ ++ V A D D  +    R +  S    + F + S+ G I    PLDFE  S + ++V A+D+++ A T V I V+++ND  P F        + E  P +  + +++  DRDS  +       GK S  +  ++  +  +I    +  +     Y +  RV                     A   PL++   +++ I D NDN+P F+ + YS SI EN+   +   K+ ATD D G N  +TY +            F+I + SG +T    LDRE +S Y L I A+D GT P  Q SS TI +T+ID+ND+ P  I    L   + EN+   T V  ++A+D D G N +L F LL N +++ F L    G + +    DRE    Y L+I + D+G   LS    V I+++D +DN PR    +Y+
Sbjct: 1294 VAITVADENDNSPIFASNETSYGIDEGV-SIGSRVAVVTATDRD-EGSNAQVFYSI---VRGDTSAFAI-NAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDS--DKFSIDQRSGIISTADVLDRELVSLYAIQVRV-------------------TDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNL-------SRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPP--QASSITIRVTVIDINDHRP-LINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYN 1830          

HSP 8 Score: 177.563 bits (449), Expect = 3.708e-45
Identity = 178/615 (28.94%), Postives = 281/615 (45.69%), Query Frame = 1
Query:  646 DTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLE--IFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGS---LQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            D  M  + + +  I    +  D E    Y L + A ++     K +  + I V + ND  P+F    Y  ++ EN P   + I V A D D   ++ ITY      +++   S  G+I    PLD ET   + + + A D +      + ITV DVND AP F L+     + E      I+ Q+T  D D    N +LS     +L +     F   +DS+       + T+  FDRE T    +  +   D G+     +   T+ + I D+NDN P+F  A Y+ S++E+  + A ++ VTA+DKD G N  + Y   +  S N   + F +D+ +G VT +  LD E+ S Y L +   D+G+ P   TS     +  ++  +++P    P   +  + EN   GT+V    ATD D   NG L+F ++  +++  F  TI+GS   +  AK  D E   RY L ++  D+G      T  V I I DVND+ P +  P  + K   I  STV               G  ++   A+DLD G      +R+   N    F+ID   G +RV  +L +E    Y++Q+   D G  S+  S ++ + +QDI
Sbjct:    8 DQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAI-VTATDRDSGTNAAITYSLFSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPL-ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDV-GINARLSY----SLVSGDTSYFT--VDSQGV-----IRTKGAFDRE-TKASYQVALRAQDGGSPSR--SGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRY---SFTSGNTNHA-FTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHL---LINVNDINDNPPVFSPSAYQSRVKENTPAGTQVS---ATDRDSSTNGALVFGIIKGNDDGVF--TIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSP-VFSPSNYSK--QIPESTVI--------------GSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDI 576          

HSP 9 Score: 164.466 bits (415), Expect = 4.744e-41
Identity = 177/696 (25.43%), Postives = 304/696 (43.68%), Query Frame = 1
Query:  439 SLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDS--EITYRSADFSSQYFSVSS-KGQIFLKRPLDFETTSLHLIDVQASDNE---FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSE-AANGKLSCW------EPRNLYNKQA--VIFKPPLD--SKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFE--ILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            S   +  + + + D+NDN P F  S    +V E     G ++    A D D +  +  VTY + +  + + F +  T     ++     +D E    YNL I A +S      +   + I V + ND  P F   +    ++E + I S +  V A D DE S  ++ Y      +  F++++  G + +K+ ++ ET   + + ++ASD       ++ ++ + V DVND  P FN       + E   ++  +  +T+   DS+  AN  L         E R   N  +  ++   PLD   K+ YG     T  ++                         T+   +++ + ++ND TP F +  Y+ S+ EN+P    V+KV+A+D+D    G ++Y I  +   + +K  F ID  SG ++    LDRE  S Y + +   D G  P    +  TI I   + N  SPKF        I EN  P +    L ATD DEG N ++ + L  + N+ F     +G +  A+  DRE    Y L I+  D G  P + + T+ + ++D+ND+ P             I++S+++        S+ E+   E  +++  ASD D G NA   F +       +F++D   G +  K  L +E    Y ++I V D G PS      +++ + D
Sbjct: 1182 SQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTAN-GSNILRVLASDPD-AGANGRVTYSIISGNHGNAFRIDSTTGRITVV---GVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSV--LTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKY-------------------------TAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSI--VGGKDSDK--FSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDN--SPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNL--SRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRP------------LINSSSLRG-------SVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVID 1816          

HSP 10 Score: 95.9005 bits (237), Expect = 5.818e-20
Identity = 131/487 (26.90%), Postives = 214/487 (43.94%), Query Frame = 1
Query:  178 IKENQP---GQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSY----------FVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIW---AWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEF---NANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAA--KNP-LTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKD 1566
            + +N P    Q+ IG + E+   ST  +L   ++  +      L Y          F ++S + ++ T T +D EE            Q  L V   D         V I V ++ND  P F   +   SV+E       S+    A DRD      +++Y +     SD F +   +    I+     LD E   LY + +    A N P  N      +TI++++ ND  PKF    Y  S+ EN   +S   ++ A D DE  ++ ITY  +  +  +   +S G I L +PLD E  S + + +QA D+      ++  + +TV+D+ND  P  N +     + E QP+   + +I   D D+   N +L+      L N+   +F   LD+ T     D+ T+V  DRE+      + +     G A   NP L+S   + + + D +DN P F+   Y+V+I E+ P  A +++VTA D D
Sbjct: 1405 VNDNPPVFNSQSYIGSVRENSAQSTS-VLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKS----------QYGLEVTATDS-KYTAKTNVTIRVINLNDITPAFTQQNYTASVREN-SPTSTSVVKVSASDRD---SFGSLSYSIVGGKDSDKFSI---DQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTW---VTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLS-RNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADT-GLNAELTFSL---LSNEHKSVFT--LDNTTG----DISTKVPLDREQ------QAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 206.453 bits (524), Expect = 3.714e-54
Identity = 211/779 (27.09%), Postives = 362/779 (46.47%), Query Frame = 1
Query:  214 KISEDVPLSTQM-----ILRNLSEKINYRFQKQLSY--FVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSL-KGIIRVEINVQDVNDNVPTF-LTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFNA---NTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDND-EGDNGKLLFKLLPNHNENFFYL-----TINGSLQSAKEFDRETTDRYCLQI-EINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPG----FEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            K+SE+  + T +     + +++ + I+Y       Y  F +D+ T  ++T   +D E +           Q  L V   D ++L   +++V + V+DVNDN P F +    ++  +E   G   S+   KAID D+  ++  V Y +  ++   T  + V   +  I +    LD E  + +N  I A +S   ++ +  S+ I++V+IND  P F    Y   V EN P  + ++ V A D+D   +++++Y  +      F++    G I  + PL+ E T  + + ++A D+   A    T+V+ITV D ND  PQF  +     + E       +G++   D D    N ++  +         +++F     +        L      DRE+       +        A   L S  ++ +TI D+NDN P+F K+VY+V++ E+  +  +V++V ATD D G NG  TY+I    +      +F ID+++G +T   KLD EK S Y L + A+D GT P   T +C + I + DV+DN+P F  P+   E++EN   G  V  + ATD D E  + ++ +++   + ++ F +      I  +   +   +RET  RY LQ+  I+    T         I +LDVNDN PR                    +S +   S+ E  G      IL  +A D DEGE+    F I   N+  +F +D + G+L   R L +E    Y++ ++ ED G+P+   S  + + + D+
Sbjct: 1200 KLSENASIGTNVTKITALDKDIGDTISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVT----------QYELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGT--SILQVKAIDADIG-DNAAVLYSIVENV---TDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDIND-NARVRYYISSG---NTSLMFSVNETTGIISTTSTL------DREQNASYTLIITAKDHGIPA---LESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKI----TAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPP--LTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRF-------------------DSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDM 1924          

HSP 2 Score: 166.777 bits (421), Expect = 9.510e-42
Identity = 159/606 (26.24%), Postives = 264/606 (43.56%), Query Frame = 1
Query:  688 LVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSS-QYFSVSS-KGQIFLKRPLDFETTSLHLIDVQASD--NEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRV------RFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLT-INGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            +++   LD E   +Y L + A N  A  Q T   + I V ++ D +P F      V + EN  I + + ++ A+D+D    I+Y  A+      F++ +  G+I     LD E  + + + VQA D  N  +   KVV+ V DVND  P F++        E  PE   I Q+   D D                    A +    +++ T Y   +  T V      + DRE        +        +K   +ST ++++ + DINDN+P+F    Y   + EN P    V+ VTA+DKD+G N  ++Y +  +       + F ID D+G +T    L+RE+   Y L + A D     ++ T+   I +T  + +   P+F        + E+ K G  VG +  TD D  DN ++ + +   +    F +    G + +    DRE    Y L I   D G   L    +V I I DVNDN P      Y+               +T+  S++     ++++  A+D DEG N  F ++I+  +  D+F ID   G++ +K KL  E    YN+ +  +D G P    +  + + + D+
Sbjct: 1144 IIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDTISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDAD----------------IGDNAAVLYSIVENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSK---SSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVL-----YTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHV--PQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYN---------------VTLRESVFLKT--QVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDV 1706          

HSP 3 Score: 152.525 bits (384), Expect = 2.253e-37
Identity = 202/785 (25.73%), Postives = 340/785 (43.31%), Query Frame = 1
Query:  199 QTRIGKISEDVPLSTQMIL-------RNLSEKINYRFQK----QLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLS---LKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMII--QVEAVDEDED---SEITYRSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLID-----------------------VQASDNE----FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGK----YDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILI-----ATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQ-SAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGF---EILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKE 2373
            Q  + KI+E+  + T ++           + ++ Y+F      Q  +F L+S    L     +D E           + + Y++V + + L    L+    V I V D++D  P FL S  LK ++E    +G ++   +A D DV   +N + Y++ +      F +   + +  ++ +  ++D E+  ++ + + A   P  N  T +++ + VV++ND  P F Q  Y   V E++ +   ++  Q++  D D++     + Y      S  F++  + G +++ + LD+E       D                       V A++ +    F+AN  V +T+++VND  P F  +     ++E       I  IT  D D     G L+ +E R     QA  F    D+ T        YD   + +F             +V  DG       +  T+++T+ D+NDN P F    Y+  I EN P    V +VTATDKD G NG +++ I    S   +   F I+  SG VT   +LDRE  + Y L + A D G   + +     + + ++D NDN+P+      L I  N   G   G ++     A D D G NG+L +  +   +  F   +  G LQ S    DRE  D Y L I + D G  P + + TV + ILDVNDN P     D +P        ++    IT+D    E PG     ++   A+D D   N    + +S  ++   F +DP  G L V+++L +E
Sbjct:   49 QPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFE-----------VARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENT-PIGSTVVTVEARDGDVGI-NNPILYEIISGNSDGVFTI---DSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADL-GTFGALT-YELR---GGQAAYFSVNADNGTISAAQILDYDTLRQYQF------------SLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNI----SAGDDGGHFSING-SGLVTTARELDRETIATYTLTVSAYDHGVSSRHK--HVQLTVNVLDENDNTPQIT--DGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYS-MSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAF---DPNPA------QSLATYVITVD----EGPGTINKTLIDINATDPDADANGKVAYSLS-GDEHGFFRLDPVTGELSVRKELDRE 776          

HSP 4 Score: 145.591 bits (366), Expect = 3.965e-35
Identity = 167/583 (28.64%), Postives = 272/583 (46.66%), Query Frame = 1
Query:  460 VEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYR-SADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANG----KLSCWEPRNLY----NKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDI-GRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLK----LDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLE-IFENEKPGTEVGILI--ATDNDEGDNGKLLFKLLPNHNENFFYLTIN--GSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFP 2133
            V I + D+NDN P F  +     V+E     G  + +  A D+DV      ++Y L   +Y+   +   T +    +  ++ L+ E    Y L + A +S    ++    + I V + ND  P+F Q  Y  SV E++ +   + +V   DED  +++ + Y  S+  +S  FSV+ + G I     LD E  + + + + A D+      +NT V+IT+ DVND  P F+ +     + E       + Q+   D D E ANG    K++  +  +++    N   +  K  LD    Y K  LY                 + V        PLT    + + ++D++DN P+F K  YS  + EN      VI V ATD D    +  V Y I++  +     S+F+I   SG +T        L+RE  + Y+L + A  +  + +Q+ S     IT++DVNDN+P+F     +  + E+  P T+  IL   A D DEG++G+++F ++ + NEN  +   N  G L   +  DRE T  Y L +   D+G+  LS + TV I +LD+NDN P L  P
Sbjct: 1385 VAIKLVDINDNSPVFNNTDYYAYVREN-QPAGTPVLVVTASDKDVGTNAK-LSYVLSGVLYTRFAIDPDTGN----ITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPD-EGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLD----YEKTSLYN----------------LTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNT----DSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQK-SLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIV-SGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTP 1934          

