GCM domain-containing protein

Overview
NameGCM domain-containing protein
Smed IDSMED30030866
Length (bp)1600
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCM domain-containing protein (SMED30030866) t-SNE clustered cells

Violin plots show distribution of expression levels for GCM domain-containing protein (SMED30030866) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCM domain-containing protein (SMED30030866) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCM domain-containing protein (SMED30030866) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030866

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30030866h1SMcG0006426 dd_Smed_v4_7752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30030866h1SMcG0006426 dd_Smed_v4_7752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030866h1SMcG0006426 dd_Smed_v4_7752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30030866h1SMcG0006426 dd_Smed_v4_7752_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030866h1SMcG0006426 Contig49468newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030866h1SMcG0006426 Contig49468uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCM domain-containing protein vs. Ensembl Human
Match: GCM2 (glial cells missing transcription factor 2 [Source:HGNC Symbol;Acc:HGNC:4198])

HSP 1 Score: 135.961 bits (341), Expect = 7.311e-34
Identity = 83/212 (39.15%), Postives = 123/212 (58.02%), Query Frame = 2
Query:  494 WDIKDAVLPQP-EFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKR--LKCEKLNFNELNEFLFHDENFDQ-KFNSVKYEHLPRI-NPENIFNIPLECMY 1114
            WDI D  +PQ    +  F  WPDG    IY++   KA++H SGWAMRNTNNHN  ILKKSCLGV+ C++ C  P+  S ++L P I + AR  Q  KK CPN  C   L    C G SG PVT++WR +   N+I+F A+G HDH +P  + +   +R  +K +  +F +  +    +   ++ + +S  + ++P + NPE+ F+I  E  +
Sbjct:   21 WDINDPQMPQELALFDQFREWPDGYVRFIYSSDEKKAQRHLSGWAMRNTNNHNGHILKKSCLGVVVCTQACTLPD-GSRLQLRPAICDKARLKQ-QKKACPN--CHSALELIPCRGHSGYPVTNFWRLD--GNAIFFQAKGVHDHPRPESKSETEARRSAIKRQMASFYQPQKKRIRESEAEENQDSSGHFSNIPPLENPED-FDIVTETSF 225          
BLAST of GCM domain-containing protein vs. Ensembl Human
Match: GCM1 (glial cells missing transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:4197])

HSP 1 Score: 124.79 bits (312), Expect = 2.406e-30
Identity = 69/161 (42.86%), Postives = 94/161 (58.39%), Query Frame = 2
Query:  485 ISDWDIKDAVLPQ-PEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKR 964
            I  WDI D  LPQ  +    F+ WPD     IY++ +  A++H S WAMRNTNNHN  ILKKSCLGV+ C + C    +   + L P I + AR+ Q  K+ CPN  CDG L    C G  G PVT++WR++     I+F ++G HDH KP  +++   +R
Sbjct:   13 ILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDKNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCGRDC-LAEEGRKIYLRPAICDKARQKQQRKR-CPN--CDGPLKLIPCRGHGGFPVTNFWRHDGRF--IFFQSKGEHDHPKPETKLEAEARR 167          
BLAST of GCM domain-containing protein vs. Ensembl Fly
Match: gcm (gene:FBgn0014179 transcript:FBtr0335492)

HSP 1 Score: 165.622 bits (418), Expect = 9.568e-45
Identity = 85/187 (45.45%), Postives = 109/187 (58.29%), Query Frame = 2
Query:  491 DWDIKDAVLPQPEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVK 1051
            DWDI D+ +P    +  F  W +G C LIY+  +++ARKH SGWAMRNTNNHN  ILKKSCLGV+ CS  C  PN  S V L P I + ARR Q  K+ CPN +C+G L  Q C G  G PVTH+WR  +  N IYF A+G+HDH +P  +     +RL         L   L  +     K +S++
Sbjct:   33 DWDINDSKMPSVGEFDDFNDWSNGHCRLIYSVQSDEARKHASGWAMRNTNNHNVNILKKSCLGVLLCSAKCKLPNGAS-VHLRPAICDKARRKQQGKQ-CPNRNCNGRLEIQACRGHCGYPVTHFWR--RDGNGIYFQAKGTHDHPRPEAKGSTEARRLLAGGRRVRSLAVMLARESALSDKLSSLR 215          
BLAST of GCM domain-containing protein vs. Ensembl Fly
Match: gcm (gene:FBgn0014179 transcript:FBtr0079855)

HSP 1 Score: 165.622 bits (418), Expect = 9.568e-45
Identity = 85/187 (45.45%), Postives = 109/187 (58.29%), Query Frame = 2
Query:  491 DWDIKDAVLPQPEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVK 1051
            DWDI D+ +P    +  F  W +G C LIY+  +++ARKH SGWAMRNTNNHN  ILKKSCLGV+ CS  C  PN  S V L P I + ARR Q  K+ CPN +C+G L  Q C G  G PVTH+WR  +  N IYF A+G+HDH +P  +     +RL         L   L  +     K +S++
Sbjct:   33 DWDINDSKMPSVGEFDDFNDWSNGHCRLIYSVQSDEARKHASGWAMRNTNNHNVNILKKSCLGVLLCSAKCKLPNGAS-VHLRPAICDKARRKQQGKQ-CPNRNCNGRLEIQACRGHCGYPVTHFWR--RDGNGIYFQAKGTHDHPRPEAKGSTEARRLLAGGRRVRSLAVMLARESALSDKLSSLR 215          
BLAST of GCM domain-containing protein vs. Ensembl Fly
Match: gcm2 (gene:FBgn0019809 transcript:FBtr0079837)

