Transformation/transcription domain-associated protein

Overview
NameTransformation/transcription domain-associated protein
Smed IDSMED30030865
Length (bp)12211
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transformation/transcription domain-associated protein (SMED30030865) t-SNE clustered cells

Violin plots show distribution of expression levels for Transformation/transcription domain-associated protein (SMED30030865) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transformation/transcription domain-associated protein (SMED30030865) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transformation/transcription domain-associated protein (SMED30030865) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Human
Match: TRRAP (transformation/transcription domain associated protein [Source:HGNC Symbol;Acc:HGNC:12347])

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 634/2656 (23.87%), Postives = 1192/2656 (44.88%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNST-SFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE---------------------------------------ALTGLSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNP-QINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEEVEQLIG-------AIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDS--RYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLS-VNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAA-----TDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLI---RELSYSDPSDSNNQSEEIKLYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I +    K G     N+ K    I  + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      D  ++  F +  L  K+A+P+RD L   P   I L+       P           P+ ST   ++   A+KII  + K++ +W  +   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    Y   E LF + R+F  R L ++  L++++ +   K   + ++    +     ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   Q+  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ +S +    F P    EQRR  +D+ E++I+W++ R K++                                       A   +SA+        G D    K I  Q  +++ N ++R+  Q+ D + T  +  +   RR + LL+TA  P +W    L ++   +          TV  P Q+N  + N+   L+ L+  L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K ++ N +++   L +L   + A  N  +++DR +   +    K+V E +   + S   E   G       ++E++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K+ E +   ++R  + ER L++  +  W++   +F    WI   +E+LL          +  KS     +C+   L     +T+  NL  S   A FA ++    E       E K     +   +  I     DQ S     +LS  +I N L+    +H++  + +++V  G +LS+ + + + S  L+   +  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C    +E   ++A+ Q G        Y+KA+  + +   +S  S   + +    Q + D   R  K+++QW++L ++   + ++N  +  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + +S   +L       +   +++W+ LP+  +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S I +WR+  +  ++    N++     ++++ +  +     +++  +  RKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LEN+F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L   L    RE   SDP      +   +    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++S   S    + +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   ++++ ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + +      + +    NSLD  N   M P+   W+
Sbjct: 1378 YLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITH----KGGQRSDGNEMKICSAI--INLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEATLNDPQWSRMF-MSFLKHKDARPLRDVLAANPNRFITLLL------PGGAQTAVRPGSPSTSTMRLDLQFQAIKIISIIVKNDDSWLASQHSLVSQLRRVWVSENFQER-HRKENMAATNWKEPKL---LAYCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKRALFFRFVDFNDPNFGDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHH---LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVNSVSSSIKRGLSVDSAQEVKRFRTATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNFLIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLM-------TVEQPNQVN--YGNICTGLEVLSFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATNANPSQLFGTLMIL---KSACSNNPSYIDRLISVFMRSLQKMVREHLNPQAASGSTEATSGTSELVMLSLELVKTRLAVMSMEMRKNFIQAILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDETLSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKR-RVYERLLYVTCSQNWEAMGNHF----WIKQCIELLL---------AVCEKSTPIGTSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESK-----EEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLQIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKY--SETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEY---QLWEDHWIRCSKELNQWEALTEYGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICH-----PEEQQLSFIERL---VEMASSLAIREWRRLPH--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQAIVTAYENSSQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KERQLHL-GVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDPGPIRATAPMWRC-SRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMFSSAAS----ESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3830          

HSP 2 Score: 345.51 bits (885), Expect = 6.889e-94
Identity = 279/900 (31.00%), Postives = 453/900 (50.33%), Query Frame = 3
Query: 1737 TLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIG-VNYDSTN------EHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            T  + D + L K L+ G+KTIT  ITS      +             I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +PT SA+ A +++ YLLD +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++ +   + Q GP I + F++     + LP+++ + TA+  LK    E   +       +AW  +K F+V                        M S  + +   YQ +   N+           H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C           S   +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E+   +I    EK    V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:  540 TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRV-ANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPTTSALFATILVEYLLDRLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLHYVVTEVQ-GPSITVEFSDCKAS-LQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVA-----------------------MMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKD---------EERAEEIVAAQEKSFHHVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYTELLNLCEA 1345          

HSP 3 Score: 330.487 bits (846), Expect = 2.082e-89
Identity = 176/467 (37.69%), Postives = 293/467 (62.74%), Query Frame = 3
Query:  195 QISLKEKLIIFFDDAKEI----DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC 1583
            Q +L +K + F     ++    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FV+ +YKEL    N+ F +      +++   P E   + T    K++ +++D        +I+P+   SLKV+ E+P+++VLMYQ +K  I N +A F+PLIM  + +  S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ +++ L+ KY+  +V+GM +++ N P+   ++RKE  IAA+HIL T E++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L+ ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C
Sbjct:   14 QTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQVIPENTVP--PPEMVGMITTIAVKVNPEREDSETR--THSIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVAEFVPLIMNTIAIQVSAQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE-LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHIL-TTELRNQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKC 471          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Human
Match: TRRAP (transformation/transcription domain associated protein [Source:HGNC Symbol;Acc:HGNC:12347])

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 633/2674 (23.67%), Postives = 1194/2674 (44.65%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNST-SFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE---------------------------------------ALTGLSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNP-QINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEEVEQ--------LIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDS--RYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLS-VNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAA-----TDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKLIRELSYSDPSDSNNQSEEIK------------LYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I +    K G     N+ K    I  + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      D  ++  F +  L  K+A+P+RD L   P   I L+       P           P+ ST   ++   A+KII  + K++ +W  +   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    Y   E LF + R+F  R L ++  L++++ +   K   + ++    +     ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   Q+  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ +S +    F P    EQRR  +D+ E++I+W++ R K++                                       A   +SA+        G D    K I  Q  +++ N ++R+  Q+ D + T  +  +   RR + LL+TA  P +W    L ++   +          TV  P Q+N  + N+   L+ L+  L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K ++ N +++   L +L   + A  N  +++DR +   +    K+V E +   + S   E         ++ ++E++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K+ E +   ++R  + ER L++  +  W++   +F    WI   +E+LL          +  KS     +C+   L     +T+  NL  S   A FA ++    E       E K     +   +  I     DQ S     +LS  +I N L+    +H++  + +++V  G +LS+ + + + S  L+   +  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C    +E   ++A+ Q G        Y+KA+  + +   +S  S   + +    Q + D   R  K+++QW++L ++   + ++N  +  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + +S   +L       +   +++W+ LP+  +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S I +WR+  +  ++    N++     ++++ +  +     +++  +  RKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LEN+F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L        R++   +     PS   NQS                    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++S   S    + +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   ++++ ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + +      + +    NSLD  N   M P+   W+
Sbjct: 1377 YLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITH----KGGQRSDGNEMKICSAI--INLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEATLNDPQWSRMF-MSFLKHKDARPLRDVLAANPNRFITLLL------PGGAQTAVRPGSPSTSTMRLDLQFQAIKIISIIVKNDDSWLASQHSLVSQLRRVWVSENFQER-HRKENMAATNWKEPKL---LAYCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKRALFFRFVDFNDPNFGDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHH---LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVNSVSSSIKRGLSVDSAQEVKRFRTATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNFLIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLM-------TVEQPNQVN--YGNICTGLEVLSFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATNANPSQLFGTLMIL---KSACSNNPSYIDRLISVFMRSLQKMVREHLNPQAASGSTEATSAGTSELVMLSLELVKTRLAVMSMEMRKNFIQAILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDETLSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKR-RVYERLLYVTCSQNWEAMGNHF----WIKQCIELLL---------AVCEKSTPIGTSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESK-----EEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLQIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKY--SETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEY---QLWEDHWIRCSKELNQWEALTEYGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICH-----PEEQQLSFIERL---VEMASSLAIREWRRLPH--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQAIVTAYENSSQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KERQLHL-GVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQQQPSSVGNQSHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMFSSAAS----ESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3848          

HSP 2 Score: 345.51 bits (885), Expect = 6.519e-94
Identity = 280/900 (31.11%), Postives = 453/900 (50.33%), Query Frame = 3
Query: 1737 TLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIG-VNYDSTN------EHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            T  + D + L K L+ G+KTIT  ITS     A              I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +PT SA+ A +++ YLLD +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++ +   + Q GP I + F++     + LP+++ + TA+  LK    E   +       +AW  +K F+V                        M S  + +   YQ +   N+           H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C           S   +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E+   +I    EK    V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:  540 TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGAQF------------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRV-ANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPTTSALFATILVEYLLDRLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLHYVVTEVQ-GPSITVEFSDCKAS-LQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVA-----------------------MMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKD---------EERAEEIVAAQEKSFHHVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYTELLNLCEA 1344          

HSP 3 Score: 330.872 bits (847), Expect = 1.858e-89
Identity = 176/467 (37.69%), Postives = 293/467 (62.74%), Query Frame = 3
Query:  195 QISLKEKLIIFFDDAKEI----DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC 1583
            Q +L +K + F     ++    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FV+ +YKEL    N+ F +      +++   P E   + T    K++ +++D        +I+P+   SLKV+ E+P+++VLMYQ +K  I N +A F+PLIM  + +  S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ +++ L+ KY+  +V+GM +++ N P+   ++RKE  IAA+HIL T E++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L+ ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C
Sbjct:   14 QTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQVIPENTVP--PPEMVGMITTIAVKVNPEREDSETR--THSIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVAEFVPLIMNTIAIQVSAQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE-LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHIL-TTELRNQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKC 471          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Human
Match: TRRAP (transformation/transcription domain associated protein [Source:HGNC Symbol;Acc:HGNC:12347])

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 633/2674 (23.67%), Postives = 1194/2674 (44.65%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNST-SFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE---------------------------------------ALTGLSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNP-QINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEEVEQ--------LIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDS--RYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLS-VNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAA-----TDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKLIRELSYSDPSDSNNQSEEIK------------LYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I +    K G     N+ K    I  + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      D  ++  F +  L  K+A+P+RD L   P   I L+       P           P+ ST   ++   A+KII  + K++ +W  +   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    Y   E LF + R+F  R L ++  L++++ +   K   + ++    +     ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   Q+  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ +S +    F P    EQRR  +D+ E++I+W++ R K++                                       A   +SA+        G D    K I  Q  +++ N ++R+  Q+ D + T  +  +   RR + LL+TA  P +W    L ++   +          TV  P Q+N  + N+   L+ L+  L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K ++ N +++   L +L   + A  N  +++DR +   +    K+V E +   + S   E         ++ ++E++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K+ E +   ++R  + ER L++  +  W++   +F    WI   +E+LL          +  KS     +C+   L     +T+  NL  S   A FA ++    E       E K     +   +  I     DQ S     +LS  +I N L+    +H++  + +++V  G +LS+ + + + S  L+   +  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C    +E   ++A+ Q G        Y+KA+  + +   +S  S   + +    Q + D   R  K+++QW++L ++   + ++N  +  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + +S   +L       +   +++W+ LP+  +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S I +WR+  +  ++    N++     ++++ +  +     +++  +  RKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LEN+F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L        R++   +     PS   NQS                    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++S   S    + +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   ++++ ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + +      + +    NSLD  N   M P+   W+
Sbjct: 1377 YLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITH----KGGQRSDGNEMKICSAI--INLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEATLNDPQWSRMF-MSFLKHKDARPLRDVLAANPNRFITLLL------PGGAQTAVRPGSPSTSTMRLDLQFQAIKIISIIVKNDDSWLASQHSLVSQLRRVWVSENFQER-HRKENMAATNWKEPKL---LAYCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKRALFFRFVDFNDPNFGDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHH---LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVNSVSSSIKRGLSVDSAQEVKRFRTATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNFLIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLM-------TVEQPNQVN--YGNICTGLEVLSFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATNANPSQLFGTLMIL---KSACSNNPSYIDRLISVFMRSLQKMVREHLNPQAASGSTEATSAGTSELVMLSLELVKTRLAVMSMEMRKNFIQAILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDETLSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKR-RVYERLLYVTCSQNWEAMGNHF----WIKQCIELLL---------AVCEKSTPIGTSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESK-----EEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLQIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKY--SETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEY---QLWEDHWIRCSKELNQWEALTEYGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICH-----PEEQQLSFIERL---VEMASSLAIREWRRLPH--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQAIVTAYENSSQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KERQLHL-GVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQQQPSSVGNQSHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMFSSAAS----ESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3848          

HSP 2 Score: 345.51 bits (885), Expect = 6.519e-94
Identity = 280/900 (31.11%), Postives = 453/900 (50.33%), Query Frame = 3
Query: 1737 TLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIG-VNYDSTN------EHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            T  + D + L K L+ G+KTIT  ITS     A              I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +PT SA+ A +++ YLLD +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++ +   + Q GP I + F++     + LP+++ + TA+  LK    E   +       +AW  +K F+V                        M S  + +   YQ +   N+           H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C           S   +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E+   +I    EK    V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:  540 TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGAQF------------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRV-ANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPTTSALFATILVEYLLDRLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLHYVVTEVQ-GPSITVEFSDCKAS-LQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVA-----------------------MMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKD---------EERAEEIVAAQEKSFHHVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYTELLNLCEA 1344          

HSP 3 Score: 330.872 bits (847), Expect = 1.858e-89
Identity = 176/467 (37.69%), Postives = 293/467 (62.74%), Query Frame = 3
Query:  195 QISLKEKLIIFFDDAKEI----DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC 1583
            Q +L +K + F     ++    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FV+ +YKEL    N+ F +      +++   P E   + T    K++ +++D        +I+P+   SLKV+ E+P+++VLMYQ +K  I N +A F+PLIM  + +  S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ +++ L+ KY+  +V+GM +++ N P+   ++RKE  IAA+HIL T E++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L+ ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C
Sbjct:   14 QTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQVIPENTVP--PPEMVGMITTIAVKVNPEREDSETR--THSIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVAEFVPLIMNTIAIQVSAQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE-LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHIL-TTELRNQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKC 471          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Human
Match: TRRAP (transformation/transcription domain associated protein [Source:HGNC Symbol;Acc:HGNC:12347])