HSP 5 Score: 142.51 bits (358), Expect = 3.076e-34
Identity = 145/561 (25.85%), Postives = 253/561 (45.10%), Query Frame = 1
Query:  811 INDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASD---NEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRD-SEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVT-ATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLE-IFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            IND  P F++  Y V+V E+     +I +V A D DE  ++ I Y S    ++++   S G I +  PLD E  ++++++V A++      +  T+V ITV DV D+ P FN +    ++ E       + +IT  D+D  +  +  ++  +P  L+          +D+ T     ++ T    DRE        V        + N ++  + + + + D+NDN P+F    Y++   E +P    +++V A D DIG N  V Y I     +        +++ +G ++  + +LDRE E ++   I A D G   K  T+S    I ++D+NDNSP F        + EN+  GT V ++ A+D D G N KL + L       F      G++ + +  +RE T  Y L +   D        T  V I + D ND+ P+     Y               S+  D+ +    G  + +   +D D  +NA   + IS  N   +FS++   GI+     L +E    Y + I  +D+G P+   +  +++ I+D+
Sbjct: 1082 INDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDTISYSIANGDPYGLFT---------IDNVTG----EIRTVAELDRENVTQYELFVQAKD----SVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSI-----VENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASV--AIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGY-------------AFSVREDVKV----GHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDV 1601          

HSP 6 Score: 140.584 bits (353), Expect = 1.404e-33
Identity = 176/704 (25.00%), Postives = 322/704 (45.74%), Query Frame = 1
Query:  460 VEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLS-ITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYR-SADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVV---ITVVDVNDEAPQFNLNPSF-CRIEEGQPEN-IIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEK------AVYSVSIEEN-NPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREK---------ESFYQLIIVAKDKGT-MPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRY-------CLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS-QKILVRIQD 2466
            V + + +VNDN P F  SS   ++ E I   G  +    A D D+      +TY+L     +  F +   N +   +   + LDY+  + Y  ++   +     Q+  ++ +T+ + ++ND +P+F    Y   + ENLP  +++ QV A D+D  E+  +++  SA     +FS++  G +   R LD ET + + + V A D+  ++  K V   + V+D ND  PQ     +    I EG     +++  I   D D+  +NG+L+       Y+      +  L+S T  G+  + +    DRE         +I+        P T++ T+ +TI D+NDNTP F+       A Y ++++E    ++  +I + ATD D   NG V Y +        E   F +D  +G ++   +LDRE          +  + L I A D+ T +  +++++  ++IT+ D NDNSP+F     +  + E  +PG+ V  + ATD D    GK+++ +  + +EN             ++ + E   R+       C+  +   + K  +  T+ V I + DVNDN P  +F         ++NS                 G  +L+  ASD D+G N    ++++  N  D FSI+   G + V   + +E +  + + +  ED G+PS   +  ++++ ++D
Sbjct:  375 VTLTLINVNDNKPMFAKSSYNYTMDEEITP-GTHIADITATDADLGT-FGALTYELRGG-QAAYFSVNADNGT---ISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDA-GSNGQLT-------YSMSGGDSRFTLNSAT--GRLQI-SPTGLDRE---LKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLS-----GDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNIT-DGDEN-------------RKCEVEKLVRHYNWHKKNCVLCK---ESKCSVERTY-VVIYVDDVNDNDP--VFNQSKYAADVLENSPT---------------GTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKD 1018          

HSP 7 Score: 139.428 bits (350), Expect = 2.778e-33
Identity = 106/355 (29.86%), Postives = 176/355 (49.58%), Query Frame = 1
Query: 1420 LTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIG-PKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEIL---KCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVK-RKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
             ++  +++LT+ ++NDN P+F K+ Y+ +++E       +  +TATD D+G  G +TYE+        + + F +++D+G ++A   LD +    YQ  +V KD G    Q+ +  T+ +T+ DVNDN P+F G P   +I EN   GT V  + ATD D G+NG+L F +    +   F +  +G + +A+E DRET   Y L +   D G +       + +N+LD NDN P++                   + +TI  +I E  G   +      A D D G N    +  S+      F+++   G L++    L +EL   Y++ I V DNG P   +S  + V I D+
Sbjct:  369 FSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYEL-----RGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGF-YQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQI------------------TDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTY--SMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDV 697          

HSP 8 Score: 134.42 bits (337), Expect = 9.792e-32
Identity = 175/662 (26.44%), Postives = 307/662 (46.37%), Query Frame = 1
Query:  154 FDDMIKYA-IKENQPGQTRIGKI-SEDVPLSTQMILRNLSEKINYRFQKQL-SYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGL--SLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYR--SADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASD---NEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKL------SCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLT---STMTISLTIADINDNTPIFEKAVYSVSI-EENNPV-DAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP---------KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL--TINGSLQSAKEFDRETTDRYCLQIE 2037
            F++   YA ++ENQP  T +  + + D  + T         K++Y     L + F +D +T  + T+  ++ EE           G   L +   D    + +G  RV I V D ND+VP F  S    SV+E +  VG ++      D D++ ++  V Y + +    +T ++   N++  I+     LD E+   Y L I A +      ++  S+ I + ++ND +P F +  Y V++ E++ + + ++QV A D DE  + + TY+  + D    ++  ++ G I +K  LD+E TSL+ + V A D           V I V DV+D AP F+       + E       +  +   D D+EA++ ++         +   L  +Q+ +      + T  G  +  T  R++ +                 ++  LT   S +   +T+ D+NDN P F+   Y  S+ E+  P+ DA ++ V A D D G +G + + I    S N E  +F +D+ +G +T T  LDRE  SFY L+++A+DKG      +SS T+NIT++D+NDN P    P             + EN   G  VG++ A D D  +   L++  + N  E  +++    +G L++    DRE +  + L ++
Sbjct: 1399 FNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNA-------KLSYVLSGVLYTRFAIDPDTGNITTREPLNREE----------TGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVK-VGHTVGRVATTDEDIN-DNARVRYYISS---GNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITL---NCTPSGCLNRETHARYELQ-------------VAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTI---VSGN-ENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKG--EPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTKN---LIYYYITNTEEQKYFILNETSGELRTRITLDREDSSVHYLYVK 2013          

HSP 9 Score: 132.88 bits (333), Expect = 3.040e-31
Identity = 184/648 (28.40%), Postives = 278/648 (42.90%), Query Frame = 1
Query:  496 PTFLTSSILKSVKEVIYGVGKSMELQ-KAIDRDVSKEHNTVTYKL-DADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNL-----------AIWAWNSPADNQK-------------TKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDS--EITYRSADFSSQYFSVSS-KGQIFLKRPLDFETTSLHLIDVQASDN----EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP-IFEKAVYSVSIEENNPVDAKVI-KVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTAT-LKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLE------IFENEKPGTEVGILI---ATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRET---------TDRYCLQIEINDQGKTPL----SITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLD 2259
            P FL S  +  V+E +   G+ +  Q +  D D +     V Y L  AD  SD F +  T+ +   L + K LDYE+   +             + W W    + +K                S+T+ ++N+ND +P F +  Y  +++E +   + I  + A D D  +   +TY      + YFSV++  G I   + LD++T   +   +   D     +  A   V +T+ DVND  P+F   P    I E  P   I+ Q+T  D+DS   NG+LS       +N  A       D   F   G   + T    DR ETI      +   D G +       +T++  + D NDNTP I +    + +I E       ++  + A D D G NG +TY      SM+   S F ++S +G +  +   LDRE +  Y LII   D G+ P   T+S T+++TI+DVNDN+P F  P   +      I  +E PGT    LI   ATD D   NGK+ + L  + +  F    + G L   KE DRE+           R+ L I   DQ  TP+    S T  V I + D NDN P+    +Y  +                 LS    PG  +++  A+D D
Sbjct:  256 PAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGAD--SDKFAIDPTSGT---LYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDS-GENGRLS-------FNISA-----GDDGGHFSINGSGLVTTARELDR-ETIATYTLTVSAYDHGVSSRHKHVQLTVN--VLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTY------SMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPP--NTNSTTVHVTILDVNDNTPAF-DPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQA-TPISDRKSATVRVSITVRDTNDNSPQFQSQNYETR-----------------LSEAARPGSNVIQVSATDQD 855          

HSP 10 Score: 107.071 bits (266), Expect = 2.429e-23
Identity = 204/822 (24.82%), Postives = 327/822 (39.78%), Query Frame = 1
Query:  271 KINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTG---EMGQLY-LVVNVWDGLSLKGI--IRVEINVQDVNDNVPTF------LTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKL---------YNLAIWAWNSP---ADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDED--SEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGL-------VTYEIDNLRSMNP-----------EKSLFVID-SDS-------GWVTATLK---------------------------------LDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESP-GFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRV-KRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            ++ Y      S F L+S T  L+               PTG   E+   Y L++NV D  S        V + + DVNDN P F        ++ + +V E    + K++    A D D +  +  V Y L  D +    +  VT +    L ++K LD E  ++         + L I A +     +D +   + ++I V + ND  P+F+ Q YE  + E     S +IQV A D+D +   ++ Y   D          K    L R  ++   +  L        E    T VVI V DVND  P FN +     + E  P    + ++   DRD + ANGK++ ++  N     A          T  G  D          E +      +   D G   +  T    + +T+ D NDN P F    Y   I EN+PV + +  V   D+ I  + L           +   R   P           EKS++ ++ S+S       G VTAT +                                 LDRE ++ Y L + A +   +   Q ++  ++IT+ DV D+ P F      +++ EN   GT V  + A D D GD   + + +        F +  + G +++  E DRE   +Y L ++  D     +S    V + + DVNDNPP    P Y  +Y W                  ESP G  IL+ +A D D G+NAA  + I + N  D  +++   G++ +   +L +E+   +N  I   D+G PSK  +  + +++ DI
Sbjct:  634 QLTYSMSGGDSRFTLNSATGRLQI-------------SPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPD-ADANGKVAYSLSGDEHGFFRLDPVTGE----LSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEK----LVRHYNWHKKNCVLCKESKCSVE---RTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRD-QGANGKIT-YKLTNGNKDDAFSINNVTGEITVAGVID---------REAVHTFVLTVQAEDQGEPSSRKTFAEVV-ITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMV--PDQKISSSTLRPRSSPRAPAALLTAREKRPITLINDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAAN--IVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGD--TISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVNL-VSDLLKVVVQVEDVNDNPPVFSMPGYTIEY-W-----------------EESPEGTSILQVKAIDADIGDNAAVLYSI-VENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDI 1392          

HSP 11 Score: 92.8189 bits (229), Expect = 5.018e-19
Identity = 114/479 (23.80%), Postives = 210/479 (43.84%), Query Frame = 1
Query:  412 LVVNVWD-GLSLKGI-IRVEINVQDVNDNVPTFLTS-SILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWN--SPADNQKTKLSITIRVVNINDMEPKF------KQQKYEVSVEEN-LPINSMIIQVEAVDEDEDS--EITYRSADFSSQYFSVSS-KGQIFLKRPLDFETTSLH---------LIDVQASD------NEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQT 1758
            L V+ +D G+S +   +++ +NV D NDN P      +I  ++ E   G    +    A+D D +  +  +TY +        F L        I      LD E    Y+L I   +  SP +   T + +TI  +++ND  P F          Y ++V+E    IN  +I + A D D D+  ++ Y  +     +F +    G++ +++ LD E+  +          L+D+ A+D      +  +A  +V ITV D ND +PQF       R+ E       + Q++  D+D E        ++ + +YN          + +     Y+ + +     +E                +K  +  T  + + + D+NDN P+F ++ Y+  + EN+P    V++V A+D+D G NG +TY++ N      +   F I++ +G +T    +DRE    + L + A+D+G    ++T
Sbjct:  566 LTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPD-AGSNGQLTYSMSGG--DSRFTLNSATGRLQI--SPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTI--LDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLE--------YKGKVIYNITDGDENRKCEVEKLVRHYNWHKKNCVLCKE----------------SKCSVERTYVV-IYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTN----GNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKT 1008          