HSP 1 Score: 143.28 bits (360), Expect = 2.632e-36
Identity = 76/161 (47.20%), Postives = 101/161 (62.73%), Query Frame = 2
Query:  491 DWDIKDAVLPQ--PEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQ-QLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKR 964
            +WDI DA++P    + +  F  W DG    IY+  N +A+KH SGWAMRNTNNHN  ILKKSCLGV+ CS+ C  PN  S + L P I + ARR Q  K  CPN  C G  ++ + C G  G PVTH+WR++   N+I+F A+G HDH +P+ +   + KR
Sbjct:   66 EWDINDAIVPHVPDQEFDEFNEWSDGHVRHIYSLHNEEAKKHISGWAMRNTNNHNVNILKKSCLGVLVCSQHCTLPN-GSKINLRPAICDKARRKQEGKA-CPNKSCRGGRLEIKPCRGHCGYPVTHFWRHS--GNAIFFQAKGVHDHLRPDPKNSSVSKR 222          
BLAST of GCM domain-containing protein vs. Ensembl Zebrafish
Match: gcm2 (glial cells missing transcription factor 2 [Source:ZFIN;Acc:ZDB-GENE-050127-1])

HSP 1 Score: 132.494 bits (332), Expect = 5.501e-33
Identity = 73/163 (44.79%), Postives = 101/163 (61.96%), Query Frame = 2
Query:  494 WDIKDAVLPQ-PEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEK 979
            WDI D  LPQ  + Y +F+ W DG    IY++ +  A++H SGWAMRNTNNHN  ILKKSCLGV+ CS+ C  P+  S ++L P I + AR+ Q  KK CPN  C+  L    C G SG PVT++WR +    +I+F A+G HDH +P  + +   +R   ++
Sbjct:    5 WDINDPKLPQDTKQYDAFQEWTDGYVRYIYSSEDKNAQRHLSGWAMRNTNNHNCQILKKSCLGVVVCSRNCSLPD-GSKLQLRPAICDKARQKQ-QKKLCPN--CNSALELIPCRGHSGYPVTNFWRVD--GKAIFFQAKGVHDHPRPESKSETEARRSAVKR 161          
BLAST of GCM domain-containing protein vs. Ensembl Zebrafish
Match: gcm2 (glial cells missing transcription factor 2 [Source:ZFIN;Acc:ZDB-GENE-050127-1])

HSP 1 Score: 132.494 bits (332), Expect = 6.394e-33
Identity = 73/163 (44.79%), Postives = 101/163 (61.96%), Query Frame = 2
Query:  494 WDIKDAVLPQ-PEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEK 979
            WDI D  LPQ  + Y +F+ W DG    IY++ +  A++H SGWAMRNTNNHN  ILKKSCLGV+ CS+ C  P+  S ++L P I + AR+ Q  KK CPN  C+  L    C G SG PVT++WR +    +I+F A+G HDH +P  + +   +R   ++
Sbjct:   23 WDINDPKLPQDTKQYDAFQEWTDGYVRYIYSSEDKNAQRHLSGWAMRNTNNHNCQILKKSCLGVVVCSRNCSLPD-GSKLQLRPAICDKARQKQ-QKKLCPN--CNSALELIPCRGHSGYPVTNFWRVD--GKAIFFQAKGVHDHPRPESKSETEARRSAVKR 179          
BLAST of GCM domain-containing protein vs. Ensembl Xenopus
Match: gcm1 (glial cells missing transcription factor 1 [Source:NCBI gene;Acc:549669])

HSP 1 Score: 137.502 bits (345), Expect = 4.090e-35
Identity = 84/207 (40.58%), Postives = 112/207 (54.11%), Query Frame = 2
Query:  488 SDWDIKDAVLPQ-PEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVKYEHLPRINPENIFNIPLE 1105
            S+WDI D  LPQ PE    F+ WPD     IY+++N  A++H SGWAMRNTNNHN  ILKKSCLGV+ CS  C  P+    V L P I + AR+ Q +K  CPN  C G L    C G  G PVT++WR+      IYF  +G HDH KP  +++   +++  +K N     +        D+     K +       EN+ N PL+
Sbjct:   22 SNWDINDMKLPQDPEQTDWFQEWPDSYVKHIYSSSNRNAQRHLSGWAMRNTNNHNSRILKKSCLGVLVCSNDCTVPDGRK-VYLRPAICDKARQKQQSKH-CPN--CSGPLKLISCRGHGGFPVTNFWRH--EGPYIYFQTKGVHDHPKPETKLESESRKVGHKKRNAIVTTKLGLKRSRNDEALTGEKADQ------ENLSNTPLD 216          
BLAST of GCM domain-containing protein vs. Ensembl Xenopus
Match: GCM2 (glial cells missing homolog 2 [Source:NCBI gene;Acc:100488293])

HSP 1 Score: 128.257 bits (321), Expect = 2.558e-31
Identity = 72/163 (44.17%), Postives = 98/163 (60.12%), Query Frame = 2
Query:  494 WDIKDAVLPQP-EFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEK 979
            WDI D  LPQ  + + SF+ W DG    IYNA +  A++H SGWAMRNTNNHN  ILKKSCLGV+ CS+ C   +   ++ L P I + AR+ Q  KK C N  C+  L    C G SG PVT++WR +    +I+F A+G HDH +P  + +   +R   ++
Sbjct:   24 WDINDPKLPQDLKQFDSFQEWTDGYVRFIYNAEDKNAQRHLSGWAMRNTNNHNCQILKKSCLGVVVCSRNCTLLDGGKLL-LRPAICDKARQKQ-QKKMCSN--CNSALELIPCRGHSGYPVTNFWRLD--GKAIFFQAKGVHDHPRPESKSETEARRSAVKR 180          
BLAST of GCM domain-containing protein vs. Ensembl Xenopus
Match: gcm1 (glial cells missing transcription factor 1 [Source:NCBI gene;Acc:549669])