HSP 1 Score: 629.402 bits (1622), Expect = 2.529e-180
Identity = 633/2692 (23.51%), Postives = 1196/2692 (44.43%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILY---EKFDKNGFID----------------TENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNST-SFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE---------------------------------------ALTGLSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNP-QINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEEVEQLIG-------AIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDS--RYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLS-VNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAA-----TDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKLIRELSYSDPSDSNNQSEEIK------------LYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I +   ++ D N  I                  E  E+  +    + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      D  ++  F +  L  K+A+P+RD L   P   I L+       P           P+ ST   ++   A+KII  + K++ +W  +   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    Y   E LF + R+F  R L ++  L++++ +   K   + ++    +     ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   Q+  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ +S +    F P    EQRR  +D+ E++I+W++ R K++                                       A   +SA+        G D    K I  Q  +++ N ++R+  Q+ D + T  +  +   RR + LL+TA  P +W    L ++   +          TV  P Q+N  + N+   L+ L+  L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K ++ N +++   L +L   + A  N  +++DR +   +    K+V E +   + S   E   G       ++E++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K+ E +   ++R  + ER L++  +  W++   +F    WI   +E+LL          +  KS     +C+   L     +T+  NL  S   A FA ++    E       E K     +   +  I     DQ S     +LS  +I N L+    +H++  + +++V  G +LS+ + + + S  L+   +  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C    +E   ++A+ Q G        Y+KA+  + +   +S  S   + +    Q + D   R  K+++QW++L ++   + ++N  +  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + +S   +L       +   +++W+ LP+  +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S I +WR+  +  ++    N++     ++++ +  +     +++  +  RKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LEN+F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L        R++   +     PS   NQS                    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++    S   ++ +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   ++++ ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + +      + +    NSLD  N   M P+   W+
Sbjct: 1093 YLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRSDGNESISECGRCPLSPFCQFEPAMEGVEEMKICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEATLNDPQWSRMF-MSFLKHKDARPLRDVLAANPNRFITLLL------PGGAQTAVRPGSPSTSTMRLDLQFQAIKIISIIVKNDDSWLASQHSLVSQLRRVWVSENFQER-HRKENMAATNWKEPKL---LAYCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKRALFFRFVDFNDPNFGDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHH---LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVNSVSSSIKRGLSVDSAQEVKRFRTATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNFLIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLM-------TVEQPNQVN--YGNICTGLEVLSFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATNANPSQLFGTLMIL---KSACSNNPSYIDRLISVFMRSLQKMVREHLNPQAASGSTEATSGTSELVMLSLELVKTRLAVMSMEMRKNFIQAILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDETLSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKR-RVYERLLYVTCSQNWEAMGNHF----WIKQCIELLL---------AVCEKSTPIGTSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESK-----EEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLQIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKY--SETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEY---QLWEDHWIRCSKELNQWEALTEYGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICH-----PEEQQLSFIERL---VEMASSLAIREWRRLPH--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQAIVTAYENSSQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KERQLHL-GVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQQQPSSVGNQSHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMF----SSAASESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3588          

HSP 2 Score: 345.51 bits (885), Expect = 6.487e-94
Identity = 275/893 (30.80%), Postives = 455/893 (50.95%), Query Frame = 3
Query: 1737 TLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            T  + D + L K L+ G+KTIT  ITS      +             I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +PT SA+ A +++ YLLD +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++ +   + Q GP I + F++     + LP+++ + TA+  LK    E   +       +AW  +K F+V ++     ++     ++ +    P  +   +            +    H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C           S   +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E+   +I    EK    V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:  255 TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRV-ANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPTTSALFATILVEYLLDRLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLHYVVTEVQ-GPSITVEFSDCKAS-LQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVAMM-----SLEDNKHALYQLLAHPNFTEKTIP-----------NVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKD---------EERAEEIVAAQEKSFHHVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYTELLNLCEA 1060          

HSP 3 Score: 159.073 bits (401), Expect = 1.474e-37
Identity = 80/190 (42.11%), Postives = 131/190 (68.95%), Query Frame = 3
Query: 1014 TLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC 1583
            TLSFLAY+++ +++ L+ KY+  +V+GM +++ N P+   ++RKE  IAA+HIL T E++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L+ ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C
Sbjct:    2 TLSFLAYIIRIYQE-LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHIL-TTELRNQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKC 186          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Human
Match: TRRAP (transformation/transcription domain associated protein [Source:HGNC Symbol;Acc:HGNC:12347])

HSP 1 Score: 625.55 bits (1612), Expect = 5.756e-179
Identity = 634/2679 (23.67%), Postives = 1191/2679 (44.46%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILY---EKFDKNGFIDTEND---------EKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNST-SFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE---------------------------------------ALTGLSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNP-QINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEEVEQLIG-------AIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDS--RYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLS-VNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAATDSSRVYRNE-------------IYLLLLELVRNGRKQHLSSCTKLYADKLKQ--QLPEM-VSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLI---RELSYSDPSDSNNQSEEIKLYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I +   ++ D N  I              E+  +    + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+A+P+RD L   P   I L+       P           P+ ST   ++   A+KII  + K++ +W  +   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    Y   E LF + R+F  R L ++  L++++ +   K   + ++    +     ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   Q+  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ +S +    F P    EQRR  +D+ E++I+W++ R K++                                       A   +SA+        G D    K I  Q  +++ N ++R+  Q+ D + T  +  +   RR + LL+TA  P +W    L ++   +          TV  P Q+N  + N+   L+ L+  L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K ++ N +++   L +L   + A  N  +++DR +   +    K+V E +   + S   E   G       ++E++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K+ E +   ++R  + ER L++  +  W++   +F    WI   +E+LL          +  KS     +C+   L     +T+  NL  S   A FA ++    E       E K     +   +  I     DQ S     +LS  +I N L+    +H++  + +++V  G +LS+ + + + S  L+   +  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C    +E   ++A+ Q G        Y+KA+  + +   +S  S   + +    Q + D   R  K+++QW++L ++   + ++N  +  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + +S   +L       +   +++W+ LP+  +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S I +WR+  +      +   ++     Y N              ++     +++ G+         +  D L +   +P + + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LEN+F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L   L    RE   SDP      +   +    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++S   S    + +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   ++++ ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + +      + +    NSLD  N   M P+   W+
Sbjct: 1378 YLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRSDGNESISECGRCPLSPFCQFEEMKICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDARPLRDVLAANPNRFITLL------LPGGAQTAVRPGSPSTSTMRLDLQFQAIKIISIIVKNDDSWLASQHSLVSQLRRVWVSENFQER-HRKENMAATNWKEPKL---LAYCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKRALFFRFVDFNDPNFGDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHH---LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVNSVSSSIKRGLSVDSAQEVKRFRTATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNFLIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLM-------TVEQPNQVN--YGNICTGLEVLSFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATNANPSQLFGTLMIL---KSACSNNPSYIDRLISVFMRSLQKMVREHLNPQAASGSTEATSGTSELVMLSLELVKTRLAVMSMEMRKNFIQAILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDETLSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKR-RVYERLLYVTCSQNWEAMGNHF----WIKQCIELLL---------AVCEKSTPIGTSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESK-----EEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLQIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKY--SETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEY---QLWEDHWIRCSKELNQWEALTEYGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICH-----PEEQQLSFIERL---VEMASSLAIREWRRLPH--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQGKPTWSGMHSSSIVTAYENSSQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KERQLH-LGVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDPGPIRATAPMWRC-SRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMFSSAAS----ESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3859          

HSP 2 Score: 345.51 bits (885), Expect = 6.317e-94
Identity = 279/900 (31.00%), Postives = 453/900 (50.33%), Query Frame = 3
Query: 1737 TLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIG-VNYDSTN------EHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            T  + D + L K L+ G+KTIT  ITS      +             I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +PT SA+ A +++ YLLD +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++ +   + Q GP I + F++     + LP+++ + TA+  LK    E   +       +AW  +K F+V                        M S  + +   YQ +   N+           H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C           S   +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E+   +I    EK    V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:  540 TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRV-ANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPTTSALFATILVEYLLDRLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLHYVVTEVQ-GPSITVEFSDCKAS-LQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVA-----------------------MMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKD---------EERAEEIVAAQEKSFHHVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYTELLNLCEA 1345          

HSP 3 Score: 330.872 bits (847), Expect = 1.893e-89
Identity = 176/467 (37.69%), Postives = 293/467 (62.74%), Query Frame = 3
Query:  195 QISLKEKLIIFFDDAKEI----DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC 1583
            Q +L +K + F     ++    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FV+ +YKEL    N+ F +      +++   P E   + T    K++ +++D        +I+P+   SLKV+ E+P+++VLMYQ +K  I N +A F+PLIM  + +  S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ +++ L+ KY+  +V+GM +++ N P+   ++RKE  IAA+HIL T E++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L+ ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C
Sbjct:   14 QTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQVIPENTVP--PPEMVGMITTIAVKVNPEREDSETR--THSIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVAEFVPLIMNTIAIQVSAQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE-LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHIL-TTELRNQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKC 471          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Celegans
Match: trr-1 (Transcription-associated protein 1 [Source:UniProtKB/Swiss-Prot;Acc:G5EEV2])

HSP 1 Score: 291.197 bits (744), Expect = 7.532e-78
Identity = 281/989 (28.41%), Postives = 497/989 (50.25%), Query Frame = 3
Query:  186 SHHQISLKEKLIIFFDDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQ-RPNFSNEVINFLKFVRNVYKEL--QNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNK----IDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNL-IPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKF--FKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKL--EKGCLV-------ETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKI-------------DEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTIT---LTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCF--ENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRT-AFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDF---INLPVKEIV 3023
            S+H   L+ ++    D+++  D++LK  QE     E     S + +V++ L     +    T PQF+ EN  QQLRK  LE+  ++ + E  K +SK  +  +M+L+  ENEEN  + +K++ D  +S  +  +  EV   +   + +  +L        +F      E  +      + +V+  +  T  + +   +N  +    + +N++P +  S KV+ E+P L++  YQ  K+ I  E   F+ L ++FLN+ +P E + K    N+ +  DF++AQ + LSF+  + K   F   +M+     LV G  +M+   P+++ ++R+E  +A ++   + E+K +F  +L  L+ E++++G G+T  + LR   Y  LADL+H +++ ++   I     ++ + +HD      +Q MS +LL +  E +    +H   +  + R+LLI+IL + V +L T++ +++P L  + G  +       E + ++P     +  ++        RL + ++ ++             DE    P     LP  T +  K   + ++  + T+T   L I  +  LV       +  +    I+       H  K  D F+     +L+RY +  MD++++     Q     P    + +  DEK  LE +  +F  +  A F+E+F+  + ++IER    +  +QL         E         A+ +LS+L+  M+++     +  L+ +LFK IF+++  N      + +L  +L  I+      AL+A++P ++  LLR LFRSIGGGA + LY +FL LLP +L  L+ L    H  Q+R+L  ELC+ VPVRLS+LLP+L LLM+PLV  +  S N ++QGLRTLELCVDN+ PEYL +NM PVRG +M  + +      +  + T AF++LGK G  NR  L + Q +Q  +  +     IN+ F+    D    I+LP+ E++
Sbjct:   18 SNHLTELETRIQNLADNSQRDDVKLKMLQEIWSTIENHFTLSSHEKVVERLILSFLQVFCNTSPQFIAENNTQQLRKLMLEIILRLSNVEAMKHHSKEIIKQMMRLITVENEENANLAIKIVTDQGRSTGKMQYCGEVSQIMVSFKTMVIDLTASGRAGDMFN---IKEHKAPPSTSSDEQVITEYLKTCYYQQTVLLNGTEGKPPLKYNMIPSAHQSTKVLLEVPYLVIFFYQHFKTAIQTEALDFMRLGLDFLNVRVPDEDKLKT---NQIITDDFVSAQSRFLSFVNIMAKIPAFMDLIMQN-GPLLVSGTMQMLERCPADLISVRREVLMALKY-FTSGEMKSKFFPMLPRLIAEEVVLGTGFTAIEHLRVFMYQMLADLLHHMRNSIDYEMITHVIFVFCRTLHDPNNSSQVQIMSARLLNSLAESLCKMDSH---DTFQTRDLLIEILESHVAKLKTLAVYHMPILFQQYGTEIDYEYKSYERDAEKPGMNIPKDTIRGVPKRRIRRLSIDSVEELEFLASEPSTSEDADESGGDPNK---LPPPTKEGKKTSPEAILTAMSTMTPPPLAIVEARNLVKYIMHTCKFVTGQLRIARPSQDMYHCSKERDLFE-----RLLRYGVMCMDVFVLPTTRNQ-----PQMHSSMRTKDEKDALESLANVFTTIDHAIFREIFEKYMDFLIERIYNRNYPLQLMVNTFLVRNE-----VPFFASTMLSFLMSRMKLLEVSNDKTMLYVKLFKIIFSAIGANGSGLHGDKMLTSYLPEILKQSTVLALTAREPLNYFLLLRALFRSIGGGAQDILYGKFLQLLPNLLQFLNKLTSCQHRIQMRELFVELCLTVPVRLSSLLPYLPLLMDPLVCAMNGSPNIVTQGLRTLELCVDNLQPEYLLENMLPVRGALMQGLWRVVSKAPDTSSMTAAFRILGKFGGANRKLLNQPQILQVATLGDSY---INMEFSRMGLDGNHSIHLPLSELM 974          