HSP 12 Score: 73.1738 bits (178), Expect = 4.968e-13
Identity = 66/215 (30.70%), Postives = 101/215 (46.98%), Query Frame = 1
Query:  433 GLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDT--FMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYR--SADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASD 1059
            GL+ +G     + V D NDN P F     +  + E    VG ++    AID D S  ++ V YK      + T  F L   N     L L   LD+E  + Y L + A +      +++ ++ I V +I+DM P+F Q  Y   +EEN PI S ++ VEA D D   ++ I Y   S +    +   S+ G I +   +D E T +  I V+AS+
Sbjct:   23 GLARRGSKFFFLIVDDYNDNAPVFTEQPYMAKIAENAR-VGTTILKISAIDAD-SGTNSQVQYKFSNATATQTPFFSLNSVNGE---LTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASE 232          

HSP 13 Score: 71.633 bits (174), Expect = 1.504e-12
Identity = 117/492 (23.78%), Postives = 199/492 (40.45%), Query Frame = 1
Query: 1090 ITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXS-PKFIGPKKLEIFENEK----PGTEVG-ILIATDNDEGDN-GKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQ------------------------IEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGK-PSKMHSQKILVRIQDI 2469
            + V D ND AP F   P   +I E       I +I+  D DS   N ++  ++  N    Q   F   L+S    G+  L   + F   E       V+I  D G  K  L S  T+ + + DI+D  P F ++ Y   IEEN P+ + V+ V A D D+G N  + YEI +  S      +F IDS++G +T    +D EK   +++ + A +   +P   +++    +  +   +++ P F+  + + IF+  +    PG  V   L  TD D+     ++L+ L+   ++ F     +G+L   K  D E    +                           +          S   +V + +++VNDN P      Y+  YT         E IT        PG  I    A+D D G   A  + +        FS++   G +   + L  + +  Y   ++V+D G    ++    + V +QD+
Sbjct:   34 LIVDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADS-GTNSQVQ-YKFSNATATQTPFFS--LNS--VNGELTLGGPLDF---EVARSYMLVVIAEDLGVPK--LESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNS----DGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASE---VPDPNSNTTVTVVVTVVDVNDNRPAFL--QSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYN--YTM-------DEEIT--------PGTHIADITATDADLGTFGALTYELR-GGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDV 487          

HSP 14 Score: 56.6102 bits (135), Expect = 5.640e-8
Identity = 58/223 (26.01%), Postives = 106/223 (47.53%), Query Frame = 1
Query:  445 KGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQ-KAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNIND--------MEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ-YFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFNANT 1080
            K ++   I V DVNDN P F + S ++SV E    +  +  L  KA D D   E   + + + +   +  F +   ++   +L   + LD E    Y+L + A +       + +++ I V+++ND        M+    +++   SV+ENL     +  V A D D  + I Y   +   Q YF ++ + G++  +  LD E +S+H + V+AS+++ N  T
Sbjct: 1805 KSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGD-EGESGEIIFTIVSGNENGVFQM---DNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTKNLIYYYITNTEEQKYFILNETSGELRTRITLDREDSSVHYLYVKASNDKLNITT 2023          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 194.897 bits (494), Expect = 1.608e-50
Identity = 206/744 (27.69%), Postives = 334/744 (44.89%), Query Frame = 1
Query:  301 SYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKG-IIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDT---FMLKVTND-----------SFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYR-SADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEF---NANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRI 2460
            S F LDS+T +++TK  +D E          +    + V+    G+  K  +  V INV D NDN P    + +                  KAI  + S  +  + Y L  D  S+T     LK+TN             F  + L+K LD E    YNL +   +    ++ T   + I V ++ND  P F    Y  ++ E     S ++Q+ A D DE  +  ++Y  +      +F V    G +   +PLD E  S   I + A D+       +T V +T++D ND  P+F  +     I EG      + Q++  D DS   NG+++ +E  +   +   +F+  L+++T      L+T+ + DR ET       ++  D G  +  L S++ + LTI+DINDN P+F    Y  SI EN P   K+++VTATD D G N +++Y+I            F IDS +G ++    LD E E F+ LII AKD G   K    +  +N+T+++  DN P F+       ++EN   GT VG + AT  D+  NG + + ++     N F + +  G ++   + DRE   +Y L +        PLS   TV I +LD NDN P+                     S+ +D+      G  +    A DLD G+N    ++++  N   +  I+   G++++ RKL       Y VQ++  D+G P +  +  I + +
Sbjct:  254 SIFDLDSSTGVIRTKQNLDFEV---------KNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYL------------PPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDS-GDNGRIT-YEISSSDAQVNGLFE--LNTQTGV----LWTKSQLDR-ETKSLYSFTVLAKDHGDPQ--LMSSVKVELTISDINDNAPVFYPVEYFASIMENEP-PGKLLQVTATDADEGTNAVISYDIIG----GNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGN--KYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDK--NGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQF-----------------STSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLT-SNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITL 938          

HSP 2 Score: 180.644 bits (457), Expect = 3.866e-46
Identity = 220/781 (28.17%), Postives = 325/781 (41.61%), Query Frame = 1
Query:  172 YAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLID----------LEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVT---NDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDS--EITYR---SADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEF---NANTKVVITVVDVNDEAPQFNL------NPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNE--NFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNG 2418
            + ++E QP  T +GK+                      F+     F  +SNT ++ T   ID          L  L P + P                      I V++ V D+NDN P F T      ++E +  V  +  +  A D D +  + TV Y + +   + TF L  T     S   ++ KK LD E    Y L I A +           I I +++ ND  P F Q  Y  S+ EN      I++V A D D  S  +I Y     A  S+  F + SS G I  K+ LDFE  + +  +V ASD      N    V I V+D ND +PQ  +      N       E    N  I  I + D+DS       S  E +         FK       F G Y +  +   DRE        + +      +++ L   +   + + D+NDN+P F    Y+ +I E     + V+++ ATD D G NG V+Y I     +      F +D  SG VT    LDRE+ S   + I A+D G+ PK  T S T+ +TIID NDN P+F+    K  I E    G  V  + ATD D GDNG++ +++  +  +    F L T  G L +  + DRET   Y   +   D G   L  +  V + I D+NDN P     +Y    + ++N               E PG ++L+  A+D DEG NA   + I   N+   FSID   G++     L  E+   +++ I  +D G
Sbjct:   14 FHVQEEQPPGTYVGKVDG-----------------ASAFEGSPKQFGFNSNTGVISTTARIDRETTTQISLQLRTLNPSNQP----------------------ISVQVQVDDINDNEPRFPTLYYTLRIRESM-DVNTTNPINTATDPD-AGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTN----SQTELKITNGDDEGCFK-----VEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVL---IDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDL----GWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPK--TGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFA--SIMEN---------------EPPG-KLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGG 717          

HSP 3 Score: 165.236 bits (417), Expect = 2.433e-41
Identity = 203/792 (25.63%), Postives = 345/792 (43.56%), Query Frame = 1
Query:  160 DMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQ--LSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITYRSADFSSQ-YFSVSSKGQIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYG----KYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLT---STMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKK---LEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELI--GDYNVQIIV--EDNGKPSKMHSQKILVRIQD 2466
            +M  + + EN P  T +G++            ++ +  I+Y        + F++DS   I+K    +D EE             L ++  V     L     V I V D NDN P F TSS++  + +  + VG+ +    A+D D  K +  V Y+L ++      +L + + S  I + +K  D +  + Y + + A +S +  Q + ++I I  ++IN   PKF    Y   V  + P++     V AVD+D  ++ ++ Y     + +  F +   G++++++ L       + + V+A+D     F+A+  V I + D ND    F  N     + E      ++G +     D                +++   I    + S++ +        + TRVR DREE I +    + +    A  N  T       + +T+ D+NDN P+F +AVY++++ E +   + V ++ A D D G N    Y + +   M+     F I+S +G +  +  LDRE  S Y L++ A D         S+  I IT+ D ND  P F  P+    + I E+   G+ V  L A+D D G NG + + +   +    F + +  G L  AK  D ETT  Y L I   D G  PLS T  V +N+LDVNDN P  +FP                + +T+ +    + GF + +C ASD D G NA   F +        FS++     +     +  E +  G  + Q++V   D G P     + I V++ D
Sbjct:  744 EMYNFTVYENVPKGTLVGRV--------YATTKDKNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKA--------QYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDI-DGTWLVGQVVYNAAAVDLDAGK-NGLVRYQLTSNAEG---LLWINSTSGVIKLARKLTDGDETQ-YTVQVLASDSGSPPQHSTMTIHI-TLSIN-HPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALD----------------HSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDK----FFINSSTGELHLSKTLDRETTSSYNLVVKATDASN--ANLYSTAKIEITVGDSNDQRPVF--PESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAP--LFP---------------TQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTD 1470          

HSP 4 Score: 151.754 bits (382), Expect = 4.504e-37
Identity = 164/595 (27.56%), Postives = 265/595 (44.54%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDS----EITYRSADFSSQYFSVSSKGQ-------IFLKRPLDFETTSLHLIDVQASDNEFNANTK---VVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSC---WEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIF----------EKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLK--LDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIG-PKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTI-NGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDP--DIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            +S+ ++V +IND EP+F    Y + + E++ +N+      A D D  +    + T  S D ++  FS+ +          +  K+PLD ETT  + +++ A+D    A      + IT++D ND AP F  N     I E     + I +++  DRDS  +NG +     W+      +   IF   LDS T      + T+   D E        VI       +KN L    T+++ + D NDN+P            +KA+ S    EN+ ++  +  +  TDKD   N     +I N       K  F+     G+    L+  LDRE   FY L +   DKG +P + T    +       ++ SP F        I E  + G+ V  L ATD DEGDNG + + +   ++  +F +   +G + +AK  DRE      + I   D G  P + + TV + I+D NDN PR +   Y             K +I+   SI    G  +L+  A+D+D G+N    + IS  +     +F ++ Q G+L  K +L +E    Y+  ++ +D+G P  M S K+ + I DI
Sbjct:   79 ISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGD-NTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDS-GSNGDIKYAIDWDAI----QSNSIFD--LDSSTGV----IRTKQNLDFEVKNSYTFNVIASDGGVPSKNDL---ATVTINVLDTNDNSPQLKITYLPPHNGDKAIRS----ENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFL-----GFYFIQLQKPLDRELVPFYNLTLNVTDKG-VPSRSTLGFVLIDVTDVNDN-SPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSY-------------KGTISEGASI----GATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDI 630          