HSP 1 Score: 125.946 bits (315), Expect = 3.113e-31
Identity = 77/199 (38.69%), Postives = 105/199 (52.76%), Query Frame = 2
Query:  509 AVLPQPEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVKYEHLPRINPENIFNIPLE 1105
            A +  PE    F+ WPD     IY+++N  A++H SGWAMRNTNNHN  ILKKSCLGV+ CS  C  P+    V L P I + AR+ Q +K  CPN  C G L    C G  G PVT++WR+      IYF  +G HDH KP  +++   +++  +K N     +        D+     K +       EN+ N PL+
Sbjct:    9 AYILDPEQTDWFQEWPDSYVKHIYSSSNRNAQRHLSGWAMRNTNNHNSRILKKSCLGVLVCSNDCTVPDGRK-VYLRPAICDKARQKQQSKH-CPN--CSGPLKLISCRGHGGFPVTNFWRH--EGPYIYFQTKGVHDHPKPETKLESESRKVGHKKRNAIVTTKLGLKRSRNDEALTGEKADQ------ENLSNTPLD 195          
BLAST of GCM domain-containing protein vs. Ensembl Mouse
Match: Gcm2 (glial cells missing homolog 2 [Source:MGI Symbol;Acc:MGI:1861438])

HSP 1 Score: 133.265 bits (334), Expect = 5.479e-36
Identity = 73/158 (46.20%), Postives = 96/158 (60.76%), Query Frame = 2
Query:  494 WDIKDAVLPQ-PEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKR 964
            WDI D  +PQ P  +  F  WPDG    IY++   KA++H SGWAMRNTNNHN  ILKKSCLGV+ C++ C   +  S ++L P I + AR  Q  KK CPN  C   L    C G SG PVT++WR +   N+I+F A+G HDH +P  + +   +R
Sbjct:   21 WDINDPQMPQEPTHFDHFREWPDGYVRFIYSSQEKKAQRHLSGWAMRNTNNHNGHILKKSCLGVVVCARACALKD-GSHLQLRPAICDKARLKQ-QKKACPN--CHSPLELVPCRGHSGYPVTNFWRLD--GNAIFFQAKGVHDHPRPESKSETEGRR 172          
BLAST of GCM domain-containing protein vs. Ensembl Mouse
Match: Gcm2 (glial cells missing homolog 2 [Source:MGI Symbol;Acc:MGI:1861438])

HSP 1 Score: 135.961 bits (341), Expect = 4.855e-34
Identity = 76/168 (45.24%), Postives = 100/168 (59.52%), Query Frame = 2
Query:  494 WDIKDAVLPQ-PEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKR--LKCEKLNF 988
            WDI D  +PQ P  +  F  WPDG    IY++   KA++H SGWAMRNTNNHN  ILKKSCLGV+ C++ C      S ++L P I + AR  Q  KK CPN  C   L    C G SG PVT++WR +   N+I+F A+G HDH +P  + +   +R  LK +  +F
Sbjct:   21 WDINDPQMPQEPTHFDHFREWPDGYVRFIYSSQEKKAQRHLSGWAMRNTNNHNGHILKKSCLGVVVCARACAL-KDGSHLQLRPAICDKARLKQ-QKKACPN--CHSPLELVPCRGHSGYPVTNFWRLD--GNAIFFQAKGVHDHPRPESKSETEGRRSALKRQMASF 182          
BLAST of GCM domain-containing protein vs. Ensembl Mouse
Match: Gcm1 (glial cells missing homolog 1 [Source:MGI Symbol;Acc:MGI:108045])

HSP 1 Score: 122.865 bits (307), Expect = 6.664e-30
Identity = 68/161 (42.24%), Postives = 95/161 (59.01%), Query Frame = 2
Query:  485 ISDWDIKDAVLPQ-PEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKR 964
            I  WDI D  LPQ  +    F+ WPD     IY++ +  A++H S WAMRNTNNHN  ILKKSCLGV+ CS+ C    +   + L P I + AR+ Q  +K CPN  C+G L    C G  G PVT++WR++     I+F ++G HDH +P  +++   +R
Sbjct:   13 ILSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCSRDC-STEEGRKIYLRPAICDKARQKQ-QRKSCPN--CNGPLKLIPCRGHGGFPVTNFWRHDGRF--IFFQSKGEHDHPRPETKLEAEARR 167          
BLAST of GCM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q27403|GCM_DROME (Transcription factor glial cells missing OS=Drosophila melanogaster OX=7227 GN=gcm PE=1 SV=2)

HSP 1 Score: 165.622 bits (418), Expect = 9.591e-44
Identity = 85/187 (45.45%), Postives = 109/187 (58.29%), Query Frame = 2
Query:  491 DWDIKDAVLPQPEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVK 1051
            DWDI D+ +P    +  F  W +G C LIY+  +++ARKH SGWAMRNTNNHN  ILKKSCLGV+ CS  C  PN  S V L P I + ARR Q  K+ CPN +C+G L  Q C G  G PVTH+WR  +  N IYF A+G+HDH +P  +     +RL         L   L  +     K +S++
Sbjct:   33 DWDINDSKMPSVGEFDDFNDWSNGHCRLIYSVQSDEARKHASGWAMRNTNNHNVNILKKSCLGVLLCSAKCKLPNGAS-VHLRPAICDKARRKQQGKQ-CPNRNCNGRLEIQACRGHCGYPVTHFWR--RDGNGIYFQAKGTHDHPRPEAKGSTEARRLLAGGRRVRSLAVMLARESALSDKLSSLR 215          
BLAST of GCM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VLA2|GCM2_DROME (Transcription factor glial cells missing 2 OS=Drosophila melanogaster OX=7227 GN=gcm2 PE=2 SV=4)