HSP 2 Score: 178.718 bits (452), Expect = 7.105e-44
Identity = 337/1657 (20.34%), Postives = 654/1657 (39.47%), Query Frame = 3
Query: 5364 FAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLM--------RF-DKIHYSHWTD-----IETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFL-TDLFVKRNYVWKQNLFRYYI--------TQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPP----------KPNEDADDIVAIFLNKLIDNQDCGDGGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVL-HTKKVSMDDVTS-QSQLHIGNLIVRHSDIYYQAKMHIL-PLMQYFISRLSNQN-----FQPEQRRCLLDMIELIIRWD---------IRTKEEAL----------TGLSAIGQD-------KSISDQQKESL---ANLIVRLMVQI------------LDQSQTNSANVDASCRRALFLLETAFHPLVWGP-INLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVM----CLDFLTTFLKLMDSNNILQNMKSFSKPLCDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNV--ELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEE-----------VEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLPKQEEHFAPGIREKSELLVKLWGKYHTWSDNA-DIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYL---EFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINC---------KEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILYQHNQT-WNKVKKVPVGDVLSSV--LLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK---LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTT-----EMQQSMAFAQQGQYDKALKISVESGSQSLN-----SSVEYKDIVMRQKFYDFNYRYLKKIS---QWDSLDKFLNGENVNY---LIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYC--------YSLIMNKMTSMPSGEDVSNTPQLDN---EFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDG-------MQLFSGIHNNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIH---------ITANAATDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLK--QQLPEM-----VSNSFTLYKQECKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLEN 9827
            FA  I+ +++KS P W ++       + K +   EF  R +        +F ++I     T+      + ILN    ++      Y+    +A  F    +  L  LR++L T++  K    W++ LF   +        T   +  +   + Y++     +P    A E      +  E+ G  P           P   +D++VA   + +  +++    G+ + + Q C L ++ A  +IH  + KKQG + RI++ FAWP +T      D   +Y G   +A +I +F INRKI+++VF  L      + +  I  A+ +L PA   R +D +  +L H KK+ +++  + Q   H+  ++VR+  +YY  ++ +L PL+      L   N     F  + RR  +++ E++I+W+         I + EEAL          T  S    D       + + D Q+  +   A++IV ++V+               QS  +   +   C+    LL  A  P +WG  ++  +  + ++  I  +  N + N   +T + N +      LD L   + +M   +++  M+   +PL   LNN            G  +  ++ +  +    K  ++ N   EL  L   + +F+ E F    +  S P    V   L   ++ +    +  A++D  +   V +  +   E +   + S++            E L   +E+++ R + +  +++R+ V  I  + II     K+++  +  L   +    Q+  F   I     LLV++     T   N  D+  + L V++ VFEN + +  +  +     F  G+ S     REK+    E     +  +++  R  +++   +W    FK   W+   L  +L  I        N +  +  +NC           +  DQPM+V +                K +E     + E                D   D      P +       +L    Q   ++       D L +V  +  + N +Q++S ++  +F   W+ L     + +T +   +V F+S+  HN +      + +  +LEAV     LP+           F++S H  W  GI ++E+ ++        I   ++N +  +   + G+    +   SL  LY  + E D    +W  +     T      MQ       Q   +K++  + E+ + ++N     +S ++   ++ +++  +   Y+   S   QW ++    NG+++ +   LI A S             H  + N V+E    +SQ+  C        Y+L     T M   E+ S T   +       + T   + +W++LP+  +++  HV +LQA NL  E  +        ++  S   +  +  ++KS++K ++NR P  SD   F S    WR  +   ++          +   A  + S V  + +    L + ++ +     + TK   +KL     +P M     V       +        E        E+LE+LE+V     + K  +A    ++A + S  ++ + A   F  A Q+    N + +     ++N
Sbjct: 1723 FAFSIVDRISKSCPEWLISPNSPIPRIKKLFSETEFNERYVVRALTEVKKFQEEIIVKRMTEHKYKVPKLILNTFLRYLRLNIYDYDLFIVIASCFNGNFVTDLSFLREYLETEVIPKVPLQWRRELFLRIMQKFDTDPQTAGTSMQHVKALQYLV-----IPTLHWAFERY----DTDEIVGTAPIDDSDSSMDVDPAGSSDNLVARLTSVIDSHRNYLSDGMVIVFYQLCTLFVQNASEHIHNNNCKKQGGRLRILMLFAWPCLTMY-NHQDPTMRYTGFFFLANIIERFTINRKIVLQVFHQLMTTYQQDTRDQIRKAIDILTPALRTRMEDGHLQILSHVKKILIEECHNLQHVQHVFQMVVRNYRVYYHVRLELLTPLLNGVQRALVMPNSVLEKFSWQTRRHAVEICEMVIKWELFRTLKTDHIISDEEALEVDKQLDKLRTASSTDRFDFEEAHNKRDMPDAQRTIIKEHADVIVNMLVRFCMTFHQNSGSSSTSQSGNHGVELTKKCQ---LLLRAALRPSMWGEFVSFRLTMIEKFLSIPND--NALRNDISSTAYANTIQNAQHTLDMLCNIIPVMPKTSLMTMMRQLQRPLIQCLNN------------GAQMTRLVTQIVSRLLEKTNVSVNGLDELEQLNQYISRFLHEHFGSLLKNLSGP----VLGVLGAFSLLRTICGHEPAYLDHLMPSFVKVMERAAKEHLAYVANSQDGNMVKNFFPDVAELLCACMELVRPRVDHISMEIKRSIVGGIIAELIIKSNHDKIIQTSVKLLGAMIS--TQDMEFT--ILTVLPLLVRIQSIIVTKFKNCKDLIADYLVVVITVFENSEYRNSEAGSRLWEGFFWGLKSSDPQTREKFSIVWEKTWPHMATVDIAHRMKYIMQNQDWSK--FKHAFWLKFALWGMLRTIAKRPTDPNNKRKKVILLNCATPWRTIEYAAKLKDQPMEVET--------------EMKREEPEPMEVDE---------------KDSQDDSKDAGEPKEKEKLTLELLLAGQQELLDEASNYDFADALDTVSQITFALNENQVTSKMWVVLFKSFWSSLSQSEIEDFTAL---VVPFMSSGVHNNYQTGVQDSVLAVWLEAVGDAVHLPSRL-------IEFISSKHECWHTGIRLLENHIWT-------IPKQLNNTLLREMKVAPGLAGDIETLESLGTLYNEISEFDQFAAIWERRAVFPDTMRAMSAMQLGDMELAQSYLEKSMSSTYETLAPTINPNNTSNSEKHVSPIIDKEYDHWMEMYITNCSELLQWQNVADVCNGKDMQHVRGLINAAS-------------HIPDWNVVEEC---KSQIAGCIPPSFHLDYTLFNLMSTVMRMNENSSPTHMKERCKIAIQECTEAHISRWRALPS--VVSYGHVKILQAMNLVREIEESTDIRIALLEAPSNKVDQALMGDMKSLMKVFRNRTPTTSDDMGFVSTWYDWRNQIHGMMLQRFEYWDKVGLNVAATGNQSIVPIHSMAQAQLAVAKHAKNLGFHNLTKDLLNKLAGLTAIPMMDAQDKVCTYGKTLRDMANSAADERVKNELLCEALEVLEDVRIDDLQ-KDQVAALLYHRANIHSVLDQAENADYTFSAASQLVDLQNSVTTTGIKLMKN 3277          

HSP 3 Score: 57.3806 bits (137), Expect = 3.055e-7
Identity = 60/288 (20.83%), Postives = 125/288 (43.40%), Query Frame = 3
Query: 3567 TRLLVDSITETMAYEDKDCIRIGTICLERITAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIE-YSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQL---SRITGR------NLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINA 4400
            + ++VD++   ++      I  G + L  I   +     +    S +P+     +++ +L H  AWYAR GG   +  +I      ++ D ++D +  +   I     +I  G+   A  CL+ ++  Y + E G+         E+E + + TI+   ++++ ++  H     N+ VRE A  ++      SR+               +P L  V   + PT ++  A      +     NY+F    NC +   ++ D+D ++++++ + +I +T T T  + NA
Sbjct: 1124 SSVMVDALIICLSETSSSFIIAGVMSLRHINETLSLTLPDIDQMSKVPMCKYLMEKVFKLCHGPAWYARSGGINAIGYMIESFPRKFVMDFVIDVVDSIMEVILGTVEEISSGSADSAYDCLKKMMRVYFIKEEGQ---------EEENLTLATIF---VSAISKHYFH----SNERVREFAIGLMDHCMVHSRLAPSLDKFYYRFKEFFEPELMRVLTTV-PTMSLADAGGSLDGV----QNYMF----NCPDGFDFEKDMDMYKRYLSHLLDIAQTDTFTLNQRNA 1386          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Celegans
Match: trr-1 (Transcription-associated protein 1 [Source:UniProtKB/Swiss-Prot;Acc:G5EEV2])

HSP 1 Score: 289.656 bits (740), Expect = 1.995e-77
Identity = 281/992 (28.33%), Postives = 498/992 (50.20%), Query Frame = 3
Query:  186 SHHQISLKEKLIIFFDDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQ-RPNFSNEVINFLKFVRNVYKEL--QNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNK----IDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNL-IPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKF--FKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKL--EKGCLV-------ETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKI-------------DEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTIT---LTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCF--ENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXX---XXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRT-AFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDF---INLPVKEIV 3023
            S+H   L+ ++    D+++  D++LK  QE     E     S + +V++ L     +    T PQF+ EN  QQLRK  LE+  ++ + E  K +SK  +  +M+L+  ENEEN  + +K++ D  +S  +  +  EV   +   + +  +L        +F      E  +      + +V+  +  T  + +   +N  +    + +N++P +  S KV+ E+P L++  YQ  K+ I  E   F+ L ++FLN+ +P E + K    N+ +  DF++AQ + LSF+  + K   F   +M+     LV G  +M+   P+++ ++R+E  +A ++   + E+K +F  +L  L+ E++++G G+T  + LR   Y  LADL+H +++ ++   I     ++ + +HD      +Q MS +LL +  E +    +H   +  + R+LLI+IL + V +L T++ +++P L  + G  +       E + ++P     +  ++        RL + ++ ++             DE    P     LP  T +  K   + ++  + T+T   L I  +  LV       +  +    I+       H  K  D F+     +L+RY +  MD++++     Q     P    + +  DEK  LE +  +F  +  A F+E+F+  + ++IER    +  +QL         E         A+ +LS+L+  M+++     +  L+ +LFK IF+++  N      + +L  +L  I+      AL+A++P ++  LLR LFRSIGGGA + LY +FL LLP +L     L++L    H  Q+R+L  ELC+ VPVRLS+LLP+L LLM+PLV  +  S N ++QGLRTLELCVDN+ PEYL +NM PVRG +M  + +      +  + T AF++LGK G  NR  L + Q +Q  +  +     IN+ F+    D    I+LP+ E++
Sbjct:   18 SNHLTELETRIQNLADNSQRDDVKLKMLQEIWSTIENHFTLSSHEKVVERLILSFLQVFCNTSPQFIAENNTQQLRKLMLEIILRLSNVEAMKHHSKEIIKQMMRLITVENEENANLAIKIVTDQGRSTGKMQYCGEVSQIMVSFKTMVIDLTASGRAGDMFN---IKEHKAPPSTSSDEQVITEYLKTCYYQQTVLLNGTEGKPPLKYNMIPSAHQSTKVLLEVPYLVIFFYQHFKTAIQTEALDFMRLGLDFLNVRVPDEDKLKT---NQIITDDFVSAQSRFLSFVNIMAKIPAFMDLIMQN-GPLLVSGTMQMLERCPADLISVRREVLMALKY-FTSGEMKSKFFPMLPRLIAEEVVLGTGFTAIEHLRVFMYQMLADLLHHMRNSIDYEMITHVIFVFCRTLHDPNNSSQVQIMSARLLNSLAESLCKMDSH---DTFQTRDLLIEILESHVAKLKTLAVYHMPILFQQYGTEIDYEYKSYERDAEKPGMNIPKDTIRGVPKRRIRRLSIDSVEELEFLASEPSTSEDADESGGDPNK---LPPPTKEGKKTSPEAILTAMSTMTPPPLAIVEARNLVKYIMHTCKFVTGQLRIARPSQDMYHCSKERDLFE-----RLLRYGVMCMDVFVLPTTRNQ-----PQMHSSMRTKDEKDALESLANVFTTIDHAIFREIFEKYMDFLIERIYNRNYPLQLMVNTFLVRNE-----VPFFASTMLSFLMSRMKLLEVSNDKTMLYVKLFKIIFSAIGANGSGLHGDKMLTSYLPEILKQSTVLALTAREPLNYFLLLRALFRSIGGGAQDILYGKFLQLLPNLLQFLNKLTNLQSCQHRIQMRELFVELCLTVPVRLSSLLPYLPLLMDPLVCAMNGSPNIVTQGLRTLELCVDNLQPEYLLENMLPVRGALMQGLWRVVSKAPDTSSMTAAFRILGKFGGANRKLLNQPQILQVATLGDTVQSYINMEFSRMGLDGNHSIHLPLSELM 980          

HSP 2 Score: 173.711 bits (439), Expect = 2.421e-42
Identity = 343/1662 (20.64%), Postives = 660/1662 (39.71%), Query Frame = 3
Query: 5364 FAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLM--------RF-DKIHYSHWTD-----IETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFL-TDLFVKRNYVWKQNLFRYYI--------TQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPP----------KPNEDADDIVAIFLNKLIDNQDCGDGGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVL-HTKKVSMDDVTS-QSQLHIGNLIVRHSDIYYQAKMHIL-PLMQYFISRLSNQN-----FQPEQRRCLLDMIELIIRWD---------IRTKEEAL----------TGLSAIGQD-------KSISDQQKESL---ANLIVRLMVQI------------LDQSQTNSANVDASCRRALFLLETAFHPLVWGP-INLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVM----CLDFLTTFLKLMDSNNILQNMKSFSKPLCDILNNQKVAQS-RFIKFFGMVLKAILLRFPAEPSNKQKITQNV--ELMDLYSTVLKFIQEAFSCYE--QKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEE-----------VEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLPKQEEHFAPGIREKSELLVKLWGKYHTWSDNA-DIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYL---EFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINC---------KEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILYQHNQT-WNKVKKVPVGDVLSSV--LLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK---LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQGQYDKA---LKISVESGSQSL-------NSSVEYKDI--VMRQKFYDFNYRYLKKIS---QWDSLDKFLNGENVNY---LIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYC--------YSLIMNKMTSMPSGEDVSNTPQLDN---EFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDG-------MQLFSGIHNNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIH---------ITANAATDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLK--QQLPEM-----VSNSFTLYKQECKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLEN 9827
            FA  I+ +++KS P W ++       + K +   EF  R +        +F ++I     T+      + ILN    ++      Y+    +A  F    +  L  LR++L T++  K    W++ LF   +        T   +  +   + Y++     +P    A E      +  E+ G  P           P   +D++VA   + +  +++    G+ + + Q C L ++ A  +IH  + KKQG + RI++ FAWP +T      D   +Y G   +A +I +F INRKI+++VF  L      + +  I  A+ +L PA   R +D +  +L H KK+ +++  + Q   H+  ++VR+  +YY  ++ +L PL+      L   N     F  + RR  +++ E++I+W+         I + EEAL          T  S    D       + + D Q+  +   A++IV ++V+               QS  +   +   C+    LL  A  P +WG  ++  +  + ++  I  +  N + N   +T + N +      LD L   + +M   +++  M+   +PL   LNN   AQ+ +  +    ++  +L         K  ++ N   EL  L   + +F+ E F      +  S P    V   L   ++ +    +  A++D  +   V +  +   E +   + S++            E L   +E+++ R + +  +++R+ V  I  + II     K+++  +  L   +    Q+  F   I     LLV++     T   N  D+  + L V++ VFEN + +  +  +     F  G+ S     REK+    E     +  +++  R  +++   +W    FK   W+   L  +L  I        N +  +  +NC           +  DQPM+V +                K +E     + E                D   D      P +       +L    Q   ++       D L +V  +  + N +Q++S ++  +F   W+ L     + +T +   +V F+S+  HN +      + +  +LEAV     LP+           F++S H  W  GI ++E+ ++        I   ++N +  +   + G+    +   SL  LY  + E D    +W  +     T   ++M+  Q G  + A   L+ S+ S  ++L       N+S   K +  ++ +++  +   Y+   S   QW ++    NG+++ +   LI A S             H  + N V+E    +SQ+  C        Y+L     T M   E+ S T   +       + T   + +W++LP+  +++  HV +LQA NL  E  +        ++  S   +  +  ++KS++K ++NR P  SD   F S    WR  +   ++          +   A  + S V  + +    L + ++ +     + TK   +KL     +P M     V       +        E        E+LE+LE+V     + K  +A    ++A + S  ++ + A   F  A Q+    N + +     ++N
Sbjct: 1729 FAFSIVDRISKSCPEWLISPNSPIPRIKKLFSETEFNERYVVRALTEVKKFQEEIIVKRMTEHKYKVPKLILNTFLRYLRLNIYDYDLFIVIASCFNGNFVTDLSFLREYLETEVIPKVPLQWRRELFLRIMQKFDTDPQTAGTSMQHVKALQYLV-----IPTLHWAFERY----DTDEIVGTAPIDDSDSSMDVDPAGSSDNLVARLTSVIDSHRNYLSDGMVIVFYQLCTLFVQNASEHIHNNNCKKQGGRLRILMLFAWPCLTMY-NHQDPTMRYTGFFFLANIIERFTINRKIVLQVFHQLMTTYQQDTRDQIRKAIDILTPALRTRMEDGHLQILSHVKKILIEECHNLQHVQHVFQMVVRNYRVYYHVRLELLTPLLNGVQRALVMPNSVLEKFSWQTRRHAVEICEMVIKWELFRTLKTDHIISDEEALEVDKQLDKLRTASSTDRFDFEEAHNKRDMPDAQRTIIKEHADVIVNMLVRFCMTFHQNSGSSSTSQSGNHGVELTKKCQ---LLLRAALRPSMWGEFVSFRLTMIEKFLSIPND--NALRNDISSTAYANTIQNAQHTLDMLCNIIPVMPKTSLMTMMRQLQRPLIQCLNNG--AQNFKMTRLVTQIVSRLL--------EKTNVSVNGLDELEQLNQYISRFLHEHFGSLLNCRNLSGP----VLGVLGAFSLLRTICGHEPAYLDHLMPSFVKVMERAAKEHLAYVANSQDGNMVKNFFPDVAELLCACMELVRPRVDHISMEIKRSIVGGIIAELIIKSNHDKIIQTSVKLLGAMIS--TQDMEFT--ILTVLPLLVRIQSIIVTKFKNCKDLIADYLVVVITVFENSEYRNSEAGSRLWEGFFWGLKSSDPQTREKFSIVWEKTWPHMATVDIAHRMKYIMQNQDWSK--FKHAFWLKFALWGMLRTIAKRPTDPNNKRKKVILLNCATPWRTIEYAAKLKDQPMEVET--------------EMKREEPEPMEVDE---------------KDSQDDSKDAGEPKEKEKLTLELLLAGQQELLDEASNYDFADALDTVSQITFALNENQVTSKMWVVLFKSFWSSLSQSEIEDFTAL---VVPFMSSGVHNNYQTGVQDSVLAVWLEAVGDAVHLPSRL-------IEFISSKHECWHTGIRLLENHIWT-------IPKQLNNTLLREMKVAPGLAGDIETLESLGTLYNEISEFDQFAAIWERRAVFPDT--MRAMSAMQLGDMELAQSYLEKSMSSTYETLAPTINPNNTSNSEKHVSPIIDKEYDHWMEMYITNCSELLQWQNVADVCNGKDMQHVRGLINAAS-------------HIPDWNVVEEC---KSQIAGCIPPSFHLDYTLFNLMSTVMRMNENSSPTHMKERCKIAIQECTEAHISRWRALPS--VVSYGHVKILQAMNLVREIEESTDIRIALLEAPSNKVDQALMGDMKSLMKVFRNRTPTTSDDMGFVSTWYDWRNQIHGMMLQRFEYWDKVGLNVAATGNQSIVPIHSMAQAQLAVAKHAKNLGFHNLTKDLLNKLAGLTAIPMMDAQDKVCTYGKTLRDMANSAADERVKNELLCEALEVLEDVRIDDLQ-KDQVAALLYHRANIHSVLDQAENADYTFSAASQLVDLQNSVTTTGIKLMKN 3288          