HSP 5 Score: 136.346 bits (342), Expect = 2.336e-32
Identity = 167/670 (24.93%), Postives = 290/670 (43.28%), Query Frame = 1
Query:  157 DDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY--RSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNE---FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTF---YGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNP-LTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK------KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFF-YLTINGSLQSAKEFDRETTD-RYCLQI-EINDQGKTPLSITHTVCINILDVN 2106
            ++  ++A+ EN    T +G       L    +  + ++ I Y      S+F +D  +  + T+  +D EEL  +      + Q   + N       K I+ V   V D+NDN P F  +    +V E+    G  +   KA+D D   ++    Y L +    D F +   N S   L L K LD E    YNL + A ++   N  +   I I V + ND  P F +  Y V++ E+  I S++I + A D+D  ++  I Y   + + ++ +   S+ G++ + + LDFETT L+ + + A D+     ++   V + V+DVND AP F   P    + E       +G+ T  DRD+   N  ++     ++Y++          SKTF       ++ T    D E          +V       +P L++  +I++ + D NDN+P F     + +    N     V+ +TA D D   NG VTY I     ++     F +   +G +    ++  +  + YQL I A D G  P +QT +       + V    P   GP       +  + EN+  GT V  ++A       NG + + L  + ++  F  +   G +++ +  DRE     + L +  ++ QG +  + + TV I + DVN
Sbjct: 1052 NNTFRFAVAENSSPGTLVGT------LVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIV--TVTDLNDNAPVFSRAVYAITVSELSL-PGSPVFRIKAMDAD-EGDNAKFFYSLVSGTGMDKFFI---NSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDT-GTNAHIAF----SMYSQTP--------SKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN-----VMTITAEDPDRNSNGKVTYSI-----ISGNNGYFNLHPSTGQLQMIHQI-PDNPTIYQLTIQASDGG-QPSRQTQTV------VSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 6 Score: 130.954 bits (328), Expect = 9.226e-31
Identity = 152/606 (25.08%), Postives = 256/606 (42.24%), Query Frame = 1
Query:  688 LVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMI--IQVEAVDEDEDSEITYRSADFSSQYFSVSSK-GQIFLKRPLDFE------TTSLHLIDVQASDNEFNANTK---VVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKY-------DLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETT----DRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSK 2430
            L ++K+L       Y+L + A +    +    + +TI + + ND    F    +  +V EN    +++  +   A+D     +I Y S   S  +F+V  + GQI  +  LD E       ++++++  +A  N+         V++TV D+ND AP F+       + E       + +I   D D E  N K                F   L S T   K+       +L+     DRE T      V       A+   L ST  I +T+ D ND  P+F ++ Y+V+I E+  + + VI + A+DKDIG+NGL+ Y I N        ++F ++S +G +     LD E    Y+L I A+D G +P   +S+  + + ++DVNDN+P F   P  L + EN   G  VG   A+D D G N  + F +        F + +    + +    D ET     D + L +   DQG   LS   ++ + + D NDN P  + P      + ++                      ++   A D D   N    + I +  +   F++ P  G L++  ++       Y + I   D G+PS+
Sbjct: 1002 LYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVY-SLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDAD-EGDNAK----------------FFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATD---ASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISN----GNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIP--LSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN----------------------VMTITAEDPDRNSNGKVTYSI-ISGNNGYFNLHPSTGQLQMIHQIPDNPT-IYQLTIQASDGGQPSR 1556          

HSP 7 Score: 113.235 bits (282), Expect = 3.080e-25
Identity = 173/759 (22.79%), Postives = 302/759 (39.79%), Query Frame = 1
Query:  307 FVLDSNTSILKTKTLID--LEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVN--DNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYR---SADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEF--NANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRN-------------LYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREK--------------ESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFI-GPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHN-ENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            F +DS+T ++ T   +D  +EE               L+++  DG +        +NV  +N  DN+P FL      +V E +        L   +      ++ +++Y + +   ++ F++  T     I+ +   +D E    Y LA+ A          + ++ I V++ ND  P+F      V ++    +  ++    AVD D       R   +++     +  S+ G I L R L     + + + V ASD+      +T  +   + +N   P+F L+     +   QP +     +   D+DS   NG+L    P+              LY +++++       +   G YDL  R                    DG   +  ++++ +++ I D ND+  +F    +  ++ EN+     V  + A   D  R   + Y      S+   +S F +D  SG +T  ++LDRE+              E+ Y    + +DK  +    T           +NDN+P F      + + E   PG+ V  + A D DEGDN K  + L+     + FF  +  G L  +K  DRETT  Y L ++  D     L  T  + I + D ND  P  +FP+    YT          +IT D  I    G  ++   ASD D G+N    + IS  N   +F ++   G L V + L  E    Y + I  +D+G      +  + V + D+
Sbjct:  684 FSIDSSTGVISTLASLDHEVEEF------------FSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENV----PKGTLVGRVYATTKDKNGSISYAIVSGDPTNLFLVDSTGG---IIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSIN-HPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDS-GKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLL-------QALKGSYDLIVRA------------------TDGGVPS-FSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVY------SLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTD----------LNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRP--VFPE--SDYTV---------NITEDALI----GSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDV 1362          

HSP 8 Score: 107.457 bits (267), Expect = 1.805e-23
Identity = 115/393 (29.26%), Postives = 183/393 (46.56%), Query Frame = 1
Query: 1327 LYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATL------KLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKL-EIFENEKPGTEVGILIATDNDEGDNGKLLFKL---LPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIG--ILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + T  R DRE T     ++  +       NP    +++ + + DINDN P F    Y++ I E+  V+      TATD D G NG V Y I    +     + F + + +    +TL       LDRE   FYQL I A D+GT        C INITI+D ND++P F     L  I EN KPG  +  + A D D G NG + + +       N  F   +  G +++ +  D E  + Y   +  +D G    +   TV IN+LD NDN P+L    Y P +    +  ++ E+  I+ +I       IL    +D D   N+    +I+  +D   F ++  +G   +++++ L +EL+  YN+ + V D G PS+     +L+ + D+
Sbjct:   51 ISTTARIDRETTTQISLQLRTL-------NPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTI----ASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGT--PALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKIT-YLPPHNG--DKAIRSENSLINTNIA-----YIL---VTDKDSNTNSQTELKITNGDDEGCFKVE-FLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDV 418          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 193.741 bits (491), Expect = 4.354e-50
Identity = 210/788 (26.65%), Postives = 346/788 (43.91%), Query Frame = 1
Query:  175 AIKENQPGQTRIGKISEDVP--LSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGL--SLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDS--EITYRSADFSSQ-YFSVSS-KGQIFLKRPLDFETTSLH--LIDVQASDNEFNAN-TKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQ----ITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEI------DNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDP-DIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            ++ E+    T +  +S   P   S  MI  ++S   N       +YF +D  T ++ TK  +D E L           + +  V   DG   SL+G + + INV DVNDN P F  +     + E    +G  +   +A D D           L++D   D     +   S  + V+KK LD E+   Y L + A +     +   +++ I ++++ND  P+F ++ Y  ++ E++P+N ++  V A D D+ S  E+ +     +   +FS++   G++ +K+ LD+E   +   L+  Q     F  N T V I ++DVND APQF ++  F   +   PEN  +GQ    +  +D+D    NG+++    +N           P       G   +  +   DRE+       +         K     T  I++T+ DINDN P F +  Y  SI EN+     V++V A D D G   +V Y I      D    +NP+          G +T +  L+   +  Y   + A D G +    +S+  + + + D N ++P+F       E+ E+   GT V  ++ATD D G N K+ + +     E F      G +++A   DRE  D Y  ++   D G   L     V I+I DVNDN P  + P Y  K          +E I         PG  +++  ASD D G+NA   +  +   D    F+ID   GI+R  + L +E I +Y + ++  D G P    S K+ V ++D+
Sbjct:   28 SVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNL---MSATYFSIDQITGVITTKRGLDREFL----------DRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPE-DKSIGDFVLAVRASDADSGSNGEVKYCILNSD--GDNSAFSIGEVSGAVTVMKK-LDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQF-VSSHF---QTMIPENYAVGQEFYRVQAYDKD-HGTNGEITFSFMQN---------DLPFSINENTGGISI--KEELDREKVPKFTFGIKARDKGVPFKE---GTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVV-YSIVSSSGHDRCFRINPQ----------GLITLSCTLNYNTKHVYVFSVSASD-GML----SSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPE-FSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKV---------REDI--------RPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDV 745          

HSP 2 Score: 163.31 bits (412), Expect = 1.339e-40
Identity = 157/566 (27.74%), Postives = 266/566 (47.00%), Query Frame = 1
Query:  460 VEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPI------LVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDED-SEITYR--SADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGP-KKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTIN-GSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRL 2124
            V+I + DVNDN P F++S     + E  Y VG+     +A D+D    H T     + +I   TF     +  F I      + +K+ LD E+   +   I A +     ++    ITI +++IND  PKF Q++Y  S+ EN    + ++QV+A+D D   + + Y   S+    + F ++ +G I L   L++ T  +++  V ASD   ++   V + V D N  AP+F        ++E       +  +   DRD+  +N K+S       Y+   ++ +  +D  T   K    T    DRE+  D  +  +   D G  +  L +   + + IAD+NDN P+F K  Y   + E+     +VI+V+A+D DIG+N  + Y   +  S    +  F IDS  G +     LDRE    Y+L +VA D+GT P Q  +S  + + + DV D+ P F  P  ++ + E+  P + V  + A   D      +++ ++  ++   F +  N G++Q+  + D ET   Y L +       +P     TV + + D+NDN P L
Sbjct:  325 VDIALIDVNDNAPQFVSSHFQTMIPEN-YAVGQEFYRVQAYDKD----HGT-----NGEI---TFSFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDT-GSNAKIS-------YSIATLVPEFSVDETTGVIK----TAGSLDREKV-DTYRFEVTATDHGIPQ--LKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIY---SFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQ--ASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRAT---LSPFFTETTVMVYLKDINDNTPVL 854          

HSP 3 Score: 150.984 bits (380), Expect = 7.529e-37
Identity = 163/666 (24.47%), Postives = 281/666 (42.19%), Query Frame = 1
Query:  454 IRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEF---NANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAAN---------GKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNE--NFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQI 2400
            + V+I + DVND  P F       +++E +  V + +   +A D D    +  V +++ +    + F +   N    +   K+ LDYE   ++NL + A +        + ++ I ++++ND  P+F    ++  + EN  +     +V+A D+D   + EIT+        +    + G I +K  LD E        ++A D          ++ IT++D+ND  P+F+       I E       + Q+   D DS   N         G   C+      N Q +I    L     Y    +Y                        A+   L+ST  + + + D N + P F++  YS  ++E+  +   V+ V ATD+D G N  ++Y I  L    PE   F +D  +G +     LDREK   Y+  + A D G +P+ +  S  + I I DVNDN P F+ P  + ++ E+ +PG  V  + A+D D G N ++++    N +    F   +  G +++ K  DRET   Y L +   DQG  P   +  V + + DV D+PP    P Y          TV +++          P   ++  +A   D        + I   N P +F I+P  G ++   KL  E   +Y + +
Sbjct:  218 VTVKITLLDVNDCTPQFSKKVYSATIREDV-PVNQLVTTVRATDCD-QGSNGEVFFEIVSGNDMNFFSINRINGEVRV---KQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFR----INPQGLI---TLSCTLNYNTKHVYV-------------------FSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLV---PE---FSVDETTGVIKTAGSLDREKVDTYRFEVTATDHG-IPQLKAKS-FVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYE--------VTVPEDT---------PPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTV 827          

HSP 4 Score: 80.8777 bits (198), Expect = 2.709e-15
Identity = 86/334 (25.75%), Postives = 151/334 (45.21%), Query Frame = 1
Query:  211 GKISEDVPLSTQMIL-------RNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTV-TYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADF---SSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAP---QFNLNPSFCRIEEGQ 1167
             ++ ED  L T ++           + KI+Y     +  F +D  T ++KT   +D E++        +  +  +         LK    V I++ DVNDN P FL  S    V+E I   G+ +E+  A D D+ K    + ++  + D    TF +  T     I+   K LD E    Y L + A +      +  + + + + ++ D  P F++  YEV+V E+ P  S +I V+A  +D   E     +     S Q F ++ + G I     LD+ET S + + V+A+ + F   T V++ + D+ND  P    F++N +   ++EG+
Sbjct:  550 AEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGVIKTAGSLDREKV--------DTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVS-ASDADIGKNAQIIYSFASNGD-GQGTFTIDSTQG---IIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATLSPFFTETTVMVYLKDINDNTPVLEAFHMNIN---VQEGK 867          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 191.045 bits (484), Expect = 4.758e-50
Identity = 208/751 (27.70%), Postives = 334/751 (44.47%), Query Frame = 1
Query:  301 SYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGL-SLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTF--MLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSIT-IRVVNINDMEPKFKQQKYEVSVEEN----LPINSMIIQVEAVDED--EDSEITYRSADFSSQYFSVSSKGQIFLKR-----PLDFETTSLHLIDVQASDNEFNAN---TKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVR--FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFK--LLPNHNENFFYLTINGSLQSAKEFDRE-----TTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            S F LD NT ++KT   ++ ++    +   G             GL S     RV I V D+NDN P F  ++   +V E    VG S+    A D D S ++  VTY + A      F  + KV+N     + +   LD E    YNL I A +      +T ++I  +R+++ ND  PKF   +Y  S++EN    +P+  M   + A D D   ++++ YR     S  F+V+ +  +   R      LD E T+ +   V A+D     +    +VVI V+D ND  P+F  +     I E       + ++T  D DS   NG++                    + K   G+ D   RV    DRE     V  V  +     + +P     T+++T+ D+NDNTP F K  ++V + E   V + ++  TATD D G N  +TY +            F I+S++G VT T  LDRE +  Y   + A+D G +     S+  +N+ I D NDNSP+F   + + ++ +    GT V  + A D D G+NG + +   +LP     F  +   G++ ++ + DRE     T   Y L + + D G T  +    + I++ D NDN P+    +Y    T ++N  V               G ++    A D D G N+   +  SL     +FSI+P  G +R+++ + +E   +Y+V I   D G P      K+ V + D+
Sbjct:   55 SDFTLDPNTGMIKTARNLERQQTFSYNLTIGAADH---------GLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFEN-SPVGTSLLDVTATDAD-SGQNAYVTYSVTAGDSHGLFRAVTKVSNHG--TIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQ-MASSIMATDRDIESNADVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDS-GLNGRIFFS------------INSGSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAID---GSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSM--------SYPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGGGLE----SNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILILP-----FIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEY--SATVLENMPV---------------GTKVTMVTARDEDSGINSQIMY--SLTGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDV 739          