HSP 1 Score: 143.28 bits (360), Expect = 2.638e-35
Identity = 76/161 (47.20%), Postives = 101/161 (62.73%), Query Frame = 2
Query:  491 DWDIKDAVLPQ--PEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQ-QLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKR 964
            +WDI DA++P    + +  F  W DG    IY+  N +A+KH SGWAMRNTNNHN  ILKKSCLGV+ CS+ C  PN  S + L P I + ARR Q  K  CPN  C G  ++ + C G  G PVTH+WR++   N+I+F A+G HDH +P+ +   + KR
Sbjct:   66 EWDINDAIVPHVPDQEFDEFNEWSDGHVRHIYSLHNEEAKKHISGWAMRNTNNHNVNILKKSCLGVLVCSQHCTLPN-GSKINLRPAICDKARRKQEGKA-CPNKSCRGGRLEIKPCRGHCGYPVTHFWRHS--GNAIFFQAKGVHDHLRPDPKNSSVSKR 222          
BLAST of GCM domain-containing protein vs. UniProt/SwissProt
Match: sp|O09102|GCM2_MOUSE (Chorion-specific transcription factor GCMb OS=Mus musculus OX=10090 GN=Gcm2 PE=2 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 3.205e-33
Identity = 76/168 (45.24%), Postives = 100/168 (59.52%), Query Frame = 2
Query:  494 WDIKDAVLPQ-PEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKR--LKCEKLNF 988
            WDI D  +PQ P  +  F  WPDG    IY++   KA++H SGWAMRNTNNHN  ILKKSCLGV+ C++ C      S ++L P I + AR  Q  KK CPN  C   L    C G SG PVT++WR +   N+I+F A+G HDH +P  + +   +R  LK +  +F
Sbjct:   21 WDINDPQMPQEPTHFDHFREWPDGYVRFIYSSQEKKAQRHLSGWAMRNTNNHNGHILKKSCLGVVVCARACAL-KDGSHLQLRPAICDKARLKQ-QKKACPN--CHSPLELVPCRGHSGYPVTNFWRLD--GNAIFFQAKGVHDHPRPESKSETEGRRSALKRQMASF 182          
BLAST of GCM domain-containing protein vs. UniProt/SwissProt
Match: sp|O75603|GCM2_HUMAN (Chorion-specific transcription factor GCMb OS=Homo sapiens OX=9606 GN=GCM2 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 3.511e-33
Identity = 83/212 (39.15%), Postives = 123/212 (58.02%), Query Frame = 2
Query:  494 WDIKDAVLPQP-EFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKR--LKCEKLNFNELNEFLFHDENFDQ-KFNSVKYEHLPRI-NPENIFNIPLECMY 1114
            WDI D  +PQ    +  F  WPDG    IY++   KA++H SGWAMRNTNNHN  ILKKSCLGV+ C++ C  P+  S ++L P I + AR  Q  KK CPN  C   L    C G SG PVT++WR +   N+I+F A+G HDH +P  + +   +R  +K +  +F +  +    +   ++ + +S  + ++P + NPE+ F+I  E  +
Sbjct:   21 WDINDPQMPQELALFDQFREWPDGYVRFIYSSDEKKAQRHLSGWAMRNTNNHNGHILKKSCLGVVVCTQACTLPD-GSRLQLRPAICDKARLKQ-QKKACPN--CHSALELIPCRGHSGYPVTNFWRLD--GNAIFFQAKGVHDHPRPESKSETEARRSAIKRQMASFYQPQKKRIRESEAEENQDSSGHFSNIPPLENPED-FDIVTETSF 225          
BLAST of GCM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9NP62|GCM1_HUMAN (Chorion-specific transcription factor GCMa OS=Homo sapiens OX=9606 GN=GCM1 PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.155e-29
Identity = 69/161 (42.86%), Postives = 94/161 (58.39%), Query Frame = 2
Query:  485 ISDWDIKDAVLPQ-PEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKR 964
            I  WDI D  LPQ  +    F+ WPD     IY++ +  A++H S WAMRNTNNHN  ILKKSCLGV+ C + C    +   + L P I + AR+ Q  K+ CPN  CDG L    C G  G PVT++WR++     I+F ++G HDH KP  +++   +R
Sbjct:   13 ILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDKNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCGRDC-LAEEGRKIYLRPAICDKARQKQQRKR-CPN--CDGPLKLIPCRGHGGFPVTNFWRHDGRF--IFFQSKGEHDHPKPETKLEAEARR 167          
BLAST of GCM domain-containing protein vs. TrEMBL
Match: A0A1B0FMT7 (GCM domain-containing protein OS=Glossina morsitans morsitans OX=37546 PE=4 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 9.699e-46
Identity = 92/187 (49.20%), Postives = 113/187 (60.43%), Query Frame = 2
Query:  491 DWDIKDAVLPQPEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVK 1051
            DWDI D+V+P    Y  F+ W +G C L+Y+A N  ARKH SGWAMRNTNNHN  ILKKSCLGV+ CS  C  PN N+ V L P I + ARR Q   KPCPN +C G L  Q C G  G PVTH+WR  +  NSI+F A+G+HDH +P  +     +RL         L   L  D   ++K NS+K
Sbjct:   26 DWDINDSVVPHVTEYDDFQDWANGHCRLVYSANNEDARKHSSGWAMRNTNNHNINILKKSCLGVLLCSDKCKLPNGNN-VNLRPAICDKARRKQ-QGKPCPNRNCSGRLEIQPCRGHCGYPVTHFWR--RSGNSIFFQAKGTHDHPRPEAKGSSEARRLLGTGRRVRSLAVLLARDAALNEKLNSLK 208          
BLAST of GCM domain-containing protein vs. TrEMBL
Match: A0A1A9XGX9 (GCM domain-containing protein OS=Glossina fuscipes fuscipes OX=201502 PE=4 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 1.070e-45
Identity = 92/187 (49.20%), Postives = 113/187 (60.43%), Query Frame = 2
Query:  491 DWDIKDAVLPQPEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVK 1051
            DWDI D+V+P    Y  F+ W +G C L+Y+A N  ARKH SGWAMRNTNNHN  ILKKSCLGV+ CS  C  PN N+ V L P I + ARR Q   KPCPN +C G L  Q C G  G PVTH+WR  +  NSI+F A+G+HDH +P  +     +RL         L   L  D   ++K NS+K
Sbjct:   26 DWDINDSVVPHVTEYDDFQDWANGHCRLVYSANNEDARKHSSGWAMRNTNNHNINILKKSCLGVLLCSDKCKLPNGNN-VNLRPAICDKARRKQ-QGKPCPNRNCSGRLEIQPCRGHCGYPVTHFWR--RSGNSIFFQAKGTHDHPRPEAKGSSEARRLLGTGRRVRSLAVLLARDAALNEKLNSLK 208          
BLAST of GCM domain-containing protein vs. TrEMBL
Match: A0A1B0A4X9 (GCM domain-containing protein OS=Glossina pallidipes OX=7398 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.249e-45
Identity = 92/187 (49.20%), Postives = 113/187 (60.43%), Query Frame = 2
Query:  491 DWDIKDAVLPQPEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVK 1051
            DWDI D+V+P    Y  F+ W +G C L+Y+A N  ARKH SGWAMRNTNNHN  ILKKSCLGV+ CS  C  PN N+ V L P I + ARR Q   KPCPN +C G L  Q C G  G PVTH+WR  +  NSI+F A+G+HDH +P  +     +RL         L   L  D   ++K NS+K
Sbjct:   26 DWDINDSVVPHVTEYDDFQDWANGHCRLVYSANNEDARKHSSGWAMRNTNNHNINILKKSCLGVLLCSDKCKLPNGNN-VNLRPAICDKARRKQ-QGKPCPNRNCSGRLEIQPCRGHCGYPVTHFWR--RSGNSIFFQAKGTHDHPRPEAKGSSEARRLLGTGRRVRSLAVLLARDAALNEKLNSLK 208          
BLAST of GCM domain-containing protein vs. TrEMBL
Match: A0A1A9W012 (GCM domain-containing protein OS=Glossina brevipalpis OX=37001 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.697e-45
Identity = 92/187 (49.20%), Postives = 114/187 (60.96%), Query Frame = 2
Query:  491 DWDIKDAVLPQPEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVK 1051
            DWDI D+V+P    Y  F+ W +G C L+Y+A+N  ARKH SGWAMRNTNNHN  ILKKSCLGV+ CS  C  PN N+ V L P I + ARR Q   KPCPN +C G L  + C G  G PVTH+WR  +  NSI+F A+G+HDH KP  +     +RL         L   L  D   ++K NS+K
Sbjct:   26 DWDINDSVVPNVTEYDEFQDWANGHCRLVYSASNEDARKHSSGWAMRNTNNHNINILKKSCLGVLLCSDKCKLPNGNN-VNLRPAICDKARRKQ-QGKPCPNRNCSGRLEIRPCRGHCGYPVTHFWR--RSGNSIFFQAKGTHDHPKPEAKGSSEARRLLGTGRRVRSLAVLLARDAALNEKLNSLK 208          
BLAST of GCM domain-containing protein vs. TrEMBL
Match: A0A1A9V9N8 (GCM domain-containing protein OS=Glossina austeni OX=7395 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 5.415e-45
Identity = 92/187 (49.20%), Postives = 113/187 (60.43%), Query Frame = 2
Query:  491 DWDIKDAVLPQPEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVK 1051
            DWDI D+V+P    Y  F+ W +G C L+Y+A N  ARKH SGWAMRNTNNHN  ILKKSCLGV+ CS  C  PN N+ V L P I + ARR Q   KPCPN +C G L  Q C G  G PVTH+WR  +  NSI+F A+G+HDH +P  +     +RL         L   L  D   ++K NS+K
Sbjct:  103 DWDINDSVVPHVTEYDDFQDWANGHCRLVYSANNEDARKHSSGWAMRNTNNHNINILKKSCLGVLLCSDKCKLPNGNN-VNLRPAICDKARRKQ-QGKPCPNRNCSGRLEIQPCRGHCGYPVTHFWR--RSDNSIFFQAKGTHDHPRPEAKGSSEARRLLGTGRRVRSLAVLLARDAALNEKLNSLK 285          
BLAST of GCM domain-containing protein vs. Ensembl Cavefish
Match: gcm2 (glial cells missing transcription factor 2 [Source:NCBI gene;Acc:103026873])