HSP 3 Score: 57.3806 bits (137), Expect = 3.267e-7
Identity = 60/288 (20.83%), Postives = 125/288 (43.40%), Query Frame = 3
Query: 3567 TRLLVDSITETMAYEDKDCIRIGTICLERITAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIE-YSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQL---SRITGR------NLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINA 4400
            + ++VD++   ++      I  G + L  I   +     +    S +P+     +++ +L H  AWYAR GG   +  +I      ++ D ++D +  +   I     +I  G+   A  CL+ ++  Y + E G+         E+E + + TI+   ++++ ++  H     N+ VRE A  ++      SR+               +P L  V   + PT ++  A      +     NY+F    NC +   ++ D+D ++++++ + +I +T T T  + NA
Sbjct: 1130 SSVMVDALIICLSETSSSFIIAGVMSLRHINETLSLTLPDIDQMSKVPMCKYLMEKVFKLCHGPAWYARSGGINAIGYMIESFPRKFVMDFVIDVVDSIMEVILGTVEEISSGSADSAYDCLKKMMRVYFIKEEGQ---------EEENLTLATIF---VSAISKHYFH----SNERVREFAIGLMDHCMVHSRLAPSLDKFYYRFKEFFEPELMRVLTTV-PTMSLADAGGSLDGV----QNYMF----NCPDGFDFEKDMDMYKRYLSHLLDIAQTDTFTLNQRNA 1392          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Celegans
Match: trr-1 (Transcription-associated protein 1 [Source:UniProtKB/Swiss-Prot;Acc:G5EEV2])

HSP 1 Score: 289.656 bits (740), Expect = 2.170e-77
Identity = 281/992 (28.33%), Postives = 498/992 (50.20%), Query Frame = 3
Query:  186 SHHQISLKEKLIIFFDDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQ-RPNFSNEVINFLKFVRNVYKEL--QNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNK----IDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNL-IPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKF--FKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKL--EKGCLV-------ETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKI-------------DEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTIT---LTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCF--ENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXX---XXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRT-AFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDF---INLPVKEIV 3023
            S+H   L+ ++    D+++  D++LK  QE     E     S + +V++ L     +    T PQF+ EN  QQLRK  LE+  ++ + E  K +SK  +  +M+L+  ENEEN  + +K++ D  +S  +  +  EV   +   + +  +L        +F      E  +      + +V+  +  T  + +   +N  +    + +N++P +  S KV+ E+P L++  YQ  K+ I  E   F+ L ++FLN+ +P E + K    N+ +  DF++AQ + LSF+  + K   F   +M+     LV G  +M+   P+++ ++R+E  +A ++   + E+K +F  +L  L+ E++++G G+T  + LR   Y  LADL+H +++ ++   I     ++ + +HD      +Q MS +LL +  E +    +H   +  + R+LLI+IL + V +L T++ +++P L  + G  +       E + ++P     +  ++        RL + ++ ++             DE    P     LP  T +  K   + ++  + T+T   L I  +  LV       +  +    I+       H  K  D F+     +L+RY +  MD++++     Q     P    + +  DEK  LE +  +F  +  A F+E+F+  + ++IER    +  +QL         E         A+ +LS+L+  M+++     +  L+ +LFK IF+++  N      + +L  +L  I+      AL+A++P ++  LLR LFRSIGGGA + LY +FL LLP +L     L++L    H  Q+R+L  ELC+ VPVRLS+LLP+L LLM+PLV  +  S N ++QGLRTLELCVDN+ PEYL +NM PVRG +M  + +      +  + T AF++LGK G  NR  L + Q +Q  +  +     IN+ F+    D    I+LP+ E++
Sbjct:   18 SNHLTELETRIQNLADNSQRDDVKLKMLQEIWSTIENHFTLSSHEKVVERLILSFLQVFCNTSPQFIAENNTQQLRKLMLEIILRLSNVEAMKHHSKEIIKQMMRLITVENEENANLAIKIVTDQGRSTGKMQYCGEVSQIMVSFKTMVIDLTASGRAGDMFN---IKEHKAPPSTSSDEQVITEYLKTCYYQQTVLLNGTEGKPPLKYNMIPSAHQSTKVLLEVPYLVIFFYQHFKTAIQTEALDFMRLGLDFLNVRVPDEDKLKT---NQIITDDFVSAQSRFLSFVNIMAKIPAFMDLIMQN-GPLLVSGTMQMLERCPADLISVRREVLMALKY-FTSGEMKSKFFPMLPRLIAEEVVLGTGFTAIEHLRVFMYQMLADLLHHMRNSIDYEMITHVIFVFCRTLHDPNNSSQVQIMSARLLNSLAESLCKMDSH---DTFQTRDLLIEILESHVAKLKTLAVYHMPILFQQYGTEIDYEYKSYERDAEKPGMNIPKDTIRGVPKRRIRRLSIDSVEELEFLASEPSTSEDADESGGDPNK---LPPPTKEGKKTSPEAILTAMSTMTPPPLAIVEARNLVKYIMHTCKFVTGQLRIARPSQDMYHCSKERDLFE-----RLLRYGVMCMDVFVLPTTRNQ-----PQMHSSMRTKDEKDALESLANVFTTIDHAIFREIFEKYMDFLIERIYNRNYPLQLMVNTFLVRNE-----VPFFASTMLSFLMSRMKLLEVSNDKTMLYVKLFKIIFSAIGANGSGLHGDKMLTSYLPEILKQSTVLALTAREPLNYFLLLRALFRSIGGGAQDILYGKFLQLLPNLLQFLNKLTNLQSCQHRIQMRELFVELCLTVPVRLSSLLPYLPLLMDPLVCAMNGSPNIVTQGLRTLELCVDNLQPEYLLENMLPVRGALMQGLWRVVSKAPDTSSMTAAFRILGKFGGANRKLLNQPQILQVATLGDTVQSYINMEFSRMGLDGNHSIHLPLSELM 980          

HSP 2 Score: 173.326 bits (438), Expect = 2.792e-42
Identity = 339/1660 (20.42%), Postives = 657/1660 (39.58%), Query Frame = 3
Query: 5364 FAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLM--------RF-DKIHYSHWTD-----IETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFL-TDLFVKRNYVWKQNLFRYYI--------TQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPP----------KPNEDADDIVAIFLNKLIDNQDCGDGGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVL-HTKKVSMDDVTS-QSQLHIGNLIVRHSDIYYQAKMHIL-PLMQYFISRLSNQN-----FQPEQRRCLLDMIELIIRWD---------IRTKEEAL----------TGLSAIGQD-------KSISDQQKESL---ANLIVRLMVQI------------LDQSQTNSANVDASCRRALFLLETAFHPLVWGP-INLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVM----CLDFLTTFLKLMDSNNILQNMKSFSKPLCDILNNQKVAQS-RFIKFFGMVLKAILLRFPAEPSNKQKITQNV--ELMDLYSTVLKFIQEAFSCYE--QKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEE-----------VEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLPKQEEHFAPGIREKSELLVKLWGKYHTWSDNA-DIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYL---EFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINC---------KEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILYQHNQT-WNKVKKVPVGDVLSSV--LLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK---LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTT-----EMQQSMAFAQQGQYDKALKISVESGSQSLN-----SSVEYKDIVMRQKFYDFNYRYLKKIS---QWDSLDKFLNGENVNY---LIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYC--------YSLIMNKMTSMPSGEDVSNTPQLDN---EFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDG-------MQLFSGIHNNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIH---------ITANAATDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLK--QQLPEM-----VSNSFTLYKQECKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLEN 9827
            FA  I+ +++KS P W ++       + K +   EF  R +        +F ++I     T+      + ILN    ++      Y+    +A  F    +  L  LR++L T++  K    W++ LF   +        T   +  +   + Y++     +P    A E      +  E+ G  P           P   +D++VA   + +  +++    G+ + + Q C L ++ A  +IH  + KKQG + RI++ FAWP +T      D   +Y G   +A +I +F INRKI+++VF  L      + +  I  A+ +L PA   R +D +  +L H KK+ +++  + Q   H+  ++VR+  +YY  ++ +L PL+      L   N     F  + RR  +++ E++I+W+         I + EEAL          T  S    D       + + D Q+  +   A++IV ++V+               QS  +   +   C+    LL  A  P +WG  ++  +  + ++  I  +  N + N   +T + N +      LD L   + +M   +++  M+   +PL   LNN   AQ+ +  +    ++  +L         K  ++ N   EL  L   + +F+ E F      +  S P    V   L   ++ +    +  A++D  +   V +  +   E +   + S++            E L   +E+++ R + +  +++R+ V  I  + II     K+++  +  L   +    Q+  F   I     LLV++     T   N  D+  + L V++ VFEN + +  +  +     F  G+ S     REK+    E     +  +++  R  +++   +W    FK   W+   L  +L  I        N +  +  +NC           +  DQPM+V +                K +E     + E                D   D      P +       +L    Q   ++       D L +V  +  + N +Q++S ++  +F   W+ L     + +T +   +V F+S+  HN +      + +  +LEAV     LP+           F++S H  W  GI ++E+ ++        I   ++N +  +   + G+    +   SL  LY  + E D    +W  +     T      MQ       Q   +K++  + E+ + ++N     +S ++   ++ +++  +   Y+   S   QW ++    NG+++ +   LI A S             H  + N V+E    +SQ+  C        Y+L     T M   E+ S T   +       + T   + +W++LP+  +++  HV +LQA NL  E  +        ++  S   +  +  ++KS++K ++NR P  SD   F S    WR  +   ++          +   A  + S V  + +    L + ++ +     + TK   +KL     +P M     V       +        E        E+LE+LE+V     + K  +A    ++A + S  ++ + A   F  A Q+    N + +     ++N
Sbjct: 1729 FAFSIVDRISKSCPEWLISPNSPIPRIKKLFSETEFNERYVVRALTEVKKFQEEIIVKRMTEHKYKVPKLILNTFLRYLRLNIYDYDLFIVIASCFNGNFVTDLSFLREYLETEVIPKVPLQWRRELFLRIMQKFDTDPQTAGTSMQHVKALQYLV-----IPTLHWAFERY----DTDEIVGTAPIDDSDSSMDVDPAGSSDNLVARLTSVIDSHRNYLSDGMVIVFYQLCTLFVQNASEHIHNNNCKKQGGRLRILMLFAWPCLTMY-NHQDPTMRYTGFFFLANIIERFTINRKIVLQVFHQLMTTYQQDTRDQIRKAIDILTPALRTRMEDGHLQILSHVKKILIEECHNLQHVQHVFQMVVRNYRVYYHVRLELLTPLLNGVQRALVMPNSVLEKFSWQTRRHAVEICEMVIKWELFRTLKTDHIISDEEALEVDKQLDKLRTASSTDRFDFEEAHNKRDMPDAQRTIIKEHADVIVNMLVRFCMTFHQNSGSSSTSQSGNHGVELTKKCQ---LLLRAALRPSMWGEFVSFRLTMIEKFLSIPND--NALRNDISSTAYANTIQNAQHTLDMLCNIIPVMPKTSLMTMMRQLQRPLIQCLNNG--AQNFKMTRLVTQIVSRLL--------EKTNVSVNGLDELEQLNQYISRFLHEHFGSLLNCRNLSGP----VLGVLGAFSLLRTICGHEPAYLDHLMPSFVKVMERAAKEHLAYVANSQDGNMVKNFFPDVAELLCACMELVRPRVDHISMEIKRSIVGGIIAELIIKSNHDKIIQTSVKLLGAMIS--TQDMEFT--ILTVLPLLVRIQSIIVTKFKNCKDLIADYLVVVITVFENSEYRNSEAGSRLWEGFFWGLKSSDPQTREKFSIVWEKTWPHMATVDIAHRMKYIMQNQDWSK--FKHAFWLKFALWGMLRTIAKRPTDPNNKRKKVILLNCATPWRTIEYAAKLKDQPMEVET--------------EMKREEPEPMEVDE---------------KDSQDDSKDAGEPKEKEKLTLELLLAGQQELLDEASNYDFADALDTVSQITFALNENQVTSKMWVVLFKSFWSSLSQSEIEDFTAL---VVPFMSSGVHNNYQTGVQDSVLAVWLEAVGDAVHLPSRL-------IEFISSKHECWHTGIRLLENHIWT-------IPKQLNNTLLREMKVAPGLAGDIETLESLGTLYNEISEFDQFAAIWERRAVFPDTMRAMSAMQLGDMELAQSYLEKSMSSTYETLAPTINPNNTSNSEKHVSPIIDKEYDHWMEMYITNCSELLQWQNVADVCNGKDMQHVRGLINAAS-------------HIPDWNVVEEC---KSQIAGCIPPSFHLDYTLFNLMSTVMRMNENSSPTHMKERCKIAIQECTEAHISRWRALPS--VVSYGHVKILQAMNLVREIEESTDIRIALLEAPSNKVDQALMGDMKSLMKVFRNRTPTTSDDMGFVSTWYDWRNQIHGMMLQRFEYWDKVGLNVAATGNQSIVPIHSMAQAQLAVAKHAKNLGFHNLTKDLLNKLAGLTAIPMMDAQDKVCTYGKTLRDMANSAADERVKNELLCEALEVLEDVRIDDLQ-KDQVAALLYHRANIHSVLDQAENADYTFSAASQLVDLQNSVTTTGIKLMKN 3288          