HSP 2 Score: 164.851 bits (416), Expect = 9.826e-42
Identity = 187/719 (26.01%), Postives = 310/719 (43.12%), Query Frame = 1
Query:  394 EMGQLY-LVVNVWDG---LSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAI---DRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLK----KALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNEFN---ANTKVVITVVDVNDEAPQFNLNPSF-CRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLY----NKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLI-----IVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQD 2466
            E+   Y L +   DG   +S   I    + + D NDNVP F  +    S++E   G G  +++  +I   DRD+    + V Y+L+    SD+    V N    ++  +     +LD+ER   Y   + A +      ++   + I V++ ND  P+F     + ++ E   I   + +V A D D   +  I +     S   F +  S G + +   LD E  ++++++V A D  ++       V +T+ DVND  P+F   P+F   + EG     +I   T  D D + +N  ++       +    N  +V    PLD +T    Y      R                  DG     L S + +++ I D NDN+P F    Y   + +  PV   V+ V A D+D+G NG VTY I  L         F+I  D+G +  + KLDRE++S Y L+     +   D G    Q TS   +NI++ D NDN P+F   +    + EN   GT+V ++ A D D G N ++++ L       F      G ++  K  +RE  + Y + I  +D+G   LS    V +++LDVNDNPP  +F     + T  + +    E               +++  A+D D   N    + I +     +F+I+   G++R +  L +E    Y + ++  D G    M    I V + D
Sbjct:  183 EVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQEN-SGPGVPVQMASSIMATDRDIESNAD-VRYRLNG---SDSIQFAV-NPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFT-KPAFNVDVSEGVAVGSVIVNATATDPD-QGSNAAITYSMSYPGFAINSNTGSVTITRPLDRETKQ-AYSFTVHAR------------------DGGG---LESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILILP--------FIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGV--TQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDGV-FSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPP--VFTSRVYERTMSEGNAAAGEF--------------VVQVNATDADVERNGHVTYTI-MHGALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVID 843          

HSP 3 Score: 148.673 bits (374), Expect = 1.279e-36
Identity = 154/576 (26.74%), Postives = 265/576 (46.01%), Query Frame = 1
Query:  433 GLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDS--EITYRSADFSSQYFSVSSK-GQIFLKRPLDFETTSLHLIDVQASD-NEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREE----TXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFE------NEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPP 2118
            G   + +  V I+V D NDN P F+ SSI  ++ E    +G+S+    A D D S  +  + + +++      F +  ++    ++ +  +LD E   +Y L + A +     ++   ++T+ + ++ND  PKF +  + V V E + + S+I+   A D D+ S   ITY     S   F+++S  G + + RPLD ET   +   V A D     +N  V + + D ND +PQF        + +  P   I+  +   DRD    NG ++           A++  P +         ++ T  + DRE+    T+      + V D G  +   TS   +++++ D NDN P F ++ YS ++ EN PV  KV  VTA D+D G N  + Y      S+     +F I+  +G +     ++RE +  Y + I A D+GT     +S   +++ ++DVNDN P F       ++E      N   G  V  + ATD D   NG + + ++      F      G +++    +RE+ D Y L +   DQG  P     T+ ++++D NDN P
Sbjct:  311 GTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAA-SIGQSVARVTANDPD-SGLNGRIFFSINSG-SEGKFEIGRSDG---VVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYS---MSYPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGGGLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDV-GNNGHVTY----------AILILPFI---IVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQ--FTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMY------SLTGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGT--PVLSSDAKVHVHVLDVNDNPPVFTS----RVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDNTP 849          

HSP 4 Score: 87.0409 bits (214), Expect = 2.317e-17
Identity = 121/453 (26.71%), Postives = 186/453 (41.06%), Query Frame = 1
Query:  217 ISEDVPLSTQMILRNLS---EKINYRFQKQLSY--FVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLY-LVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYK---LDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWN-SPADNQKTKLS----ITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDE--DSEITYRSADFSSQYFSVS-SKGQIFLKRPLDFETTSLHLIDVQASDNE---FNANTKVVITVVDVNDEAPQFNLNPSFCRIEEG-QPENIIIGQITIWDRDSE-----------AANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPI 1479
            +SE V + + ++    +   +  N      +SY  F ++SNT  +     +D E             Q Y   V+  DG  L+  + V + + D NDN P F T      V +    VG  +    A DRDV    + VTY    L   I  DT  +  +            LD E+  LY L  +  N S  D+  T+ +    + I V + ND +P+F Q +Y  +V EN+P+ + +  V A DED   +S+I Y S       FS+  S GQI L++ ++ E    + + + ASD      +++ KV + V+DVND  P F        + EG       + Q+   D D E            A G  +  E   +   Q V+ +   +SK      D YT +   R++              GA   P     TI + + D NDNTPI
Sbjct:  447 VSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPGFAINSNTGSVTITRPLDRETK-----------QAYSFTVHARDGGGLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTP-VGTIVLAVNAEDRDVGNNGH-VTYAILILPFIIVPDTGNINTS----------SKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMY-SLTGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGALGMFTINETTGVIRTQGVLNR---ESK------DFYTLIVMARDQ--------------GAV--PYMDFGTIDVHVIDKNDNTPI 850          

HSP 5 Score: 71.633 bits (174), Expect = 1.303e-12
Identity = 61/213 (28.64%), Postives = 95/213 (44.60%), Query Frame = 1
Query: 1870 GILIAT----DNDEGDNGKLLFKLL------PNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQI---GILRVKRKLKKELIGDYNVQIIVEDNGKP-SKMHSQKILVRIQD 2466
            G+LIAT    D+D+G NG + + ++      P  N +F      G +++A+  +R+ T  Y L I   D G    S T  V I + D+NDN P  +F   +   T  +NS V               G  +L   A+D D G+NA   + ++  +   +F    ++   G + V   L +E+   YN+ I   D G P S+      LVRI D
Sbjct:   20 GVLIATVKATDSDDGANGDVDYSIVDGNVGDPRSNSDFTLDPNTGMIKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNP--VFNPTNYSTTVFENSPV---------------GTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILD 215          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 257.684 bits (657), Expect = 3.303e-71
Identity = 218/780 (27.95%), Postives = 364/780 (46.67%), Query Frame = 1
Query:  172 YAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVT----NDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNLNPSFCRI------EEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
            Y I+E       IG I +D+ +S        S  + YR   +        VL +   I  T   ID E+LCP            + V V      + +I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N+V +K +       F L +      + +P L++++ LD E+   Y + I   +  +  + +   + + V ++ND +P F++ + EV + EN PI + ++Q++A D D   ++EI Y    + +  + + F++ S+ G I ++RPLD E T++H + V ASD   + A   V+I V DVND  P  +L      I       E  P N  I  IT+ D+D++  NGK+ C+  +++          P   K  Y  +Y L T    D E T +   K++      + K  L  T  + + + D NDN PIF + V  +++ ENN  D  +  ++ATD+D G+N  + Y+      + P  S F +D  +G +TA+   DRE +  +   + A+D GT P Q  ++  + +   + N  +PKF     +  + EN    + VG++  TD+D G+N  +   +L N NENF     +G ++S   FDRE    Y   +   D G+ P S    V IN++DVNDN P +I+P  +  +  +  S++              PG  + +  A D D G NA   + I   N+  +F IDP  G + ++ K     IG + + + + D G P  +H+
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFR-LIKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFAIPSATDPDTGP--NSV-HKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDI-NGKVICFIEKDV----------PFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQ------LGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDN--NPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSIL-NDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSI--------------PGSVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYPKSLHT 765          

HSP 2 Score: 129.413 bits (324), Expect = 6.114e-30
Identity = 160/585 (27.35%), Postives = 258/585 (44.10%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ-YFSV----SSKG----QIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      ++    + Q  F +    + +G    Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F  N    +IE   PEN  IG   +  + ++A  G  +  E   ++  Q      P   + F       L T  R  DREET      V+       + +P  +T+ I++T  D+NDN P      I      +V + E +P++ K+  +T +DKD   NG V   I+     + +    V D+     T+ L LD E    Y   IVA D G     QT+   + + + D NDN P F  P  +L + EN K    +  L ATD D G N +++++L PN   +FF L    G L +++ FDRE  DR+   +   D G  PL     V + +LD NDN P+      H  + +          ++ +L  Y + G        +D D GENAA    +S+ ND + F +DP  G+++      +E    Y   +   D+G+P    + K+ + + D+
Sbjct:  125 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFREN----QIEVHIPENSPIGTSVVQLQATDADIGPNA--EIHYVFGTQV----SPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASD---GSSSPARATVIINVT--DVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKA---VYDNQYLLETSAL-LDYEGTKEYNFKIVASDSGKPSLNQTA--LVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPN--ASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDSDAGENAAI--SLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDV 667          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 257.684 bits (657), Expect = 1.583e-70
Identity = 219/781 (28.04%), Postives = 364/781 (46.61%), Query Frame = 1
Query:  172 YAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVT----NDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNLNPSFCRI------EEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIF--ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
            Y I+E       IG I +D+ +S        S  + YR   +        VL +   I  T   ID E+LCP            + V V      + +I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N+V +K +       F L +      + +P L++++ LD E+   Y + I   +  +  + +   + + V ++ND +P F++ + EV + EN PI + ++Q++A D D   ++EI Y    + +  + + F++ S+ G I ++RPLD E T++H + V ASD   + A   V+I V DVND  P  +L      I       E  P N  I  IT+ D+D++  NGK+ C+  +++          P   K  Y  +Y L T    D E T +   K++      + K  L  T  + + + D NDN PIF + V  +++ ENN  D  +  ++ATD+D G+N  + Y+      + P  S F +D  +G +TA+   DRE +  +   + A+D GT P Q  ++  + +   + N  +PKF      + F  EN    + VG++  TD+D G+N  +   +L N NENF     +G ++S   FDRE    Y   +   D G+ P S    V IN++DVNDN P +I+P  +  +  +  S++              PG  + +  A D D G NA   + I   N+  +F IDP  G + ++ K     IG + + + + D G P  +H+
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFR-LIKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFAIPSATDPDTGP--NSV-HKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDI-NGKVICFIEKDV----------PFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQ------LGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDN--NPKFTH-NHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSIL-NDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSI--------------PGSVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYPKSLHT 765          