HSP 1 Score: 130.568 bits (327), Expect = 2.868e-32
Identity = 71/163 (43.56%), Postives = 99/163 (60.74%), Query Frame = 2
Query:  494 WDIKDAVLPQ-PEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEK 979
            WDI D  LPQ P+ +  F+ W DG    IY+A +  A++H SGWAMRNTNNHN  ILKKSCLGV+ C++ C   +  + ++L P I + AR+ Q  KK CPN  C   L    C G SG PVT++WR +    +I+F A+G HDH +P  + +   +R   ++
Sbjct:   23 WDINDPKLPQDPKQFDPFQEWTDGYVRYIYSAEDKNAQRHLSGWAMRNTNNHNCQILKKSCLGVVVCARGCTLAD-GTKLQLRPAICDKARQKQ-QKKLCPN--CSSALELVPCRGHSGYPVTNFWRVD--GKAIFFQAKGVHDHPRPESKSETEARRSAVKR 179          
BLAST of GCM domain-containing protein vs. Ensembl Sea Lamprey
Match: gcm2 (glial cells missing transcription factor 2 [Source:ZFIN;Acc:ZDB-GENE-050127-1])

HSP 1 Score: 126.716 bits (317), Expect = 1.164e-31
Identity = 71/163 (43.56%), Postives = 95/163 (58.28%), Query Frame = 2
Query:  494 WDIKDAVLPQP-EFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEK 979
            WDI D  LPQ  +    F+ W DG    +++A +  A++H SGWAMRNTNNHN  ILKKSCLGV+ C + C  P+    V L P I + AR+ Q  KK CPN  C   L    C G SG PVT++WR+      I+F A+GSHDH +P  + +   +R   ++
Sbjct:   23 WDINDPKLPQDLKQVDPFQEWNDGYARFVFSAEDKNAQRHLSGWAMRNTNNHNCAILKKSCLGVVACGRACTMPDGRK-VHLRPAICDKARQKQ-QKKLCPN--CGSPLDLLPCRGHSGYPVTNFWRHEGRF--IFFQAKGSHDHPRPESKTEAEARRSSSKR 179          
BLAST of GCM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001147.1 (pep scaffold:Pmarinus_7.0:GL476699:2797:4762:1 gene:ENSPMAG00000001027.1 transcript:ENSPMAT00000001147.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 5.568e-8
Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 2
Query:  782 KPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEK 979
            K CPN  C G L    C G SG PVT++WR+      ++F A+G HDH +P  + +   +R   +K
Sbjct:    1 KMCPN--CQGPLELVPCRGHSGYPVTNFWRHEGKL--VFFQAKGVHDHPRPESKTEAEGRRCAAKK 62          
BLAST of GCM domain-containing protein vs. Ensembl Nematostella
Match: EDO33215 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSU8])