HSP 3 Score: 57.3806 bits (137), Expect = 3.322e-7
Identity = 60/288 (20.83%), Postives = 125/288 (43.40%), Query Frame = 3
Query: 3567 TRLLVDSITETMAYEDKDCIRIGTICLERITAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIE-YSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQL---SRITGR------NLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINA 4400
            + ++VD++   ++      I  G + L  I   +     +    S +P+     +++ +L H  AWYAR GG   +  +I      ++ D ++D +  +   I     +I  G+   A  CL+ ++  Y + E G+         E+E + + TI+   ++++ ++  H     N+ VRE A  ++      SR+               +P L  V   + PT ++  A      +     NY+F    NC +   ++ D+D ++++++ + +I +T T T  + NA
Sbjct: 1130 SSVMVDALIICLSETSSSFIIAGVMSLRHINETLSLTLPDIDQMSKVPMCKYLMEKVFKLCHGPAWYARSGGINAIGYMIESFPRKFVMDFVIDVVDSIMEVILGTVEEISSGSADSAYDCLKKMMRVYFIKEEGQ---------EEENLTLATIF---VSAISKHYFH----SNERVREFAIGLMDHCMVHSRLAPSLDKFYYRFKEFFEPELMRVLTTV-PTMSLADAGGSLDGV----QNYMF----NCPDGFDFEKDMDMYKRYLSHLLDIAQTDTFTLNQRNA 1392          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Fly
Match: Nipped-A (gene:FBgn0053554 transcript:FBtr0303293)

HSP 1 Score: 1145.95 bits (2963), Expect = 0.000e+0
Identity = 1065/4164 (25.58%), Postives = 1924/4164 (46.21%), Query Frame = 3
Query:  201 SLKEKLIIFFDDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQK-DMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLP-KIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINI--RFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHC------KYSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERITAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVH--YDIDVDN--HEKFINEIRNILETSTGTDEEI----NAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTXXXXXXXXXXXXSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRE--NYTLATNRQLYFCARLFHASFSERMCESLLVTKVKPVLDILYEKFDK-----NGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTSFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYV-WKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKP-NEDADDIVAIFLNKLIDNQDCGDGGLRVAYCQFCILILEYAPNYIH--EISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDIR------------TKEEAL-------------------------TGLSAIGQD-------KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWG-PINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSK--PLCDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKT-----------NSQSEEVEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLPKQEEHF-APGIREKSELLVKLWGKYH-TWSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWD---SRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTTEMQQS---MAFAQ--QGQYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDS-LDKFLNGENVNYLIKAESLWRKGQWKDI-IQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGI--HNNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLI-HITANAATDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQE--CKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLIRE-----------------------LSYSDPSDSNN--------QSEEIKLYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQI-------VSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNSK--ALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNKIEHLQSKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIK-FAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSED-AHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHK------YLVNNHEKKDMYSAELENCILEK--WLSSASEQIYNRISTVGRMDDDSITRDKI----QNSLDPLNQALMKPSHQIWI 12191
            + +  L I  D + + +L+LKA QE S+ FE   Q+  YP  L    +   + L   EPQF+QEN +Q +RK  LE+  ++P  E  +Q+ K  + +++K+++ +NEEN ++C+++++++HK  RP+F++E+  FL FV+ +Y  L NH   IF  S    +  + +  +E  + E+++V  IH ++  D N  +  +N+LP+   SLKV+QE+P+++VLMYQ +K+ +  E++ FIPLI+  +NL P+  ++      + +Y++F+ AQ+KTLSFLAY+V+ F++ ++   + S+  GM  ++ N P    ++RKE  IAARHI  T +++ +F+  +  L +ED+LIG G T++  +RPLAYSTLADL H V+  LN+  + KA N++ KN+HD++L   IQ MS KLLLN ++ +++   H+  E    + LL K+L   VK+  TI+K  LP + + C         +         +        +  P L   I    +    +  + ++ + +F+ L K L+ G+KTIT    +S                       D + ++ +K      V  Y  L+ Y +  +D+Y I     Q  QR  ++ L ++  +EK +LE    IFL +   NF+E+F T I +++ER   N    Q  Q+I ++S   +PT S + A +++ YLL+ ME +G     ++L+ RLFK +F SV    V  E +L  HL +IV   M+ AL +++P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   +RDL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   ISQGLRTLELCVDN+ P++LY ++ PVR  +M A+ ++ R   +     AF+VLGK G  NR  ++E Q +   S+     P I+I   F E+ E  I+ PV E + +A + L     +   + +S  V++   FL +FI  + DE   ++ +  F+   F          VE     W      ST +H+     N    +TH+                      +AL+G+ +      +R +    +  +V+  T+ A+A+         Y  T   D              +L+D++   M +E+K+  + G  C+  I     +   NK  A  +PI    A++++ L +   WY++ GGC  +  L + +    L+ +L +FLK   + + DL   +  GA+ + K+ ++ ++E  L  I +           + I +  +  K    V   ++  + + N  VRE++  +L+ +  I  + ++ ++ PH  V++DI+PP   + +  P + QI +++ N        C       + ID+ N  H+ F +E+  + E    T  ++    N P +   P+ + A                               AC Y                 S + Y    K+K    +FK M S   E+  TAF C++ F++   +  E   + ++PLL    +  N ++   ++L +  ++F   F+E++ E +L      +++I   ++       N F  ++  E    ++  +E+F  + +AS KY++ L +LVLK E+ +   ++S  R+ LI +L + PTETV LFL                  +D +  +     L+++  +    + K S  +  ++      + P  +  + + H AV II  L +S+  W    + + +AL   W +  + S L   D +    W  I  I  LL  F +   D  E LF + R+   R +  ++ LR FL     +   V WK+N F Y++   +N   + ++   I   +I+P F V+ +      E  +L G PP P  ED  +IV++F+NK+ D     D  +R+A  Q   L++E A  +IH  + +NK+QG+K R ++TFAWP + ++    D   +Y G   ++++I++  I++KI+++VF  L KG+ +E + ++  AL VL PA   R +D N ++ H TKK+ +++  +  QL HI  LI+RH  +Y+  +     L+Q+ I+ +    F P    E ++  +D+ E+II+W++             T+EE +                         T +  +G         +SI     +++ N ++RL  Q+ D      +  ++  RR + LL+ A  P +W  P ++ +  L +       V  TV  P  N   NN+   +DFLT    ++  + ++  ++   +   LC I  N     +R ++   M L  I+  FP +  +K +     +L  LY+ V K I E  + YE+ P  PN++ +   L +L   +    N  +++DR L+  + + + L  + I T           +S +  +E L+ ++E+IK+R  V+  ++R+  +  I V  I    + K++K ++  L  W+K  +       P IREKS LLVKL       ++D  ++  + L ++  ++ +E L+  +  N  + AF  G+  Q  +VR K+ E     +RR  L +R L++I +  WD   S Y     WI   +E+L+L             + M +I C  E    P  +TS   + + ++     SF +  ++H    ++           +   +    +  +       V +  ++Y+  +     + +    +L +   + +   QL+ SV+  +FP++W++      D    + +E++ FLS+ G N +     P+ +  F+E++ K  P  +     +   +L  SHNLW   I+V+ED     S   K I  G +   + D  +SN I      F SL+ +Y  + EED   GLW +      T +  S   M F +  QG YD A+    +  S  + ++    ++++ +  +    R  K+++QWD  LD     ++ N  +  ES WR   W  + I   K  Q  ++          Y + + + K       ++   T  ++      +   +++W+ LPN  I++  H+  LQA    +E  +  Q+  G+    NN   ++K+++K+W+NR P  SD  S  SDI  WR+  +  +  H+   +   S+ +  +     ++   +  RK +L+   +    ++       + + F   +Q+  C ++M     ++   E+LE++E+ + + F  + + A+FY  K +L +   + +EA + F  A Q+     K W+++ D++E +F     ER+              +  A  AL      S N + + K    +AK LW ++ D++  ++   LE+    +P S  LPW   ++ CL + EG  ++++L ++   +P+AVY   R L   L  E                       LS+   +   N         +  +     V+   ++ + + L  ++    Q+ W   SW+E++L Q+        +I     D +    ++       +KL   F + + N+          +  I N     ++ R                R          Q ++ +F+NDF  SK  A+ L   ++KL K WI +L   V     +  ++++ R L+  +Q + ++ LPG+L +     +++ IA   P VE V  N    RR+ IR +NG  + Y +          V+DS      +     +E++ Q+ R+LN  L K++E+ RR LN+  PR++ I+                 Q  +  +N   +SL  I+   C +                         Q+  D+ ++   ++     ++E + R        +   ++ I      + ++K +A    +   D+W  RK LT   A+  + ++ + ++ L A    +      + IS  +  +++D   L     +PFRL+PN+  F+   G         + PL+A+++AT          + ++++ +LRD  I   K       L+   E  D YS    NC+      ++SA + I  R + +     DSI   KI    Q++ +  N   M P+   W+
Sbjct:   11 TFRNYLNILNDSSSKDELKLKATQELSEHFEMIMQSPAYPSFLDNSLKIFMRILQDGEPQFIQENTMQHIRKLILEMIHRLPITESLRQHVKTIITMMLKILKTDNEENVLVCLRIIIELHKHFRPSFNSEIQLFLGFVKEIYTNLPNHLTSIFETSNDVWVTDLKDLNLEVLLSESYSVRTIHVEKALDSNSQQQIYNLLPRGILSLKVLQELPIIVVLMYQIYKNAVHQEVSEFIPLILTTINLQPTVTRRNSPQ--KEIYVEFMGAQIKTLSFLAYIVRIFQEVVIAS-SLSVTSGMLNLMKNCPKEAAHLRKELLIAARHIFAT-DLRQKFIPSIEQLFDEDLLIGKGVTLDS-IRPLAYSTLADLAHHVRQSLNIDVLIKAVNLFSKNVHDESLAVGIQTMSCKLLLNLVDCLRH---HSETEPQRSKALLSKLLKVFVKKFETIAKIQLPLIIQKCKGHAFSGALV--------NSSGNASLSHINAPDLKDDISNIQVSASGSQWIYSVNVAEFRSLVKTLVGGVKTITWGFFNSK------------------FQLTDTKLANHEKIFGPEIVCSYIDLVYYAMEALDIYTINVNPNQ--QR--TSGLISRSKEEKEVLEHFSGIFLMMHSQNFQEIFSTTINFLVERIYKN----QSLQVI-ANSFLANPTTSPLFATVLVEYLLNKMEEMGSNLERSNLYLRLFKLVFGSVSLFPVENEQMLRPHLHKIVNRSMELALISEEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLEGLNRLQSGFHKQHMRDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSPTLISQGLRTLELCVDNLQPDFLYDHIQPVRAALMQALWKTLR-NQDNAALVAFRVLGKFGGGNRKMMVEPQAL---SYIINDKPTISIVTYFQEY-ETPIDFPVDEAIKSAFRALGSNSTDQFYRRQSWEVIR--CFLAAFI-SLDDE--KHMLLKLFTHVDF----------VENKIMNW------STFQHK---AGNETVRETHQ----------------------TALIGMLVASATKDLRDSVCPVMAAVVRHYTMVAIAQQAGPFPQKGYQATHGID------------PMILIDALASCMGHEEKELCKPGIACMGIILDTATNIMGNKDRACKLPIIQYLAEKMVSLCYDRPWYSKVGGCQAIQFLCKHMSLRALFQNLFNFLKAFMFVLMDLEGDVSNGAIEITKSYMKSMLEICLTPINECY---------KNIDLKDLQAKATYEVIHELVRHITSPNTIVREESMVLLKHIGTIQSKTVSEVMDPHKDVLADIIPPKKHLLRHQPANAQIGLMDGNTF------CTTLEPRLFTIDLTNTYHKLFFHELLTLSEAEDATLAKLDCYKNVPNL--IPLRTSA--------------------------LRALAACHYI----------------SDIGY----KEKIINIIFKVMESDKSELQTTAFHCMKHFITGVTLEKEKVQSAMRPLLLKLGDHRNLSIPAIKRLSYFTQIFPQMFNEKLSEQIL-QHCSKIMEIFVSEYKSTSPNVNFFASSKGGEYEQKIVILIEMFFYI-SASVKYIEKLCQLVLKTEKNLMIEASSPYREALIKFLQRFPTETVDLFLTESLM-------------IDPQWNRLFIYLLKHETGVSFRAVIKSSRYNNLIHYLNTHTEFP-EALKYEIQHQAVLIIFTLMESDDQWIPTRQDIVDALKNCWQN--YLSTLSSED-VLCDLWHLIGKI--LLHYFSNNTNDI-ELLFQLLRALCFRFIPDVYFLRDFLQHTVAQSFTVNWKRNAFFYFVENFNNSFLSEELKAKIITAVIIPCFAVSFDK----GEGNKLIGAPPTPYQEDEKNIVSVFINKVFDPDKQYDDAVRIALLQLACLLVERASQHIHDGDANNKRQGNKLRRLMTFAWPCLLSKSS-VDPTARYHGHLLLSHIIARLAIHKKIVLQVFHSLLKGHALEARSIVKQALDVLTPAMPLRMEDGNTMLTHWTKKIIVEEGHAMQQLFHILQLIIRHYKVYFPVRHQ---LVQHLINYMQRLGFPPTASIEHKKLAVDLAEVIIKWELHRIKDDRETKTDGTEEELIQESSVKRSGIDLVETRKKSFDIIRETTVQGVGSHTKPDDILRSIDKSYCDTVLNFLIRLACQVNDPQAPILSPGESLSRRCVMLLKMAMRPEIWPQPFDIKLNWLDK-------VLATVETPHHN--LNNICTGIDFLTFLTTILSPDQLVSIIRPVQRGLSLCIIHQN-----TRIVRLMHMFLTRIMAIFPPDTQHKHE-----DLDLLYTAVSKMIAENLTSYEKSP-QPNASSLFGTLMIL---KACTTNNASYIDRILVQFIRVLNHLTRDHINTIGGNTVISQSPDSNALPLELLVLSLELIKNRIFVMSVEIRKLFIGTILVSLIEKSTEVKIIKCIIKMLDEWIKTKEPNVMTQVPSIREKSALLVKLMQNVEKKFTDEIELNIQFLEIINFIYRDEILKQTELTNKLEGAFLNGLRFQNPNVRSKFFEILDSSMRR-RLHDRLLYIICSQAWDTIGSHY-----WIKQCIELLILT-----------ANTMMQIQCSNEQFKIP-SITSV--IPVNSSETQENSFVSFLSSHSESFDIIQTVDDKDDVYDIDLNADRKEDCQQILPNRRVTLVELVYKQAEFLEANRNIRTDQMLVATSQLCHIDTQLAQSVWLSMFPRIWSIFTE---DQRCNITKELIPFLSS-GTNVNQKDCHPSTLNTFVESLTKCAPPIY--IPPNLLAYLGKSHNLWHRAILVLEDMAVNQSMQSKDIDGGENQFSDLDVQQSNNI------FDSLSKMYSSMHEEDLWAGLWLKFAHYPETNIAVSYEQMGFFEEAQGAYDLAMTKFKQDLSNGVVNTYVNSELLLWENHW---MRCAKELNQWDILLDYAQTNKDKNMFLILESSWRVPDWNLMKIALAKTEQCYLKH---------YGFKINLYKGYLSILHQEERQTGNIERYVEIASSLCIREWRRLPN--IVSHIHLPYLQASQQIMELHEASQIHQGLAQSRNNSLHDMKAIVKTWRNRLPIISDDLSHWSDIFTWRQHHYQIITQHLEQQSDQGSTMLGVHASAQAIISFGKIARKHNLTGVCQETLSRIYTIPSVPIVDCFQKIRQQVKCYLQMPSTSGKNEINEALEVIESTNLKYFTGEMN-AEFYALKGLLLAQIGRSEEAGKSFSVAAQLHDGLTKAWAMWGDYMEQIFLK---ERK--------------ITLAVDALICYLQASRNQI-ESKTRKYIAKVLWFLSYDNNTKILISTLEKHVAGIPPSYWLPWIPQLLCCLEQFEGDVILNLLSQIGRLYPQAVYFPIRTLYLTLKIEQREKHKTAEQAVKSSCSNIDGTTLSFGRGASHGNIPSINPIKATPPMWRCSKVMQLQREVHPTILSSLEGIVDQMVWFRESWTEEVLRQLRQGLIKCYAIAFEKRDTVQHSTITPHTLHFVKKLGSTFGIGIENV------PGSVTSSISNSAASESLAR----------------RAQVTFQDPVFQKMKEQFTNDFDFSKPGAMKLHNLISKL-KTWIKVLETKVKKLPTSFLIEDKCRFLSNFSQKTAEVELPGELLIPLSSHYYVRIARFMPRVEIVQKNNTAARRLYIRGTNGKIYPYLV----------VLDS-----GLGDARREERVLQLKRMLNYYLEKQKETSRRFLNITVPRVVPISP----------------QMRLAEDNPNSISLLKIFKKCCQSM------------------------QVDYDMPIVKYYDR-----LSEVQARGTPTTHTLLREIFSEIQWTMVPKTLLKHWALKTFLAATDFWHFRKMLTLQLALAFLCEHALNLTRLNADMMYLHQDSGLMNISYFKFDVNDDKCQLNQHRPVPFRLTPNVGEFITHFG--------ITGPLSAAIVATARCFIQPNYKLSSILQTILRDEIIALQKKGFRECKLIEGSE--DRYSD--GNCMEHSVNIVNSAVDIIMTRFNKISYF--DSIENKKISVLVQSATNIDNLCRMDPAWHPWL 3790          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Fly
Match: Nipped-A (gene:FBgn0053554 transcript:FBtr0347556)