HSP 2 Score: 129.798 bits (325), Expect = 5.878e-30
Identity = 160/585 (27.35%), Postives = 258/585 (44.10%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ-YFSV----SSKG----QIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      ++    + Q  F +    + +G    Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F  N    +IE   PEN  IG   +  + ++A  G  +  E   ++  Q      P   + F       L T  R  DREET      V+       + +P  +T+ I++T  D+NDN P      I      +V + E +P++ K+  +T +DKD   NG V   I+     + +    V D+     T+ L LD E    Y   IVA D G     QT+   + + + D NDN P F  P  +L + EN K    +  L ATD D G N +++++L PN   +FF L    G L +++ FDRE  DR+   +   D G  PL     V + +LD NDN P+      H  + +          ++ +L  Y + G        +D D GENAA    +S+ ND + F +DP  G+++      +E    Y   +   D+G+P    + K+ + + D+
Sbjct:  125 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFREN----QIEVHIPENSPIGTSVVQLQATDADIGPNA--EIHYVFGTQVS----PATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASD---GSSSPARATVIINVT--DVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKA---VYDNQYLLETSAL-LDYEGTKEYNFKIVASDSGKPSLNQTA--LVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPN--ASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDSDAGENAAI--SLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDV 667          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 256.914 bits (655), Expect = 2.107e-70
Identity = 219/781 (28.04%), Postives = 364/781 (46.61%), Query Frame = 1
Query:  172 YAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS----YFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVT----NDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY----RSADFSSQYFSV-SSKGQIFLKRPLDFETTSLHLIDVQASDNEFN-ANTKVVITVVDVNDEAPQFNLNPSFCRI------EEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY-GKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIF--ENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHS 2439
            Y I+E       IG I +D+ +S        S  + YR   +        VL +   I  T   ID E+LCP            + V V      + +I+++I V+D NDN P F +  I  S+ E    +     +  A D D     N+V +K +       F L +      + +P L++++ LD E+   Y + I   +  +  + +   + + V ++ND +P F++ + EV + EN PI + ++Q++A D D   ++EI Y    + +  + + F++ S+ G I ++RPLD E T++H + V ASD   + A   V+I V DVND  P  +L      I       E  P N  I  IT+ D+D++  NGK+ C+  +++          P   K  Y  +Y L T    D E T +   K++      + K  L  T  + + + D NDN PIF + V  +++ ENN  D  +  ++ATD+D G+N  + Y+      + P  S F +D  +G +TA+   DRE +  +   + A+D GT P Q  ++  + +   + N  +PKF      + F  EN    + VG++  TD+D G+N  +   +L N NENF     +G ++S   FDRE    Y   +   D G+ P S    V IN++DVNDN P +I+P  +  +  +  S++              PG  + +  A D D G NA   + I   N+  +F IDP  G + ++ K     IG + + + + D G P  +H+
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDYFR-LIKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFAIPSATDPDTGP--NSV-HKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDI-NGKVICFIEKDV----------PFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASD---SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQ------LGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDN--NPKFTH-NHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSIL-NDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSI--------------PGSVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYPKSLHT 765          

HSP 2 Score: 129.028 bits (323), Expect = 9.190e-30
Identity = 160/585 (27.35%), Postives = 258/585 (44.10%), Query Frame = 1
Query:  784 LSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQ-YFSV----SSKG----QIFLKRPLDFETTSLHLIDVQASDN---EFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFY--GKYDLYTRVR-FDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTP------IFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPK-KLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYL-TINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            + I I V + ND  P F      +S+ EN  INS      A D D      ++    + Q  F +    + +G    Q+ +++ LD E    +++ ++  D    + ++   + +TV DVND  P F  N    +IE   PEN  IG   +  + ++A  G  +  E   ++  Q      P   + F       L T  R  DREET      V+       + +P  +T+ I++T  D+NDN P      I      +V + E +P++ K+  +T +DKD   NG V   I+     + +    V D+     T+ L LD E    Y   IVA D G     QT+   + + + D NDN P F  P  +L + EN K    +  L ATD D G N +++++L PN   +FF L    G L +++ FDRE  DR+   +   D G  PL     V + +LD NDN P+      H  + +          ++ +L  Y + G        +D D GENAA    +S+ ND + F +DP  G+++      +E    Y   +   D+G+P    + K+ + + D+
Sbjct:  125 IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFREN----QIEVHIPENSPIGTSVVQLQATDADIGPNA--EIHYVFGTQVS----PATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASD---GSSSPARATVIINVT--DVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKA---VYDNQYLLETSAL-LDYEGTKEYNFKIVASDSGKPSLNQTA--LVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPN--ASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFT----HNHFQFF---------VSENLPKYSTVGV----ITVTDSDAGENAAI--SLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDV 667          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 234.958 bits (598), Expect = 1.243e-63
Identity = 232/799 (29.04%), Postives = 364/799 (45.56%), Query Frame = 1
Query:  166 IKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTS-ILKTKTLIDLEELCPDHCPT---GEMGQLYLVVNVWDGLSLKG--IIRVEINVQDVNDNVPTFLTSSILKSVKE-VIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDT-FMLKVTND---SFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY---RSADFSSQYFSVS-SKGQIFLKRPLDFE---TTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNL--------NPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKT-FYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDIL 2472
            I Y ++E QP  T IG ++ D  L     L        Y+ +    Y  +D  T  I  T+  ID E L    C +   G+   L   V+V D L      +I   I VQD+NDN P F  S +  SV E  I G   S+ L  A DRD S+ +    Y L A   + T F L+V +D     P L++   LD E    Y+L I A +     + ++  + + V + ND  PKF+   YE  V EN P+   ++QV+A D D   + EI Y   ++ D   +   +  + G I++K PLD E   + S +++         ++ T V I V D ND AP   +        +     I E  P    +  + + D+D E  N  ++C     +        +P  DS +    KY L T    D E   +   +++ V     A   L+ST ++ + + D+NDN+P+F   ++ V   E N     ++ VTATD D G N  + Y I     +   K LF ID ++G V A   LDRE +  Y+  + A DKG+   + T++    I ++D NDN PKF +      + EN  P + VG++   D D+G+N  +   + P+  + F      G++ S+  FDRE    Y  +++  D G+ P S    V IN+LD NDN P +  P          NS+ ++      LS   SP   +   EA DLD G NA   F I+  N   +F I P  G + + +++ ++  G + + + V D GKP +  +  + + + + +
Sbjct:   24 ILYRVQEEQPPNTLIGSLAADHGLPDSGHL--------YKLEVGAPYLRVDGKTGDIFTTEIPIDRETL--RDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPL--ATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKD-EGENAVVTCV----VAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPA---LSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYI---KGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATV--VIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGK-FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKP---------SNSSFRQ------LSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETI 780          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 236.498 bits (602), Expect = 1.291e-63
Identity = 232/799 (29.04%), Postives = 364/799 (45.56%), Query Frame = 1
Query:  166 IKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTS-ILKTKTLIDLEELCPDHCPT---GEMGQLYLVVNVWDGLSLKG--IIRVEINVQDVNDNVPTFLTSSILKSVKE-VIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDT-FMLKVTND---SFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDED--EDSEITY---RSADFSSQYFSVS-SKGQIFLKRPLDFE---TTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNL--------NPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKT-FYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDIL 2472
            I Y ++E QP  T IG ++ D  L     L        Y+ +    Y  +D  T  I  T+  ID E L    C +   G+   L   V+V D L      +I   I VQD+NDN P F  S +  SV E  I G   S+ L  A DRD S+ +    Y L A   + T F L+V +D     P L++   LD E    Y+L I A +     + ++  + + V + ND  PKF+   YE  V EN P+   ++QV+A D D   + EI Y   ++ D   +   +  + G I++K PLD E   + S +++         ++ T V I V D ND AP   +        +     I E  P    +  + + D+D E  N  ++C     +        +P  DS +    KY L T    D E   +   +++ V     A   L+ST ++ + + D+NDN+P+F   ++ V   E N     ++ VTATD D G N  + Y I     +   K LF ID ++G V A   LDRE +  Y+  + A DKG+   + T++    I ++D NDN PKF +      + EN  P + VG++   D D+G+N  +   + P+  + F      G++ S+  FDRE    Y  +++  D G+ P S    V IN+LD NDN P +  P          NS+ ++      LS   SP   +   EA DLD G NA   F I+  N   +F I P  G + + +++ ++  G + + + V D GKP +  +  + + + + +
Sbjct:  101 ILYRVQEEQPPNTLIGSLAADHGLPDSGHL--------YKLEVGAPYLRVDGKTGDIFTTEIPIDRETL--RDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPL--ATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKD-EGENAVVTCV----VAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPA---LSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYI---KGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATV--VIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGK-FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKP---------SNSSFRQ------LSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETI 857          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000036716.1 (SMESG000036716.1)

HSP 1 Score: 1865.12 bits (4830), Expect = 0.000e+0
Identity = 967/970 (99.69%), Postives = 968/970 (99.79%), Query Frame = 1
Query:   70 MKQIKCSLFLLYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDILRLEERSKRQKSEHWTKSNKFQXXXXXXXXXXXXXXXXXXTVLCIIKPCSNRPNNRGDYSSVGRQFLCDTKSSNLEMKNEQYLFTTNFDHEKPTYIPNIYQRDSILEPQSITPNPLHTVMYPTTYSNSHYNQFYLPRSYPFNSENNEVKSTFSPIYENSNFQKYDFNTIQ 2979
            MKQIKCSLFLLYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQ KYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVI VVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDS+AANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETIDDVKKVIIVCDDGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCTINITIIDVNDNSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDILRLEERSKRQKSEHWTKSNKFQIAIMISIASAILMLIFISTVLCIIKPCSNRPNNRGDYSSVGRQFLCDTKSSNLEMKNEQYLFTTNFDHEKPTYIPNIYQRDSILEPQSITPNPLHTVMYPTTYSNSHYNQFYLPRSYPFNSENNEVKSTFSPIYENSNFQKYDFNTIQ
Sbjct:    1 MKQIKCSLFLLYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQHKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVINVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSDAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETIDDVKKVIIVCDDGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCTINITIIDVNDNSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDILRLEERSKRQKSEHWTKSNKFQIAIMISIASAILMLIFISTVLCIIKPCSNRPNNRGDYSSVGRQFLCDTKSSNLEMKNEQYLFTTNFDHEKPTYIPNIYQRDSILEPQSITPNPLHTVMYPTTYSNSHYNQFYLPRSYPFNSENNEVKSTFSPIYENSNFQKYDFNTIQ 970          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000046654.1 (SMESG000046654.1)

HSP 1 Score: 512.686 bits (1319), Expect = 8.946e-164
Identity = 315/803 (39.23%), Postives = 471/803 (58.66%), Query Frame = 1
Query:  100 LYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMIL-RNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITY----RSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITHT--VCINILDVNDNPPRLIFPDYHPKYTWID--NSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPD----IFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 2469
            +Y+   +++  L   F++F+  + Y I+EN P   ++G IS D+     + L + L     + F+ +  YF LD  +S+LKT   IDLE LCP  C    +G L LVVNVW    L+G+I V+I + D NDNVP FL  S +K +KE++YGVGK++EL KAID+DV++ ++ V YKL+    SDTF L+++ D+ P L L K +DYE    Y L + AWN+  D  K+ L I I ++++ND EP FK+  +E+ ++EN  I  +II++EA D+D+DS++ Y     +   + + F+V   G++ L + LD E    + I V A+D EF +N+K+ I V DVN+  P +NLNP+   +EE QP NI++GQI + D D+   NG + C EP    N Q + F P         KYD+++RV+ DREE     + + ++C DG     LTST  I+L + D+NDN P+F    Y   I+ENN +  KV++V A DKD   N  + Y I     +    + F I+ +SGW+TA  +LDRE++  YQL I+A +K ++     ++ T+NI + D NDN P+   PKKLEI EN KP   +G +I+ D D G+NGK +F L+ +   ++F L  NGSL S   FDRE  D YCL I +ND G  P+S + T  +C+NILD NDN P +       +   ++  N++    S  I  S+YE+PGF+I    A D D+GENA   F +    D +    +F ID   G +++ R + +++IGDY ++II  D GK S    + I ++IQDI
Sbjct:    3 IYLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFLMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNK--ASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEA--PTRTIYLICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSI-----LEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINK-SLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPNQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLG-VPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESKNNSQNLGSEIIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEKIIRIQIQDI 794          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000029841.1 (SMESG000029841.1)