HSP 1 Score: 129.413 bits (324), Expect = 2.269e-35
Identity = 64/143 (44.76%), Postives = 89/143 (62.24%), Query Frame = 2
Query:  533 YHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDK 961
            +  F  W DG C L Y+A + +A+ H SGWAM+ TNNHNK +LKK+C+GV+ CSK C  PN   IV + P IS+  R  Q+ +  CPN  C G L  + CTG +G PVTH+W +    + IYF ++G+HDH +P  +    D+
Sbjct:   11 FDEFNEWIDGSCKLRYSAYSREAQAHISGWAMKYTNNHNKYVLKKTCVGVLLCSKDCTLPNGLKIV-VRPAISDKVRERQIGQN-CPNASCSGILSHRKCTGNNGYPVTHFWVHQD--DGIYFESKGTHDHFRPQARRATPDR 149          
BLAST of GCM domain-containing protein vs. Ensembl Nematostella
Match: EDO25565 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DW44])

HSP 1 Score: 128.642 bits (322), Expect = 2.735e-35
Identity = 63/134 (47.01%), Postives = 86/134 (64.18%), Query Frame = 2
Query:  533 YHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKP 934
            +  F  W DG C L Y+A + +A+ H SGWAM+ TNNHNK +LKK+C+GV+ CSK C  PN   IV + P IS+  R  Q+ +  CPN  C G L  + CTG +G PVTH+W +    + IYF ++G+HDH +P
Sbjct:   11 FDEFNEWIDGSCKLRYSAYSREAQAHISGWAMKYTNNHNKYVLKKTCVGVLLCSKDCTLPNGLKIV-VRPAISDKVRERQIGQN-CPNASCSGILSHRKCTGNNGYPVTHFWVHQD--DGIYFESKGTHDHFRP 140          
BLAST of GCM domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000033677.1 (glial cells missing transcription factor 2 [Source:NCBI gene;Acc:101156002])

HSP 1 Score: 92.4337 bits (228), Expect = 6.938e-20
Identity = 53/113 (46.90%), Postives = 70/113 (61.95%), Query Frame = 2
Query:  626 MRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKR 964
            MRNTNNHN  ILKKSCLGV+ CS+ C  P+  S ++L P I + AR+ Q  KK CP+  C   L    C G SG PVT++WR +    SI+F A+G HDH +P  + +   +R
Sbjct:    1 MRNTNNHNCQILKKSCLGVVVCSRGCSLPD-GSRLQLRPAICDKARQKQ-QKKLCPS--CSAGLELLPCRGHSGYPVTNFWRVD--GKSIFFQAKGVHDHPRPESKSETEARR 107          
BLAST of GCM domain-containing protein vs. Planmine SMEST
Match: SMESG000056241.1 (SMESG000056241.1)

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 411/438 (93.84%), Postives = 414/438 (94.52%), Query Frame = 2
Query:  257 MNDPYDYIDCQNYPHNQFNYNSFKSFQTQNGWIFGGDGDLVQINDGLXXXXXXXXXXXEFHEHNSADAGILNSCFAISDWDIKDAVLPQPEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVKYEHLPRINPENIFNIPLECMYSPYVNKSYQQLMIKPHVEIFPSDINRNCQYISPVYXXXXXXXXXXXXXXXXHMSPLKNSSDFVNDEIQRLYCPEFQQNPNNANNMEYISRNIPFEISWNNTCAPQEQKVEVDKESLLICEELGDSINKNQIDCTNFKYSFRNELEMLDCFTK 1570
            MNDPYDYIDCQNYPHNQFNYNSFKSFQTQNGWIFGGDGDLVQINDGLSTNNNNNNSNTEFHEHNSADAGILNSCFAISDWDIKDAVLPQPEFYHSFEMWPDGDCHLIYNATNNKARKHK                      VIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVKYEHLPRINPENIFNIPLECMYSPYVNKSYQQLMIKPHVEIFPSD+NRNCQYISPVYNSS+SNSTDSINDNWNHMSPLK+SSDFVNDEIQRLYCPEF  NPNNANNMEYISRNIPFEISWNNTCAPQEQKVEVDKESLLICEELGDSINKNQIDCTNFKYSFRNELEMLDCFTK
Sbjct:    1 MNDPYDYIDCQNYPHNQFNYNSFKSFQTQNGWIFGGDGDLVQINDGLSTNNNNNNSNTEFHEHNSADAGILNSCFAISDWDIKDAVLPQPEFYHSFEMWPDGDCHLIYNATNNKARKHKR---------------------VIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVKYEHLPRINPENIFNIPLECMYSPYVNKSYQQLMIKPHVEIFPSDLNRNCQYISPVYNSSVSNSTDSINDNWNHMSPLKHSSDFVNDEIQRLYCPEFHMNPNNANNMEYISRNIPFEISWNNTCAPQEQKVEVDKESLLICEELGDSINKNQIDCTNFKYSFRNELEMLDCFTK 417          
BLAST of GCM domain-containing protein vs. Planmine SMEST
Match: SMESG000056241.1 (SMESG000056241.1)