HSP 1 Score: 1141.33 bits (2951), Expect = 0.000e+0
Identity = 1060/4123 (25.71%), Postives = 1915/4123 (46.45%), Query Frame = 3
Query:  201 SLKEKLIIFFDDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQK-DMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLPK-IDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINI--RFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERITAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVH--YDIDVDN--HEKFINEIRNILETSTGTDEEI----NAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTXXXXXXXXXXXXSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRE--NYTLATNRQLYFCARLFHASFSERMCESLLVTKVKPVLDILYEKFDK-----NGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTSFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYV-WKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKP-NEDADDIVAIFLNKLIDNQDCGDGGLRVAYCQFCILILEYAPNYIHE--ISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEEALTGLSAIGQDKSISDQQKESLANLI--VRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWG-PINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSK--PLCDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKT-----------NSQSEEVEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLPKQEEHF-APGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWD---SRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTTEMQQS---MAFAQ--QGQYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSL-DKFLNGENVNYLIKAESLWRKGQWKDI-IQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGI--HNNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLI-HITANAATDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQE--CKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLIRE-----------------------LSYSDPSDSNN--------QSEEIKLYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQI-------VSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNSK--ALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNKIEHLQSKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIK-FAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSED-AHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHK------YLVNNHEKKDMYSAELENCILEK--WLSSASEQIYNRISTVGRMDDDSITRDKI----QNSLDPLNQALMKPSHQIWI 12191
            + +  L I  D + + +L+LKA QE S+ FE   Q+  YP  L    +   + L   EPQF+QEN +Q +RK  LE+  ++P  E  +Q+ K  + +++K+++ +NEEN ++C+++++++HK  RP+F++E+  FL FV+ +Y  L NH   IF  S    +  + +  +E  + E+++V  IH ++  D N  +  +N+LP+   SLKV+QE+P+++VLMYQ +K+ +  E++ FIPLI+  +NL P+  ++      + +Y++F+ AQ+KTLSFLAY+V+ F++ ++   + S+  GM  ++ N P    ++RKE  IAARHI  T +++ +F+  +  L +ED+LIG G T++ + RPLAYSTLADL H V+  LN+  + KA N++ KN+HD++L   IQ MS KLLLN ++ +++   H+  E    + LL K+L   VK+  TI+K  LP + + C         +       +          +  P L   I    +    +  + ++ + +F+ L K L+ G+KTIT    +S                       D + ++ +K      V  Y  L+ Y +  +D+Y I     Q  QR  ++ L ++  +EK +LE    IFL +   NF+E+F T I +++ER   N    Q  Q+I ++S   +PT S + A +++ YLL+ ME +G     ++L+ RLFK +F SV    V  E +L  HL +IV   M+ AL +++P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   +RDL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   ISQGLRTLELCVDN+ P++LY ++ PVR  +M A+ ++ R   +     AF+VLGK G  NR  ++E Q +   S+     P I+I   F E+ E  I+ PV E + +A + L     +   + +S  V++   FL +FI  + DE   ++ +  F+   F          VE     W      ST +H+     N    +TH+                      +AL+G+ +      +R +    +  +V+  T+ A+A+         Y  T   D              +L+D++   M +E+K+  + G  C+  I     +   NK  A  +PI    A++++ L +   WY++ GGC  +  L + +    L+ +L +FLK   + + DL   +  GA+ + K+ ++ ++E  L  I +           + I +  +  K    V   ++  + + N  VRE++  +L+ +  I  + ++ ++ PH  V++DI+PP   + +  P + QI +++ N        C       + ID+ N  H+ F +E+  + E    T  ++    N P +   P+ + A                               AC Y                 S + Y    K+K    +FK M S   E+  TAF C++ F++   +  E   + ++PLL    +  N ++   ++L +  ++F   F+E++ E +L      +++I   ++       N F  ++  E    ++  +E+F  + +AS KY++ L +LVLK E+ +   ++S  R+ LI +L + PTETV LFL                  +D +  +     L+++  +    + K S  +  ++      + P  +  + + H AV II  L +S+  W    + + +AL   W +  + S L   D +    W  I  IL  L  F +   D  E LF + R+   R +  ++ LR FL     +   V WK+N F Y++   +N   + ++   I   +I+P F V+ +      E  +L G PP P  ED  +IV++F+NK+ D     D  +R+A  Q   L++E A  +IH+   +NK+QG+K R ++TFAWP + ++    D   +Y G   ++++I++  I++KI+++VF  L KG+ +E + ++  AL VL PA   R +D N ++ H TKK+ +++  +  QL HI  LI+RH  +Y+  +     L+Q+ I+ +    F P    E ++  +D+ E+II+W++ R K++  T      ++       K S  +L+   +    I+ ++      V   C   + LL+ A  P +W  P ++ +  L +       V  TV  P  N   NN+   +DFLT    ++  + ++  ++   +   LC I  N     +R ++   M L  I+  FP +  +K +     +L  LY+ V K I E  + YE+ P  PN++ +   L +L   +    N  +++DR L+  + + + L  + I T           +S +  +E L+ ++E+IK+R  V+  ++R+  +  I V  I    + K++K ++  L  W+K  +       P IREKS LLVKL       ++D  ++  + L ++  ++ +E L+  +  N  + AF  G+  Q  +VR K+ E     +RR  L +R L++I +  WD   S Y     WI   +E+L+L             + M +I C  E    P  +TS   + + ++     SF +  ++H    ++           +   +    +  +       V +  ++Y+  +     + +    +L +   + +   QL+ SV+  +FP++W++      D    + +E++ FLS+ G N +     P+ +  F+E++ K  P  +     +   +L  SHNLW   I+V+ED     S   K I  G +   + D  +SN I      F SL+ +Y  + EED   GLW +      T +  S   M F +  QG YD A+    +  S  + ++    ++++ +  +    R  K+++QWD L D     ++ N  +  ES WR   W  + I   K  Q  ++          Y + + + K       ++   T  ++      +   +++W+ LPN  I++  H+  LQA    +E  +  Q+  G+    NN   ++K+++K+W+NR P  SD  S  SDI  WR+  +  +  H+   +   S+ +  +     ++   +  RK +L+   +    ++       + + F   +Q+  C ++M     ++   E+LE++E+ + + F  + + A+FY  K +L +   + +EA + F  A Q+     K W+++ D++E +F     ER+              +  A  AL      S N + + K    +AK LW ++ D++  ++   LE+    +P S  LPW   ++ CL + EG  ++++L ++   +P+AVY   R L   L  E                       LS+   +   N         +  +     V+   ++ + + L  ++    Q+ W   SW+E++L Q+        +I     D +    ++       +KL   F + + N+          +  I N     ++ R                R          Q ++ +F+NDF  SK  A+ L   ++KL K WI +L   V     +  ++++ R L+  +Q + ++ LPG+L +     +++ IA   P VE V  N    RR+ IR +NG  + Y +          V+DS      +     +E++ Q+ R+LN  L K++E+ RR LN+  PR++ I+                 Q  +  +N   +SL  I+   C +                         Q+  D+ ++   ++     ++E + R        +   ++ I      + ++K +A    +   D+W  RK LT   A+  + ++ + ++ L A    +      + IS  +  +++D   L     +PFRL+PN+  F+   G         + PL+A+++AT          + ++++ +LRD  I   K       L+   E  D YS    NC+      ++SA + I  R + +     DSI   KI    Q++ +  N   M P+   W+
Sbjct:   11 TFRNYLNILNDSSSKDELKLKATQELSEHFEMIMQSPAYPSFLDNSLKIFMRILQDGEPQFIQENTMQHIRKLILEMIHRLPITESLRQHVKTIITMMLKILKTDNEENVLVCLRIIIELHKHFRPSFNSEIQLFLGFVKEIYTNLPNHLTSIFETSNDVWVTDLKDLNLEVLLSESYSVRTIHVEKALDSNSQQQIYNLLPRGILSLKVLQELPIIVVLMYQIYKNAVHQEVSEFIPLILTTINLQPTVTRRNSPQ--KEIYVEFMGAQIKTLSFLAYIVRIFQEVVIAS-SLSVTSGMLNLMKNCPKEAAHLRKELLIAARHIFAT-DLRQKFIPSIEQLFDEDLLIGKGVTLDSI-RPLAYSTLADLAHHVRQSLNIDVLIKAVNLFSKNVHDESLAVGIQTMSCKLLLNLVDCLRH---HSETEPQRSKALLSKLLKVFVKKFETIAKIQLPLIIQKCKGHAFSGALVNSSGNASL--------SHINAPDLKDDISNIQVSASGSQWIYSVNVAEFRSLVKTLVGGVKTITWGFFNSK------------------FQLTDTKLANHEKIFGPEIVCSYIDLVYYAMEALDIYTINVNPNQ--QR--TSGLISRSKEEKEVLEHFSGIFLMMHSQNFQEIFSTTINFLVERIYKN----QSLQVI-ANSFLANPTTSPLFATVLVEYLLNKMEEMGSNLERSNLYLRLFKLVFGSVSLFPVENEQMLRPHLHKIVNRSMELALISEEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLEGLNRLQSGFHKQHMRDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSPTLISQGLRTLELCVDNLQPDFLYDHIQPVRAALMQALWKTLR-NQDNAALVAFRVLGKFGGGNRKMMVEPQAL---SYIINDKPTISIVTYFQEY-ETPIDFPVDEAIKSAFRALGSNSTDQFYRRQSWEVIRC--FLAAFI-SLDDE--KHMLLKLFTHVDF----------VENKIMNW------STFQHK---AGNETVRETHQ----------------------TALIGMLVASATKDLRDSVCPVMAAVVRHYTMVAIAQQAGPFPQKGYQATHGID------------PMILIDALASCMGHEEKELCKPGIACMGIILDTATNIMGNKDRACKLPIIQYLAEKMVSLCYDRPWYSKVGGCQAIQFLCKHMSLRALFQNLFNFLKAFMFVLMDLEGDVSNGAIEITKSYMKSMLEICLTPINECY---------KNIDLKDLQAKATYEVIHELVRHITSPNTIVREESMVLLKHIGTIQSKTVSEVMDPHKDVLADIIPPKKHLLRHQPANAQIGLMDGNTF------CTTLEPRLFTIDLTNTYHKLFFHELLTLSEAEDATLAKLDCYKNVPNL--IPLRTSA--------------------------LRALAACHYI----------------SDIGY----KEKIINIIFKVMESDKSELQTTAFHCMKHFITGVTLEKEKVQSAMRPLLLKLGDHRNLSIPAIKRLSYFTQIFPQMFNEKLSEQIL-QHCSKIMEIFVSEYKSTSPNVNFFASSKGGEYEQKIVILIEMFFYI-SASVKYIEKLCQLVLKTEKNLMIEASSPYREALIKFLQRFPTETVDLFLTESLM-------------IDPQWNRLFIYLLKHETGVSFRAVIKSSRYNNLIHYLNTHTEFPE-ALKYEIQHQAVLIIFTLMESDDQWIPTRQDIVDALKNCWQN--YLSTLSSED-VLCDLWHLIGKIL--LHYFSNNTNDI-ELLFQLLRALCFRFIPDVYFLRDFLQHTVAQSFTVNWKRNAFFYFVENFNNSFLSEELKAKIITAVIIPCFAVSFDK----GEGNKLIGAPPTPYQEDEKNIVSVFINKVFDPDKQYDDAVRIALLQLACLLVERASQHIHDGDANNKRQGNKLRRLMTFAWPCLLSKSS-VDPTARYHGHLLLSHIIARLAIHKKIVLQVFHSLLKGHALEARSIVKQALDVLTPAMPLRMEDGNTMLTHWTKKIIVEEGHAMQQLFHILQLIIRHYKVYFPVRHQ---LVQHLINYMQRLGFPPTASIEHKKLAVDLAEVIIKWELHRIKDDRETKTDGTEEELIQESSVKRSGIDLVETRKKSFDIIRET-----TVQGKC---VMLLKMAMRPEIWPQPFDIKLNWLDK-------VLATVETPHHN--LNNICTGIDFLTFLTTILSPDQLVSIIRPVQRGLSLCIIHQN-----TRIVRLMHMFLTRIMAIFPPDTQHKHE-----DLDLLYTAVSKMIAENLTSYEKSPQ-PNASSLFGTLMIL---KACTTNNASYIDRILVQFIRVLNHLTRDHINTIGGNTVISQSPDSNALPLELLVLSLELIKNRIFVMSVEIRKLFIGTILVSLIEKSTEVKIIKCIIKMLDEWIKTKEPNVMTQVPSIREKSALLVKLMQNVEKKFTDEIELNIQFLEIINFIYRDEILKQTELTNKLEGAFLNGLRFQNPNVRSKFFEILDSSMRR-RLHDRLLYIICSQAWDTIGSHY-----WIKQCIELLILT-----------ANTMMQIQCSNEQFKIP-SITSV--IPVNSSETQENSFVSFLSSHSESFDIIQTVDDKDDVYDIDLNADRKEDCQQILPNRRVTLVELVYKQAEFLEANRNIRTDQMLVATSQLCHIDTQLAQSVWLSMFPRIWSIFTE---DQRCNITKELIPFLSS-GTNVNQKDCHPSTLNTFVESLTKCAPPIY--IPPNLLAYLGKSHNLWHRAILVLEDMAVNQSMQSKDIDGGENQFSDLDVQQSNNI------FDSLSKMYSSMHEEDLWAGLWLKFAHYPETNIAVSYEQMGFFEEAQGAYDLAMTKFKQDLSNGVVNTYVNSELLLWENHW---MRCAKELNQWDILLDYAQTNKDKNMFLILESSWRVPDWNLMKIALAKTEQCYLKH---------YGFKINLYKGYLSILHQEERQTGNIERYVEIASSLCIREWRRLPN--IVSHIHLPYLQASQQIMELHEASQIHQGLAQSRNNSLHDMKAIVKTWRNRLPIISDDLSHWSDIFTWRQHHYQIITQHLEQQSDQGSTMLGVHASAQAIISFGKIARKHNLTGVCQETLSRIYTIPSVPIVDCFQKIRQQVKCYLQMPSTSGKNEINEALEVIESTNLKYFTGEMN-AEFYALKGLLLAQIGRSEEAGKSFSVAAQLHDGLTKAWAMWGDYMEQIFLK---ERK--------------ITLAVDALICYLQASRNQI-ESKTRKYIAKVLWFLSYDNNTKILISTLEKHVAGIPPSYWLPWIPQLLCCLEQFEGDVILNLLSQIGRLYPQAVYFPIRTLYLTLKIEQREKHKTAEQAVKSSCSNIDGTTLSFGRGASHGNIPSINPIKATPPMWRCSKVMQLQREVHPTILSSLEGIVDQMVWFRESWTEEVLRQLRQGLIKCYAIAFEKRDTVQHSTITPHTLHFVKKLGSTFGIGIENV------PGSVTSSISNSAASESLAR----------------RAQVTFQDPVFQKMKEQFTNDFDFSKPGAMKLHNLISKL-KTWIKVLETKVKKLPTSFLIEDKCRFLSNFSQKTAEVELPGELLIPLSSHYYVRIARFMPRVEIVQKNNTAARRLYIRGTNGKIYPYLV----------VLDS-----GLGDARREERVLQLKRMLNYYLEKQKETSRRFLNITVPRVVPISP----------------QMRLAEDNPNSISLLKIFKKCCQSM------------------------QVDYDMPIVKYYDR-----LSEVQARGTPTTHTLLREIFSEIQWTMVPKTLLKHWALKTFLAATDFWHFRKMLTLQLALAFLCEHALNLTRLNADMMYLHQDSGLMNISYFKFDVNDDKCQLNQHRPVPFRLTPNVGEFITHFG--------ITGPLSAAIVATARCFIQPNYKLSSILQTILRDEIIALQKKGFRECKLIEGSE--DRYSD--GNCMEHSVNIVNSAVDIIMTRFNKISYF--DSIENKKISVLVQSATNIDNLCRMDPAWHPWL 3741          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Zebrafish
Match: trrap (transformation/transcription domain-associated protein [Source:ZFIN;Acc:ZDB-GENE-050809-47])