HSP 1 Score: 410.223 bits (1053), Expect = 2.081e-125
Identity = 292/840 (34.76%), Postives = 476/840 (56.67%), Query Frame = 1
Query:  151 QFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRF--QKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNS--PADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSS---QYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRI-EEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQG-KTPLSITHTVCINILDVNDNPPRLIFPDYHPKY--TWIDNSTVQKES--ITIDLSIYESPGFEILKCEASDLDEGENAAFHFR----ISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKIL-VRIQDILRLEERSKRQKSEHWTKSNKFQXXXXXXXXXXXXXXXXXXTVLCIIKPC 2616
            + D+ ++Y I+ENQP    IGKISED+  ++  +   L+   N RF   ++ S F L+S + +LKTK +IDLE LCP +C   + G + L VN+W   +L+GI +V + + D+NDN P F  S++  S+KE++Y  GK+++L +A+DRDVS ++N ++YKL     SD F L++     P+LV+ K +D E    ++LA+ AWNS  P+ N  ++L I I V++IND EP F +  Y + V EN P+ S++ ++ A+D D DS++ Y SAD  S     F +  +G I L R LD+ET   + +  + +D EF A TK+   ++DVNDE PQFNLNP+   + E  +P+ I   Q+T++DRDSE  NGKL C+EP    NKQ V F P +++     ++ +      DR+    D +   ++C+D      LTST T+++ + D NDN PIF +    ++++EN+P +  +    A D D G N  V Y +  L + N +     ID +SG + +    DRE+ SFY+LII+A D+  +  +Q++S ++NIT++D ND  P+ + P    I EN+   T +G+L A D DEG N  ++F L+ + N  FF L  NGSL S + FDRE  + + L + + D G     S+   + + ILD NDN P +  P++      T   NS + + +    +++SI+ S  + I + +  D D GEN     +    +  P  P++ S+D +   L     L ++L   Y   I+  D+G+P++   +K++   +   +      ++++    +K+N   I I+++  SA L  + +S +LC+I+PC
Sbjct:   33 KLDNFLQYNIEENQPAGLVIGKISEDIKRNSNPVWF-LTSDSNLRFLLSQESSLFELESKSGVLKTKQVIDLERLCPGNC-IKDKGVVNLTVNIWSPSNLQGIAKVSVIIDDINDNFPYFEQSTVEISIKEMLYTRGKTIKLPRAVDRDVSMKNNEISYKLKDS--SDYFDLEMKTKFQPVLVVLKTMDSENINQFHLALLAWNSYFPSFN-VSELKIIINVIDINDNEPFFSKPLYLIPVPENTPVGSIVHKISALDLDVDSQLRYYSADPGSLITSIFKIEIQGSIRLLRSLDYETQPFYHMSAKVTDGEFIAFTKLKFVIIDVNDETPQFNLNPTNISVFENSEPKEI--AQVTVYDRDSEDINGKLKCYEPNYSTNKQIVSFLPNINNPY---QFTIKLIRSLDRDILNGDQQYATLICEDNGIPTRLTSTFTLTINVLDRNDNRPIFTQPFVQIAVKENSPTEIPIYTFGAEDIDRGLNARVIYSV-MLNTTNDD--CCRIDENSGKLFSFKTFDREQRSFYKLIIIATDQSQIDPKQSTSISVNITVLDENDEKPQLLPPYNFTILENQPQMTYIGLLKAQDKDEGANSGIIFSLVTDINSVFFLLLKNGSLYSRRRFDREEKEEFSLDVNLEDSGLHHTNSVKSRIYVKILDQNDNAPVINLPEFEKVLFQTQSKNSELDQNNYFYRLNVSIHSSVQYPIGQIKVVDRDIGENGKVTLKLIPELQDPKVPNLLSLDEEKNELYTTSSLNRDLKDCYQYTILAMDHGRPNRRSEKKVMFCFVNQPVETPLIPEKERVSSLSKANIL-IVIILAGTSAFLTALLVSAILCMIQPC 858          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000005850.1 (SMESG000005850.1)

HSP 1 Score: 385.571 bits (989), Expect = 6.741e-117
Identity = 293/863 (33.95%), Postives = 468/863 (54.23%), Query Frame = 1
Query:   70 MKQIKCSLFLLYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITH-TVCINILDVNDNPPRLIFPDYHPKYTWID---NSTVQKES---ITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPD----IFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDILRLEERSKRQKSEHWTKSNKFQXXXXXXXXXXXXXXXXXXTVLCIIKPCSNR 2625
            M QI   L ++ +FQ L    ++  F  FD + K+ I+ENQP +T +G+I            + + E+++Y F      F +D  +  + T  +IDLE LC + C   E   + L VNV    +L  ++++ I + D++DN P F        +KEVI+     + L  A+D+D+S ++  + Y++  D     F L+  N   P L L   +DYE+ K Y   + A+    ++    +++T++VVNIND  P+F +  YE SV E++ ++ +II+V AVD D D+ + Y     ++ YF +++ G++ L + LDFE        +QA+D EF A +K+ ITV+DVNDE P + LNP    I+E     I++GQIT++DRDS + N  + C E    +  QA+  +    S      Y LYT    DRE   D +     +C D   K  L + ++I L + DINDN P+F  + Y V ++ENN +  ++ +  ATD+DIG+N L+TY I      + +  LFVIDS +GW+     LDREK++ Y L IVA D+    + ++ S  + IT++D NDN+P+        I EN   G  +G LIA D DEG+N +++FKL  +H      +   GSL S + FDRE   + C QI+++D     +  +H +VC+NILD NDN P+ IF     + T I+   N+T  + S     + +SI E  GF I   +A+D D    +   + +      +    IF ID + G + + R L ++LIG   V+++VED+G PS   ++ I+V I DI +  ++     +      N F I++++S+ SA+L+LI IS ++CI+KPC+ R
Sbjct:    1 MVQIIEKLAIVLLFQFLYVYSIF--FNAFDGVQKFTIEENQPIKTFVGRIK---------FAKQIDEELSYSFGLITDIFSIDPKSGDIHTSKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGD--HSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN-LRYILLPMTN-YFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETN--HETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNI----QFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDR-KSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQ-IFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIPQSSDKLFNVLNNPLIIGNNFMISLILSVVSALLILILISVIICIVKPCTGR 840          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000020970.1 (SMESG000020970.1)