HSP 1 Score: 728.398 bits (1879), Expect = 0.000e+0
Identity = 392/438 (89.50%), Postives = 396/438 (90.41%), Query Frame = 2
Query:  257 MNDPYDYIDCQNYPHNQFNYNSFKSFQTQNGWIFGGDGDLVQINDGLXXXXXXXXXXXEFHEHNSADAGILNSCFAISDWDIKDAVLPQPEFYHSFEMWPDGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVKYEHLPRINPENIFNIPLECMYSPYVNKSYQQLMIKPHVEIFPSDINRNCQYISPVYXXXXXXXXXXXXXXXXHMSPLKNSSDFVNDEIQRLYCPEFQQNPNNANNMEYISRNIPFEISWNNTCAPQEQKVEVDKESLLICEELGDSINKNQIDCTNFKYSFRNELEMLDCFTK 1570
            MNDPYDYIDCQNYPHNQFNYNSFKSFQTQNGWIFGGDGDLVQINDGLSTNNNNNNSNTEFHEHNSADAG    CFA              +FYHSFEMWPDGDCHLIYNATNNKARKHK                      VIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVKYEHLPRINPENIFNIPLECMYSPYVNKSYQQLMIKPHVEIFPSD+NRNCQYISPVYNSS+SNSTDSINDNWNHMSPLK+SSDFVNDEIQRLYCPEF  NPNNANNMEYISRNIPFEISWNNTCAPQEQKVEVDKESLLICEELGDSINKNQIDCTNFKYSFRNELEMLDCFTK
Sbjct:    1 MNDPYDYIDCQNYPHNQFNYNSFKSFQTQNGWIFGGDGDLVQINDGLSTNNNNNNSNTEFHEHNSADAGC---CFAT-------------KFYHSFEMWPDGDCHLIYNATNNKARKHKR---------------------VIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFHDENFDQKFNSVKYEHLPRINPENIFNIPLECMYSPYVNKSYQQLMIKPHVEIFPSDLNRNCQYISPVYNSSVSNSTDSINDNWNHMSPLKHSSDFVNDEIQRLYCPEFHMNPNNANNMEYISRNIPFEISWNNTCAPQEQKVEVDKESLLICEELGDSINKNQIDCTNFKYSFRNELEMLDCFTK 401          
BLAST of GCM domain-containing protein vs. Planmine SMEST
Match: SMESG000036444.1 (SMESG000036444.1)

HSP 1 Score: 159.458 bits (402), Expect = 1.121e-43
Identity = 84/196 (42.86%), Postives = 117/196 (59.69%), Query Frame = 2
Query:  431 EFHEHNSADAGILNSCFAISDWDIKDAVLPQPEFYHSFEMWPDGDCHLIYN-ATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCWYPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPVTHYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEFLFH 1015
              H  +S +  +  +   I++WD+ D  LPQ    + F++WPDG   L+Y+ + N + R+H SGWAMRNTNNHN+ ILKKSCLGV+ C K C  P     V L P I + AR+ Q+  K CPN  C+G LI Q C G  G PVTHYWR ++  + ++F A+G HDH KP+++    +++   E  N    N FL H
Sbjct:   11 RMHLESSINIDVTATTPLINEWDVADLSLPQLIETNDFQIWPDGHIKLVYDYSKNERVRRHISGWAMRNTNNHNREILKKSCLGVLLCEKKCIRPGTREYVVLRPAICDKARKKQMKNK-CPN--CNGNLILQPCKGNLGFPVTHYWRRDE--DRVFFQAKGIHDHLKPDLRPHRENRKKSSESNNVYMENNFLIH 201          
The following BLAST results are available for this feature:
BLAST of GCM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
GCM27.311e-3439.15glial cells missing transcription factor 2 [Source... [more]
GCM12.406e-3042.86glial cells missing transcription factor 1 [Source... [more]
back to top
BLAST of GCM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gcm9.568e-4545.45gene:FBgn0014179 transcript:FBtr0335492[more]
gcm9.568e-4545.45gene:FBgn0014179 transcript:FBtr0079855[more]
gcm22.632e-3647.20gene:FBgn0019809 transcript:FBtr0079837[more]
back to top
BLAST of GCM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gcm25.501e-3344.79glial cells missing transcription factor 2 [Source... [more]
gcm26.394e-3344.79glial cells missing transcription factor 2 [Source... [more]
back to top
BLAST of GCM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gcm14.090e-3540.58glial cells missing transcription factor 1 [Source... [more]
GCM22.558e-3144.17glial cells missing homolog 2 [Source:NCBI gene;Ac... [more]
gcm13.113e-3138.69glial cells missing transcription factor 1 [Source... [more]
back to top
BLAST of GCM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Gcm25.479e-3646.20glial cells missing homolog 2 [Source:MGI Symbol;A... [more]
Gcm24.855e-3445.24glial cells missing homolog 2 [Source:MGI Symbol;A... [more]
Gcm16.664e-3042.24glial cells missing homolog 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of GCM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q27403|GCM_DROME9.591e-4445.45Transcription factor glial cells missing OS=Drosop... [more]
sp|Q9VLA2|GCM2_DROME2.638e-3547.20Transcription factor glial cells missing 2 OS=Dros... [more]
sp|O09102|GCM2_MOUSE3.205e-3345.24Chorion-specific transcription factor GCMb OS=Mus ... [more]
sp|O75603|GCM2_HUMAN3.511e-3339.15Chorion-specific transcription factor GCMb OS=Homo... [more]
sp|Q9NP62|GCM1_HUMAN1.155e-2942.86Chorion-specific transcription factor GCMa OS=Homo... [more]
back to top
BLAST of GCM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B0FMT79.699e-4649.20GCM domain-containing protein OS=Glossina morsitan... [more]
A0A1A9XGX91.070e-4549.20GCM domain-containing protein OS=Glossina fuscipes... [more]
A0A1B0A4X91.249e-4549.20GCM domain-containing protein OS=Glossina pallidip... [more]
A0A1A9W0121.697e-4549.20GCM domain-containing protein OS=Glossina brevipal... [more]
A0A1A9V9N85.415e-4549.20GCM domain-containing protein OS=Glossina austeni ... [more]
back to top
BLAST of GCM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gcm22.868e-3243.56glial cells missing transcription factor 2 [Source... [more]
back to top
BLAST of GCM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gcm21.164e-3143.56glial cells missing transcription factor 2 [Source... [more]
ENSPMAT00000001147.15.568e-837.88pep scaffold:Pmarinus_7.0:GL476699:2797:4762:1 gen... [more]
back to top
BLAST of GCM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO332152.269e-3544.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO255652.735e-3547.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of GCM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000033677.16.938e-2046.90glial cells missing transcription factor 2 [Source... [more]
back to top
BLAST of GCM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000056241.10.000e+093.84SMESG000056241.1[more]
SMESG000056241.10.000e+089.50SMESG000056241.1[more]
SMESG000036444.11.121e-4342.86SMESG000036444.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030866 ID=SMED30030866|Name=GCM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1600bp
CCTTCAACGGATAAAACTAATGAAAAAATATTGTTGTTTTGTTGATTTTT
GAAATTTAGTAATGAGAATTGAATAGTTTTCATTTATTCCTTCAAATCAG
CTATAGAGAAATTAAAAAAAATTTTAAAAATAATTTAACGAGCGCCAATC
GATTTGCCTGTAAGAGCACTTGCACTGTGGTGCTCAAATCCTATTGGATA
AAATCAATAGTAATAATGGCTCCCGCAAAATAAGATTATATTACATTTCA
CCGCTAATGAATGACCCGTATGACTACATAGATTGTCAAAATTACCCACA
TAATCAATTCAATTATAATTCATTTAAGTCATTTCAAACACAAAATGGAT
GGATATTTGGTGGAGATGGGGATTTGGTGCAAATAAATGACGGCTTAAGT
ACCAATAACAACAATAATAATAGTAATACGGAATTTCACGAGCACAACTC
TGCCGATGCGGGTATCTTAAATTCGTGTTTTGCGATATCAGATTGGGACA
TTAAGGATGCTGTTTTGCCACAACCAGAATTCTATCACTCATTTGAAATG
TGGCCGGATGGAGACTGTCACTTGATTTATAATGCTACAAATAACAAAGC
AAGGAAACACAAAAGTGGGTGGGCAATGAGGAATACAAATAATCATAATA
AAATGATTTTGAAAAAATCTTGTCTAGGAGTAATCAAGTGTTCCAAAACT
TGTTGGTATCCAAACCAGAATAGCATTGTCAGACTTGCTCCCAAAATAAG
TGAAGCAGCTAGACGTTGTCAATTGAACAAAAAACCATGCCCCAATCCAG
ATTGTGATGGATTTCTAATTCAGCAGCTTTGCACTGGGAAATCCGGTAAT
CCAGTCACCCACTACTGGCGATATAATCAGCATACAAATAGCATATATTT
TATGGCTCGTGGATCCCATGACCATGAAAAACCAAATATCCAAATTAAGA
TGATCGATAAGCGTTTGAAGTGTGAAAAATTGAATTTCAATGAATTAAAT
GAGTTTTTATTTCACGATGAAAATTTTGATCAAAAATTCAATTCAGTCAA
ATACGAACATTTGCCAAGGATAAATCCAGAAAATATTTTCAATATTCCAC
TTGAGTGCATGTACTCTCCGTACGTCAATAAATCCTATCAACAATTAATG
ATAAAGCCTCACGTGGAAATCTTTCCGTCAGATATCAACCGAAACTGTCA
GTATATTTCACCAGTTTATAATTCATCAATATCAAACAGTACTGATTCAA
TTAATGACAACTGGAATCATATGAGTCCTTTGAAGAATAGCTCTGATTTT
GTAAACGACGAAATTCAAAGACTTTACTGTCCTGAATTCCAACAGAATCC
TAACAATGCTAACAATATGGAATATATCTCAAGAAATATCCCATTCGAAA
TATCGTGGAATAACACGTGTGCACCACAGGAGCAAAAAGTAGAAGTTGAT
AAAGAATCTTTATTAATTTGTGAAGAACTTGGTGATTCTATAAATAAGAA
TCAGATAGATTGTACTAATTTCAAATATTCGTTTAGAAATGAATTGGAAA
TGTTGGATTGTTTTACTAAATAAATAGTTTTATTTTTTTGTTTAAAAAAA
back to top