HSP 1 Score: 383.645 bits (984), Expect = 3.303e-115
Identity = 311/929 (33.48%), Postives = 484/929 (52.10%), Query Frame = 1
Query:   94 FLLYIFQC-LINLRLYYGFTQFDD-------MIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLS-YFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKT-KLSITIRVVNINDMEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFS----SQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETXXXXXXXXXXXXXGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCXXXXXXXXXXXXSPKF-IGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTD--RYCLQIEINDQG-KTPLSITHTVCINILDVNDNPPRL-IFPDYHPKYTWIDNSTVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFR-----ISLPNDPDIFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI-LRLEERSKRQKSEHWTKSNKFQXXXXXXXXXXXXXXXXXXTVLCIIKPCSNRPNNRGDYSSVGRQFLCDTKSSNLEMKNEQ--YLFTT-------NFDHEKPTYIPNIYQRD 2778
            FLL+     L +L L + F    D        I Y IKENQP    +G + +++P     I    S   ++  QK+   +F L   +S+L T  LIDLE LC          +  +V  V         +R+ I V+DVNDN P F  +S  K++KE+IYG GKS++L +A D+D+S  +N ++Y L     S  F   V+ D  PIL++ K LD E    + L + AWN    ++ T  LSITI + +IND EP+F Q  Y+V + EN+ +N  I+Q++A D+D+ S + +          ++ F++S +G I+L + LD+ET   + I V+ +D EF++N +V + ++DVND APQF LNP    I E      ++G I ++D+DS   +  + C E        A+ F    ++     K ++Y     DR++   D +  +I+C+D    N LT+T T++LT+ D NDN+P F    Y V ++EN      +I V+ATDKD G N  + Y I    S +  +  F ID +SG +     LDREK+ +YQ+ +VA D      + TS+ T++I +IDVND +P+         ++EN+  GT +G LIATD D G NGK +F L+P+   ++F L  NGSL +   FDRE+    ++ L+I + D G +  LS    VCI ILD NDN P++ + PD+   Y + DN+T      +I +S  ES    I     SDLD+G N    F      ISL ++  +F ++     +++KR  ++     + V +I +D G P +  S+ I+V+  DI  RL +++    S    K N   I I++   S +L    I  ++C+ +PC N+  +    + V R    D  + NL +K  Q  YL T+       N + E  T + +I Q D
Sbjct:   14 FLLFRLSVMLFDLVLGHSFVSARDSSSLSFGTINYWIKENQPPGLVVGNLLDNLPYKQYFI----SPGYHFVLQKESEEFFSLKPGSSMLTTSKLIDLESLCGSSDCYNGTKEFQVVALVMRDKQFIQELRINIIVEDVNDNDPFFKNASYTKNIKEIIYGPGKSIDLPRAFDKDLSLINNQISYSLQET--STYFHFSVSKDGKPILIIIKELDAETIDTHRLILIAWNQNYPSRPTASLSITIVIDDINDNEPRFSQSIYKVPILENVELNHQILQLKATDKDKTSRLQFIIVPTINVEIAKTFAISDQGMIYLIKHLDYETAPKYEIPVRVTDGEFSSNGRVEVVIIDVNDCAPQFTLNPENLVISENTLSKTLLGNIVVYDQDSAYVDSGIECREGS---PNDAMRFDITENNSERTKKINIYLNQEIDRDQINGDRRFSVIICNDMGINNRLTATFTVTLTVLDANDNSPQFTLTDYVVRVKENLKPQYPLIDVSATDKDDGVNSQIKYFI----SDHTHQQYFKIDENSGKIIGIQSLDREKQDYYQVTVVATDLAINEIRHTSTATVHIHVIDVNDCAPRINESLNTFSVYENQPIGTVIGKLIATDCDIGQNGKFIFTLIPSAFSHYFELLTNGSLLTKVSFDRESLSQVKFSLRITVRDIGEEIHLSSKTAVCIKILDENDNSPKISVIPDFIAAYNYSDNNTTD---CSITVSKTESTNSPIFPFTFSDLDDGPNGQVAFSMKIYPISLKSN-QLFYLNVTEKAIKLKRSWQQSDGNRFLVTLIAKDKGSPPRETSKVIMVQFADIPPRLIDQNISMGSFSNVKINV-LIIIILVTISTVLTTALIGAIICMWQPCGNKRQSANCRNGVMR----DNANDNLRIKGYQDSYLVTSSIIDSVENDETEFKTSVSHIQQND 920          
The following BLAST results are available for this feature:
BLAST of Protocadherin gamma vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH99.751e-7029.00protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH93.240e-6929.08protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH93.777e-6929.08protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH94.887e-6929.08protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH11Y3.267e-6828.64protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-12.686e-4630.03FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-15.555e-4630.03FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
hmr-15.063e-3227.00Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-15.063e-3227.00Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
cdh-17.746e-3027.03CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds6.576e-5328.01gene:FBgn0284247 transcript:FBtr0078045[more]
ds6.576e-5328.01gene:FBgn0284247 transcript:FBtr0343249[more]
stan9.333e-5027.48gene:FBgn0024836 transcript:FBtr0339463[more]
stan1.013e-4927.48gene:FBgn0024836 transcript:FBtr0330601[more]
stan1.070e-4927.48gene:FBgn0024836 transcript:FBtr0304899[more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh93.271e-6828.57protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh95.090e-6828.57protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh95.090e-6828.57protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
CR847522.15.307e-6828.57pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:487... [more]
pcdh111.950e-6427.69protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vapa1.047e-6929.01VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000047804.12.111e-6127.53protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.12.152e-6127.53protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047798.12.453e-6127.16protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
pcdh171.162e-6027.95protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh92.167e-7029.00protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh93.448e-6929.08protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh94.179e-6929.08protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh94.179e-6929.08protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh94.596e-6929.08protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HC56|PCDH9_HUMAN2.347e-6829.08Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q9BZA8|PC11Y_HUMAN1.544e-6628.71Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6WYY1|PC11X_PANPA1.365e-6428.47Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q71M42|PC11X_PANTR1.493e-6428.47Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6WXV7|PC11X_PONPY3.699e-6428.47Protocadherin-11 X-linked OS=Pongo pygmaeus OX=960... [more]
back to top
BLAST of Protocadherin gamma vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2KYT31.943e-13234.37Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3R7CGZ32.239e-13134.65Protocadherin Fat 4 OS=Clonorchis sinensis OX=7992... [more]
A0A068YEP33.748e-13034.06Protocadherin gamma OS=Echinococcus multilocularis... [more]
A0A075A2519.516e-12933.83Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A068WBV33.535e-12633.55Protocadherin gamma c4 OS=Echinococcus granulosus ... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh91.094e-7129.21protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh91.442e-7129.21protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh1a7.071e-6529.49protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a1.092e-6429.58protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh114.359e-6428.09protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh116.839e-5828.53protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000006996.11.614e-5228.17pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
ENSPMAT00000008517.11.406e-5026.15pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000010725.11.254e-4225.39pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000004043.14.163e-4125.04pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461892.421e-6128.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303643.714e-5427.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354121.608e-5027.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482374.354e-5026.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348154.758e-5027.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh93.303e-7127.95protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh91.583e-7028.04protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh92.107e-7028.04protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh1a1.243e-6329.04protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a1.291e-6329.04protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
back to top
BLAST of Protocadherin gamma vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036716.10.000e+099.69SMESG000036716.1[more]
SMESG000046654.18.946e-16439.23SMESG000046654.1[more]
SMESG000029841.12.081e-12534.76SMESG000029841.1[more]
SMESG000005850.16.741e-11733.95SMESG000005850.1[more]
SMESG000020970.13.303e-11533.48SMESG000020970.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030878 ID=SMED30030878|Name=Protocadherin gamma|organism=Schmidtea mediterranea sexual|type=transcript|length=3115bp
CTAATTTATTCAATCTCTAACATTTGGGATATATTTAATTAAAACAAAAA
CCCGGTAAAACAAGATACGATGAAGCAAATCAAATGCTCGTTATTTTTAC
TGTACATTTTTCAATGTCTCATCAATTTGCGTCTTTACTATGGATTTACT
CAATTCGACGACATGATCAAGTATGCAATCAAAGAAAATCAACCGGGCCA
AACCAGAATTGGTAAGATTTCCGAAGATGTTCCATTGTCAACTCAGATGA
TTCTTAGAAACCTTTCAGAGAAAATAAATTATCGTTTCCAAAAACAATTG
TCATATTTTGTATTAGATTCCAATACAAGTATTTTAAAAACGAAAACATT
AATTGATTTGGAAGAACTTTGTCCAGACCATTGTCCAACCGGGGAAATGG
GTCAGTTATATTTGGTTGTCAATGTTTGGGATGGGTTGAGTTTAAAAGGA
ATTATTCGAGTGGAAATTAATGTTCAAGATGTCAATGATAACGTACCGAC
ATTTCTTACCTCAAGTATTTTGAAAAGTGTCAAAGAAGTGATTTATGGTG
TCGGAAAATCGATGGAACTTCAAAAAGCAATCGACCGTGACGTATCAAAG
GAACACAATACCGTCACATATAAACTAGATGCCGATATATATTCCGATAC
TTTTATGTTGAAAGTCACCAATGACAGTTTCCCGATATTAGTTTTAAAAA
AGGCGCTCGATTATGAACGTTGTAAATTATATAATTTAGCTATTTGGGCA
TGGAATAGTCCAGCTGATAATCAAAAAACAAAATTATCTATTACGATCAG
AGTAGTTAATATCAACGATATGGAACCAAAATTTAAACAACAAAAATATG
AGGTATCAGTGGAAGAAAATCTTCCAATTAATTCAATGATTATACAAGTA
GAGGCAGTAGATGAAGATGAAGATAGCGAGATTACTTATAGGTCAGCGGA
TTTTAGCAGTCAGTATTTTAGTGTATCAAGTAAAGGCCAAATATTTTTAA
AAAGACCTCTTGATTTTGAGACAACTTCGCTTCATTTAATTGATGTGCAA
GCCTCAGATAATGAATTTAATGCCAATACAAAAGTCGTTATAACTGTTGT
TGACGTAAATGATGAAGCTCCTCAGTTCAATTTAAATCCTTCATTTTGCA
GAATCGAAGAAGGTCAGCCAGAAAATATCATAATTGGACAAATAACAATT
TGGGATCGAGATAGTGAAGCCGCCAATGGAAAGTTATCATGTTGGGAACC
ACGAAATCTTTACAATAAACAAGCAGTTATTTTCAAACCTCCTTTAGATA
GTAAAACCTTTTATGGGAAATATGATTTATACACAAGGGTTCGATTTGAT
AGAGAAGAAACAATAGATGATGTCAAGAAAGTTATTATTGTTTGCGACGA
TGGTGCTGCAAAAAACCCATTAACTTCAACAATGACTATAAGCCTTACAA
TAGCAGACATAAATGATAATACTCCAATATTCGAAAAAGCTGTTTACTCA
GTCAGTATAGAAGAAAACAACCCCGTCGATGCCAAAGTGATAAAGGTAAC
CGCGACAGACAAAGATATAGGAAGGAATGGATTAGTTACATACGAAATTG
ATAATCTTAGATCTATGAATCCAGAGAAAAGTCTTTTTGTGATAGATTCA
GACTCAGGATGGGTTACAGCGACTCTCAAACTTGATAGGGAAAAAGAAAG
TTTTTACCAGTTAATTATTGTTGCAAAAGACAAAGGAACTATGCCAAAAC
AACAAACTTCTTCTTGTACAATTAATATTACAATAATTGATGTCAATGAT
AATTCTCCCAAATTTATTGGACCAAAGAAATTGGAAATATTTGAGAATGA
GAAACCCGGTACAGAGGTTGGAATATTAATTGCCACAGATAATGATGAAG
GTGATAATGGGAAATTGTTGTTCAAACTTTTGCCGAATCATAATGAAAAC
TTTTTTTATCTTACCATAAACGGATCTTTACAAAGTGCCAAAGAATTTGA
CAGAGAGACCACAGATAGATATTGCCTTCAAATCGAAATAAACGATCAAG
GCAAAACCCCTCTTTCCATAACGCATACGGTTTGCATTAATATCTTGGAT
GTAAATGACAACCCACCCAGACTCATCTTCCCAGATTATCATCCGAAATA
TACATGGATTGATAATAGTACTGTTCAAAAGGAATCAATTACAATAGACC
TTTCCATCTACGAATCTCCAGGATTTGAGATCTTAAAATGTGAAGCATCA
GATCTTGATGAAGGAGAAAATGCAGCATTTCACTTTCGAATATCTTTGCC
TAATGATCCAGATATATTTTCTATAGATCCTCAAATTGGTATTTTGAGAG
TTAAAAGAAAATTGAAAAAAGAACTAATTGGAGACTACAATGTCCAAATA
ATTGTTGAAGATAATGGAAAGCCTTCCAAAATGCATTCACAAAAGATTTT
AGTCAGAATTCAAGACATTCTCAGACTCGAAGAGAGATCTAAACGGCAAA
AGTCTGAACATTGGACGAAAAGCAATAAATTTCAAATTGCAATTATGATT
TCGATTGCGTCGGCTATATTAATGCTGATTTTTATTTCAACTGTGCTATG
CATCATTAAACCATGTTCAAATCGGCCGAATAATCGAGGAGACTATTCCA
GCGTCGGTCGGCAGTTCCTCTGTGATACGAAGTCAAGTAATCTTGAAATG
AAAAATGAACAGTACCTTTTTACAACAAATTTTGATCACGAGAAACCGAC
ATACATTCCTAATATATATCAGCGAGACTCTATATTAGAACCTCAAAGTA
TAACTCCAAATCCACTTCACACTGTAATGTATCCAACCACTTATTCCAAT
TCACATTATAACCAATTTTATTTACCAAGATCCTATCCATTTAATTCCGA
AAACAATGAAGTGAAAAGCACATTTTCCCCGATATATGAAAATTCCAATT
TCCAAAAATATGATTTTAATACTATACAATGATGCATTTCAAATGTGCTT
AAAGGATTTTCAAATTCGATTTGAATACTATTATTAAAATTGCTAATATA
TTCATTGGCACTTTTTGAGCTTCTTTTGGTAGTGATTTCTATCATGTAGT
TTCTTTTATTTCAAG
back to top

protein sequence of SMED30030878-orf-1

>SMED30030878-orf-1 ID=SMED30030878-orf-1|Name=SMED30030878-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=971bp
MKQIKCSLFLLYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKI
SEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEEL
CPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSI
LKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVT
NDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNIND
MEPKFKQQKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYF
SVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVITVVDVNDEA
PQFNLNPSFCRIEEGQPENIIIGQITIWDRDSEAANGKLSCWEPRNLYNK
QAVIFKPPLDSKTFYGKYDLYTRVRFDREETIDDVKKVIIVCDDGAAKNP
LTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDI
GRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLII
VAKDKGTMPKQQTSSCTINITIIDVNDNSPKFIGPKKLEIFENEKPGTEV
GILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDR
YCLQIEINDQGKTPLSITHTVCINILDVNDNPPRLIFPDYHPKYTWIDNS
TVQKESITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPDIF
SIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI
LRLEERSKRQKSEHWTKSNKFQIAIMISIASAILMLIFISTVLCIIKPCS
NRPNNRGDYSSVGRQFLCDTKSSNLEMKNEQYLFTTNFDHEKPTYIPNIY
QRDSILEPQSITPNPLHTVMYPTTYSNSHYNQFYLPRSYPFNSENNEVKS
TFSPIYENSNFQKYDFNTIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001627Semap_dom
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 78..97
score: 23.37
coord: 528..554
score: 30.95
coord: 255..284
score: 36.1
coord: 564..581
score: 38.32
coord: 469..482
score: 36.59
coord: 450..469
score: 41.88
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 493..580
e-value: 7.6E-29
score: 111.8
coord: 168..253
e-value: 0.0093
score: 24.6
coord: 375..469
e-value: 0.0082
score: 25.1
coord: 277..351
e-value: 5.2E-16
score: 69.2
coord: 724..805
e-value: 8.5E-7
score: 38.6
coord: 60..143
e-value: 0.013
score: 23.0
coord: 603..683
e-value: 2.9E-17
score: 73.3
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 476..571
e-value: 2.0E-20
score: 73.0
coord: 260..343
e-value: 2.0E-9
score: 37.8
coord: 589..676
e-value: 1.2E-14
score: 54.4
coord: 712..797
e-value: 4.7E-12
score: 46.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 27..142
e-value: 1.7E-10
score: 43.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 250..348
e-value: 6.1E-23
score: 83.4
coord: 467..579
e-value: 3.1E-33
score: 116.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 682..800
e-value: 4.5E-17
score: 64.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 580..681
e-value: 6.8E-25
score: 89.7
coord: 349..466
e-value: 9.0E-13
score: 50.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 143..249
e-value: 3.0E-11
score: 46.0
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 37..625
NoneNo IPR availablePANTHERPTHR24028:SF257coord: 37..625
NoneNo IPR availablePANTHERPTHR24028:SF257coord: 438..800
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 438..800
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 582..685
score: 23.879
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 29..145
score: 13.487
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 472..582
score: 29.469
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 256..353
score: 22.366
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 362..471
score: 13.181
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 703..800
score: 14.408
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 170..255
score: 15.636
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 588..681
e-value: 1.28734E-25
score: 99.6953
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 711..800
e-value: 6.64369E-20
score: 83.5169
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 260..331
e-value: 1.57309E-17
score: 76.5833
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 37..141
e-value: 5.41695E-8
score: 49.6194
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 169..250
e-value: 1.03332E-8
score: 51.5454
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 475..578
e-value: 2.4268E-33
score: 121.652
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
NoneNo IPR availableTMHMMTMhelixcoord: 824..846
IPR013164Cadherin, N-terminalPFAMPF08266Cadherin_2coord: 33..103
e-value: 1.3E-4
score: 21.7
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 459..469
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 570..580
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 673..683
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 133..143
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 346..463
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 243..336
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 460..583
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 570..691
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 678..799
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 138..246
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 68..145