protein sequence of SMED30030866-orf-1

>SMED30030866-orf-1 ID=SMED30030866-orf-1|Name=SMED30030866-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=439bp
MNDPYDYIDCQNYPHNQFNYNSFKSFQTQNGWIFGGDGDLVQINDGLSTN
NNNNNSNTEFHEHNSADAGILNSCFAISDWDIKDAVLPQPEFYHSFEMWP
DGDCHLIYNATNNKARKHKSGWAMRNTNNHNKMILKKSCLGVIKCSKTCW
YPNQNSIVRLAPKISEAARRCQLNKKPCPNPDCDGFLIQQLCTGKSGNPV
THYWRYNQHTNSIYFMARGSHDHEKPNIQIKMIDKRLKCEKLNFNELNEF
LFHDENFDQKFNSVKYEHLPRINPENIFNIPLECMYSPYVNKSYQQLMIK
PHVEIFPSDINRNCQYISPVYNSSISNSTDSINDNWNHMSPLKNSSDFVN
DEIQRLYCPEFQQNPNNANNMEYISRNIPFEISWNNTCAPQEQKVEVDKE
SLLICEELGDSINKNQIDCTNFKYSFRNELEMLDCFTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0001228transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR043020GCM_large
IPR043021GCM_small
IPR039791GCM
IPR036115GCM_dom_sf
IPR003902Tscrpt_reg_GCM
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR043020GCM, large domainGENE3DG3DSA:3.30.1370.90coord: 107..226
e-value: 2.0E-43
score: 149.1
IPR003902Transcription regulator GCM domainPFAMPF03615GCMcoord: 94..231
e-value: 1.5E-50
score: 170.7
IPR003902Transcription regulator GCM domainPROSITEPS50807GCMcoord: 78..239
score: 42.678
IPR043021GCM, small domainGENE3DG3DSA:2.20.28.80coord: 142..230
e-value: 2.0E-43
score: 149.1
NoneNo IPR availablePANTHERPTHR12414:SF8TRANSCRIPTION FACTOR GLIAL CELLS MISSING-RELATEDcoord: 78..228
NoneNo IPR availablePRODOMPD014393coord: 79..265
e-value: 2.0E-39
score: 410.0
IPR039791Chorion-specific transcription factor GCMPANTHERPTHR12414GLIAL CELLS MISSING RELATED/GLIDEcoord: 78..228
IPR036115GCM domain superfamilySUPERFAMILYSSF90073GCM domaincoord: 79..231