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 458/1424 (32.16%), Postives = 756/1424 (53.09%), Query Frame = 3
Query:  195 QISLKEKLIIFF----DDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC-------LVETN------EKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---YSCTESTD------FNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            Q +L +K + F     D+    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E E+EEN +IC+++++++HK  RP  S E+ +FL FV+ +YKEL     + F +      +++       +++   T   + T  +  +       I+P+   SLKV+ E+P+++VLMYQ +K  I N ++ F+PLIM  + L  S   ++ + FN+ LY DF+AAQ+KTLSFLAY+++ ++  L+ KY+  +V+GM +++ N P    ++RKE  IAA+HIL T +++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L  ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C       +V+T           +T  +                  +  +  EK  K        T  + D + L K L+ G+KTIT  ITS      +             I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   + T SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A SAK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  +E ++  A++VLGK G  NR  L ESQ++ +   + Q GP I   FT+     I LP+++ + TA+  LK    E   +       +AW  +K F+V +     +++     S+ +    P  +         +WI    +    H+YK  D   A +T E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C      C +S        F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  + L FLK L + + DL  ++  GA+ MAKT LE L+      +           E++  ++ +  +K    V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:   14 QTTLMKKYLQFVAALTDNNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPTQQLRKLVLEIIHRIPTNEHLRSHAKNILSVMFRFLEIESEENVLICLRIIIELHKQFRPPISQEIHHFLDFVKQIYKELPKVVARYFENPQVIAENTVP----SPEMVGMITSVMVKTAPERDDSETRTHTIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVSEFVPLIMNTIMLQVSPQARQHKLFNKELYADFIAAQIKTLSFLAYIIRIYQD-LVGKYSQQMVKGMLQLLSNCPPETAHLRKELLIAAKHIL-TTDLRSQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQNLPLTDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQENGNGRDILMRMLEVFVLKFHTIARYQLVSIFKKCKPQSEMGVVDTGALPGVPATPTVTTPALPPPAPPTPVTPAPPPATSFDRAGEKEDK-------QTFQVSDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIR-VANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANLTTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQSAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPAETISHVAYRVLGKFGGSNRKMLKESQKLLYVVTEVQ-GPSIKAEFTDCKAS-IQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVAM-----TSLEDNKHSLYQLLAHPNFTE--------KWIP---NVIISHRYKAQDTP-ARRTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQSGSQPSTGMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLIWVLQNQLTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLIRCATPLKD---------EEKTEELLSAQDKSFHLVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTIIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVMEHKVFYTELLNLCEA 1334          

HSP 2 Score: 615.92 bits (1587), Expect = 2.939e-176
Identity = 625/2667 (23.43%), Postives = 1180/2667 (44.24%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTS-FNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKE-------------EALTGLSAI---------GQD-----------------------------KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEII--KTNSQSEEV-----EQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLP--KQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILY-QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKF--LNGENVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAA-----TDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKLIRELSYSDPSDSNNQSEEIK------------LYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+ +FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I ++   +       +  +  +    + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+AKP+RD L + P   + L+       P  ++       P+ ST+  ++   A+KII  + K++  W      L   L + W S  FQ R  R D +  ++W + +    L  C + Y    Y   E LF + R+F  R L ++  L++++ +   K   +  +    +   + ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   QF  L++E+AP++IH+ +NK +  K R ++TFAWP +  +    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ IS +    F P    EQR+  +D+ E++I+W++ R K+             E  +G SA           QD                             K +  Q  +++ N ++R+  Q+ D +    +  +   RR + L++TA  P +W    L ++   +          TV  P     F+N+   L+ L   L ++    IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K SS N  ++   L +L   + A  N  +++DR +   +    K+V E +  + N  + E      E ++ +++++K R +V+  +MR+  +  I    I    D K+L+ V+  ++ W+K        +  P  REKS LLVK+       + D+ ++  + L ++  V+ ++ L   D  +  + AF +G+      +R K+ E +   ++R  + ER L++  +  W+S       WI    E+LL     + + TI         +C+   L     +T+  NL  S   A FA  +    E       E K  + V+   + +  D  +   +K    + + N  ++L  +H++  + +++V  G +L++++ + + S  L+   +  +FP+LW +L ++       +  EM  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLW    +++E   +     EK +   +    + +  E   I       L SL  LY LL+EED   GLW ++C     E   ++A+ Q G        Y+KA++ + +  + S     EY      Q + D   R  K+++QW+ L ++    G N  YL+  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + ++   +L       +   +++W+ LP+  I++  H  +LQA    +E  +  Q+ +G+       N    ++K+++K+W+NR P  SD  S  S I +WR+  +  ++    N       T+++ +  +     +++  +  RKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LEN+F       + R  H  G+ +IT  + A             H  + K    LAK LWL++ DD   L +  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L        R++   +     PS +  Q+                    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K      +  H L  +    +   + ++N    SN++ ++    S   ++ +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++ + ++++ ++ L      I      L +S  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++A+LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + +      + +    NSLD  N   M P+   W+
Sbjct: 1367 YLPQSREKIIAALFKALNSTNSELQEAGEACMGKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRG------DGSEMRICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDAKPLRDVLASNPNRFVPLLV------PAGSAATVRPGSPSTSTARLDLQFQAIKIISIIVKNDEGWLAGQHSLVSQLRRVWVSEAFQER-HRKDNMAATNWKEPKL---LAFCLLSYCKRNYSEIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYGITHKRALFFRFVEFNDPHFNDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADLADSLRIYLLQFSTLLVEHAPHHIHD-NNKSRNSKLRRLMTFAWPCLLPK-TCVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHTMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFRVYYPVRHH---LVQHMISAMQRLGFTPSVTIEQRKLAVDLAEVVIKWELQRIKDQQPESEADPGSVGEGTSGASAAMKRGMSVDSAQDVKRFRTAAGAVGTVFGRSQSIPGTEALLTKPVEKQHTDTVVNFLIRIACQVNDSTNVAGSPGELLSRRCVNLMKTALRPDMWPSSELKLQWFDKLLM-------TVEQPN-QANFSNICTGLEILCFLLSVLQPPAILSHFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSTFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KASSANPTQLFGTLMIL---KSACSNNSSYIDRLISVFMRSLQKMVREHLSPQPNPGAAETSTVTSELVMLSLDLVKMRLSVMNMEMRKNFIQVILTSLIEKSPDPKILRAVVKIVEEWVKNSGNPMATNQVPNPREKSILLVKMMTYIEKRFPDDLELNAQFLDLVNYVYRDDNLSGSDITSKLEPAFLSGLRCTQPLIRAKFFEVFDASMKR-RVYERLLYICCSQNWESMGSHF--WIKQCTELLL--AVCERNTTIG-------TSCQGSMLP---SITNVINLADSHDRAAFAMATHIKQEPRERENSETKEED-VEIDIELAPGDQTSLPKTKEQAERDAGNQLHMLTNRHDKFLDSLREVKTGALLNALVQLCHISTPLAEKTWVQLFPRLWKILSDRQQHA---LSGEMGPFLCS-GSHQAQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWLRSTLMLEQQAF-----EKGLNLHIKPKQSTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--PETSTAIAYEQHGFFEQAQETYEKAMEKARKEHNVSPAIFPEY------QLWEDHWIRCSKELNQWEPLTEYGQSKGHNNPYLV-LECAWRVSNWAAMKEALVQVELSCPKEMAWKVNMHRGYLAICH-----PEEQQLNFIERL---VEMASSLAIREWRRLPH--IVSHVHTPLLQAAQQIIELQEAAQINAGLQPANLGRNTSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQAIVTAYENNTQHDPNTNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KDRQPH-LGVSSITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDKNTL-ADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKPLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQQQPSSAAAQTHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAK------ITPHTLNFVKKLVSTFGVGLEN---VSNVSTMF----SSAASESLARRAQATAQDPVFQKMKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQGNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGLAEFMLHLNRLNPEMLQIAQDTGKLNVSYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKAVLRDEIIAWHKKTQEDTSMPLSPAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3834          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Zebrafish
Match: trrap (transformation/transcription domain-associated protein [Source:ZFIN;Acc:ZDB-GENE-050809-47])

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 458/1424 (32.16%), Postives = 756/1424 (53.09%), Query Frame = 3
Query:  195 QISLKEKLIIFF----DDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC-------LVETN------EKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---YSCTESTD------FNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            Q +L +K + F     D+    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E E+EEN +IC+++++++HK  RP  S E+ +FL FV+ +YKEL     + F +      +++       +++   T   + T  +  +       I+P+   SLKV+ E+P+++VLMYQ +K  I N ++ F+PLIM  + L  S   ++ + FN+ LY DF+AAQ+KTLSFLAY+++ ++  L+ KY+  +V+GM +++ N P    ++RKE  IAA+HIL T +++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L  ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C       +V+T           +T  +                  +  +  EK  K        T  + D + L K L+ G+KTIT  ITS      +             I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   + T SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A SAK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  +E ++  A++VLGK G  NR  L ESQ++ +   + Q GP I   FT+     I LP+++ + TA+  LK    E   +       +AW  +K F+V +     +++     S+ +    P  +         +WI    +    H+YK  D   A +T E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C      C +S        F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  + L FLK L + + DL  ++  GA+ MAKT LE L+      +           E++  ++ +  +K    V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:   14 QTTLMKKYLQFVAALTDNNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPTQQLRKLVLEIIHRIPTNEHLRSHAKNILSVMFRFLEIESEENVLICLRIIIELHKQFRPPISQEIHHFLDFVKQIYKELPKVVARYFENPQVIAENTVP----SPEMVGMITSVMVKTAPERDDSETRTHTIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVSEFVPLIMNTIMLQVSPQARQHKLFNKELYADFIAAQIKTLSFLAYIIRIYQD-LVGKYSQQMVKGMLQLLSNCPPETAHLRKELLIAAKHIL-TTDLRSQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQNLPLTDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQENGNGRDILMRMLEVFVLKFHTIARYQLVSIFKKCKPQSEMGVVDTGALPGVPATPTVTTPALPPPAPPTPVTPAPPPATSFDRAGEKEDK-------QTFQVSDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIR-VANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANLTTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQSAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPAETISHVAYRVLGKFGGSNRKMLKESQKLLYVVTEVQ-GPSIKAEFTDCKAS-IQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVAM-----TSLEDNKHSLYQLLAHPNFTE--------KWIP---NVIISHRYKAQDTP-ARRTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQSGSQPSTGMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLIWVLQNQLTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLIRCATPLKD---------EEKTEELLSAQDKSFHLVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTIIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVMEHKVFYTELLNLCEA 1334          

HSP 2 Score: 615.92 bits (1587), Expect = 2.939e-176
Identity = 625/2667 (23.43%), Postives = 1180/2667 (44.24%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTS-FNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKE-------------EALTGLSAI---------GQD-----------------------------KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEII--KTNSQSEEV-----EQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLP--KQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILY-QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKF--LNGENVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAA-----TDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKLIRELSYSDPSDSNNQSEEIK------------LYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+ +FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I ++   +       +  +  +    + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+AKP+RD L + P   + L+       P  ++       P+ ST+  ++   A+KII  + K++  W      L   L + W S  FQ R  R D +  ++W + +    L  C + Y    Y   E LF + R+F  R L ++  L++++ +   K   +  +    +   + ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   QF  L++E+AP++IH+ +NK +  K R ++TFAWP +  +    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ IS +    F P    EQR+  +D+ E++I+W++ R K+             E  +G SA           QD                             K +  Q  +++ N ++R+  Q+ D +    +  +   RR + L++TA  P +W    L ++   +          TV  P     F+N+   L+ L   L ++    IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K SS N  ++   L +L   + A  N  +++DR +   +    K+V E +  + N  + E      E ++ +++++K R +V+  +MR+  +  I    I    D K+L+ V+  ++ W+K        +  P  REKS LLVK+       + D+ ++  + L ++  V+ ++ L   D  +  + AF +G+      +R K+ E +   ++R  + ER L++  +  W+S       WI    E+LL     + + TI         +C+   L     +T+  NL  S   A FA  +    E       E K  + V+   + +  D  +   +K    + + N  ++L  +H++  + +++V  G +L++++ + + S  L+   +  +FP+LW +L ++       +  EM  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLW    +++E   +     EK +   +    + +  E   I       L SL  LY LL+EED   GLW ++C     E   ++A+ Q G        Y+KA++ + +  + S     EY      Q + D   R  K+++QW+ L ++    G N  YL+  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + ++   +L       +   +++W+ LP+  I++  H  +LQA    +E  +  Q+ +G+       N    ++K+++K+W+NR P  SD  S  S I +WR+  +  ++    N       T+++ +  +     +++  +  RKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LEN+F       + R  H  G+ +IT  + A             H  + K    LAK LWL++ DD   L +  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L        R++   +     PS +  Q+                    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K      +  H L  +    +   + ++N    SN++ ++    S   ++ +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++ + ++++ ++ L      I      L +S  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++A+LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + +      + +    NSLD  N   M P+   W+
Sbjct: 1367 YLPQSREKIIAALFKALNSTNSELQEAGEACMGKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRG------DGSEMRICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDAKPLRDVLASNPNRFVPLLV------PAGSAATVRPGSPSTSTARLDLQFQAIKIISIIVKNDEGWLAGQHSLVSQLRRVWVSEAFQER-HRKDNMAATNWKEPKL---LAFCLLSYCKRNYSEIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYGITHKRALFFRFVEFNDPHFNDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADLADSLRIYLLQFSTLLVEHAPHHIHD-NNKSRNSKLRRLMTFAWPCLLPK-TCVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHTMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFRVYYPVRHH---LVQHMISAMQRLGFTPSVTIEQRKLAVDLAEVVIKWELQRIKDQQPESEADPGSVGEGTSGASAAMKRGMSVDSAQDVKRFRTAAGAVGTVFGRSQSIPGTEALLTKPVEKQHTDTVVNFLIRIACQVNDSTNVAGSPGELLSRRCVNLMKTALRPDMWPSSELKLQWFDKLLM-------TVEQPN-QANFSNICTGLEILCFLLSVLQPPAILSHFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSTFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KASSANPTQLFGTLMIL---KSACSNNSSYIDRLISVFMRSLQKMVREHLSPQPNPGAAETSTVTSELVMLSLDLVKMRLSVMNMEMRKNFIQVILTSLIEKSPDPKILRAVVKIVEEWVKNSGNPMATNQVPNPREKSILLVKMMTYIEKRFPDDLELNAQFLDLVNYVYRDDNLSGSDITSKLEPAFLSGLRCTQPLIRAKFFEVFDASMKR-RVYERLLYICCSQNWESMGSHF--WIKQCTELLL--AVCERNTTIG-------TSCQGSMLP---SITNVINLADSHDRAAFAMATHIKQEPRERENSETKEED-VEIDIELAPGDQTSLPKTKEQAERDAGNQLHMLTNRHDKFLDSLREVKTGALLNALVQLCHISTPLAEKTWVQLFPRLWKILSDRQQHA---LSGEMGPFLCS-GSHQAQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWLRSTLMLEQQAF-----EKGLNLHIKPKQSTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--PETSTAIAYEQHGFFEQAQETYEKAMEKARKEHNVSPAIFPEY------QLWEDHWIRCSKELNQWEPLTEYGQSKGHNNPYLV-LECAWRVSNWAAMKEALVQVELSCPKEMAWKVNMHRGYLAICH-----PEEQQLNFIERL---VEMASSLAIREWRRLPH--IVSHVHTPLLQAAQQIIELQEAAQINAGLQPANLGRNTSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQAIVTAYENNTQHDPNTNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KDRQPH-LGVSSITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDKNTL-ADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKPLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQQQPSSAAAQTHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAK------ITPHTLNFVKKLVSTFGVGLEN---VSNVSTMF----SSAASESLARRAQATAQDPVFQKMKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQGNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGLAEFMLHLNRLNPEMLQIAQDTGKLNVSYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKAVLRDEIIAWHKKTQEDTSMPLSPAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3834          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Zebrafish
Match: trrap (transformation/transcription domain-associated protein [Source:ZFIN;Acc:ZDB-GENE-050809-47])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 458/1424 (32.16%), Postives = 756/1424 (53.09%), Query Frame = 3
Query:  195 QISLKEKLIIFF----DDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC-------LVETN------EKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---YSCTESTD------FNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            Q +L +K + F     D+    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E E+EEN +IC+++++++HK  RP  S E+ +FL FV+ +YKEL     + F +      +++       +++   T   + T  +  +       I+P+   SLKV+ E+P+++VLMYQ +K  I N ++ F+PLIM  + L  S   ++ + FN+ LY DF+AAQ+KTLSFLAY+++ ++  L+ KY+  +V+GM +++ N P    ++RKE  IAA+HIL T +++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L  ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C       +V+T           +T  +                  +  +  EK  K        T  + D + L K L+ G+KTIT  ITS      +             I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   + T SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A SAK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  +E ++  A++VLGK G  NR  L ESQ++ +   + Q GP I   FT+     I LP+++ + TA+  LK    E   +       +AW  +K F+V +     +++     S+ +    P  +         +WI    +    H+YK  D   A +T E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C      C +S        F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  + L FLK L + + DL  ++  GA+ MAKT LE L+      +           E++  ++ +  +K    V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:   14 QTTLMKKYLQFVAALTDNNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPTQQLRKLVLEIIHRIPTNEHLRSHAKNILSVMFRFLEIESEENVLICLRIIIELHKQFRPPISQEIHHFLDFVKQIYKELPKVVARYFENPQVIAENTVP----SPEMVGMITSVMVKTAPERDDSETRTHTIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVSEFVPLIMNTIMLQVSPQARQHKLFNKELYADFIAAQIKTLSFLAYIIRIYQD-LVGKYSQQMVKGMLQLLSNCPPETAHLRKELLIAAKHIL-TTDLRSQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQNLPLTDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQENGNGRDILMRMLEVFVLKFHTIARYQLVSIFKKCKPQSEMGVVDTGALPGVPATPTVTTPALPPPAPPTPVTPAPPPATSFDRAGEKEDK-------QTFQVSDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIR-VANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANLTTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQSAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPAETISHVAYRVLGKFGGSNRKMLKESQKLLYVVTEVQ-GPSIKAEFTDCKAS-IQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVAM-----TSLEDNKHSLYQLLAHPNFTE--------KWIP---NVIISHRYKAQDTP-ARRTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQSGSQPSTGMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLIWVLQNQLTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLIRCATPLKD---------EEKTEELLSAQDKSFHLVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTIIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVMEHKVFYTELLNLCEA 1334          

HSP 2 Score: 620.928 bits (1600), Expect = 9.529e-178
Identity = 628/2668 (23.54%), Postives = 1184/2668 (44.38%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDK-NGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTS-FNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKE-------------EALTGLSAI---------GQD-----------------------------KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEII--KTNSQSEEV-----EQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLP--KQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILY-QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKF--LNGENVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIHNNNV-----FSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAA-----TDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKLIRELSYSDPSDSNNQSEEIK------------LYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+ +FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I ++   + +G    E  E+  +    + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+AKP+RD L + P   + L+       P  ++       P+ ST+  ++   A+KII  + K++  W      L   L + W S  FQ R  R D +  ++W + +    L  C + Y    Y   E LF + R+F  R L ++  L++++ +   K   +  +    +   + ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   QF  L++E+AP++IH+ +NK +  K R ++TFAWP +  +    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ IS +    F P    EQR+  +D+ E++I+W++ R K+             E  +G SA           QD                             K +  Q  +++ N ++R+  Q+ D +    +  +   RR + L++TA  P +W    L ++   +          TV  P     F+N+   L+ L   L ++    IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K SS N  ++   L +L   + A  N  +++DR +   +    K+V E +  + N  + E      E ++ +++++K R +V+  +MR+  +  I    I    D K+L+ V+  ++ W+K        +  P  REKS LLVK+       + D+ ++  + L ++  V+ ++ L   D  +  + AF +G+      +R K+ E +   ++R  + ER L++  +  W+S       WI    E+LL     + + TI         +C+   L     +T+  NL  S   A FA  +    E       E K  + V+   + +  D  +   +K    + + N  ++L  +H++  + +++V  G +L++++ + + S  L+   +  +FP+LW +L ++       +  EM  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLW    +++E   +     EK +   +    + +  E   I       L SL  LY LL+EED   GLW ++C     E   ++A+ Q G        Y+KA++ + +  + S     EY      Q + D   R  K+++QW+ L ++    G N  YL+  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + ++   +L       +   +++W+ LP+  I++  H  +LQA    +E  +  Q+ +G+   N+       ++K+++K+W+NR P  SD  S  S I +WR+  +  ++    N       T+++ +  +     +++  +  RKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LEN+F       + R  H  G+ +IT  + A             H  + K    LAK LWL++ DD   L +  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L        R++   +     PS +  Q+                    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K      +  H L  +    +   + ++N    SN++ ++    S   ++ +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++ + ++++ ++ L      I      L +S  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++A+LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + +      + +    NSLD  N   M P+   W+
Sbjct: 1367 YLPQSREKIIAALFKALNSTNSELQEAGEACMGKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRGDGSPAMEGVEEMRICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDAKPLRDVLASNPNRFVPLLV------PAGSAATVRPGSPSTSTARLDLQFQAIKIISIIVKNDEGWLAGQHSLVSQLRRVWVSEAFQER-HRKDNMAATNWKEPKL---LAFCLLSYCKRNYSEIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYGITHKRALFFRFVEFNDPHFNDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADLADSLRIYLLQFSTLLVEHAPHHIHD-NNKSRNSKLRRLMTFAWPCLLPK-TCVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHTMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFRVYYPVRHH---LVQHMISAMQRLGFTPSVTIEQRKLAVDLAEVVIKWELQRIKDQQPESEADPGSVGEGTSGASAAMKRGMSVDSAQDVKRFRTAAGAVGTVFGRSQSIPGTEALLTKPVEKQHTDTVVNFLIRIACQVNDSTNVAGSPGELLSRRCVNLMKTALRPDMWPSSELKLQWFDKLLM-------TVEQPN-QANFSNICTGLEILCFLLSVLQPPAILSHFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSTFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KASSANPTQLFGTLMIL---KSACSNNSSYIDRLISVFMRSLQKMVREHLSPQPNPGAAETSTVTSELVMLSLDLVKMRLSVMNMEMRKNFIQVILTSLIEKSPDPKILRAVVKIVEEWVKNSGNPMATNQVPNPREKSILLVKMMTYIEKRFPDDLELNAQFLDLVNYVYRDDNLSGSDITSKLEPAFLSGLRCTQPLIRAKFFEVFDASMKR-RVYERLLYICCSQNWESMGSHF--WIKQCTELLL--AVCERNTTIG-------TSCQGSMLP---SITNVINLADSHDRAAFAMATHIKQEPRERENSETKEED-VEIDIELAPGDQTSLPKTKEQAERDAGNQLHMLTNRHDKFLDSLREVKTGALLNALVQLCHISTPLAEKTWVQLFPRLWKILSDRQQHA---LSGEMGPFLCS-GSHQAQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWLRSTLMLEQQAF-----EKGLNLHIKPKQSTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--PETSTAIAYEQHGFFEQAQETYEKAMEKARKEHNVSPAIFPEY------QLWEDHWIRCSKELNQWEPLTEYGQSKGHNNPYLV-LECAWRVSNWAAMKEALVQVELSCPKEMAWKVNMHRGYLAICH-----PEEQQLNFIERL---VEMASSLAIREWRRLPH--IVSHVHTPLLQAAQQIIELQEAAQINAGLQPANLGRNTSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQAIVTAYENNTQHDPNTNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KDRQPH-LGVSSITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDKNTL-ADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKPLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQQQPSSAAAQTHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAK------ITPHTLNFVKKLVSTFGVGLEN---VSNVSTMF----SSAASESLARRAQATAQDPVFQKMKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQGNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGLAEFMLHLNRLNPEMLQIAQDTGKLNVSYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKAVLRDEIIAWHKKTQEDTSMPLSPAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3841          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Zebrafish
Match: BX005075.2 (pep chromosome:GRCz11:CHR_ALT_CTG12_1_7:18093333:18104154:1 gene:ENSDARG00000112092.1 transcript:ENSDART00000186148.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX005075.2)

HSP 1 Score: 73.559 bits (179), Expect = 1.595e-12
Identity = 89/386 (23.06%), Postives = 153/386 (39.64%), Query Frame = 3
Query: 11064 NDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++ + ++++ ++ L      I      L +S  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++A+LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + +      + +    NSLD  N   M P+   W+
Sbjct:   47 NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQGNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGLAEFMLHLNRLNPEMLQIAQDTGKLNVSYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKAVLRDEIIAWHKKTQEDTSMPLSPAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 374          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Xenopus
Match: TRRAP (transformation/transcription domain-associated protein [Source:NCBI gene;Acc:100158625])

HSP 1 Score: 1234.17 bits (3192), Expect = 0.000e+0
Identity = 1089/4179 (26.06%), Postives = 1975/4179 (47.26%), Query Frame = 3
Query:  195 QISLKEKLIIFFDDAKEI----DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETN----------EKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---YSCTE------STDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTXXXXXXXXXXXXSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKN-GFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTS---FNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNED-ADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE--------------------------------------ALTGLSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEEVEQ--------LIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDS--RYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQW---KDIIQNHKLN--QNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANA-----ATDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQE--CKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKLIRELSYSDPSDSNNQSEEIK------------LYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            Q +L +K + F     ++    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FVR +YK+L    N+ F + P    +++   P    ++ T  V K++ ++ D         I+PK   SLKV+ E+P+++VLMYQ +K  I N ++ F+PLIM  +    S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ ++  ++ K++  +V+GM +++ N P    ++RKE  IAA+HIL T +++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L  ++ A  ++ KN+ D+++  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C  ++              P          T   T   ++ L    K  EK  + +      T  + D + L K L+ G+KTIT  ITS      +             + N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +P  SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++Q+   + Q GP I + F +     I LP+++ + TA+  LK    E   +       +AW  +K F+V ++     N++    ++ +    P  +   +                 H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C      C +      +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E++  +I   ++K    V   ++  + + N  VR++A   LQ L+++TG+ +  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F +E+ N+ E                                               +  T+ +   Y  +S+ V L++AA   L+   YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ + ++   ++ G    E  E+  +    + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+AKP+RD L   P   I L+       P V         P+ ST+    ++   A+KII  + K++  W  N   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    +   E LF + R+F  R L ++  L++++ +   K   + ++    +   +  +  +  ++   +  +I+ PAF  + E       + E   GPP P  D  + I ++F+ K++D +   D    LR+   QF  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + +   L+Q+ +S +    F P    EQR+  +D+ E++I+W++ R K++                                      A  G+S +        G D    K+I  Q  +++ N ++R+  Q+ D S T  +  +   RR + LL+TA  P +W    L ++   +          TV  P     F N+   L+ L+  L ++ +  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K ++ N +++   L +L   + A  N  +++DR +   +    K+V E +   +     E         ++ +++++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K++E +   ++R  + +R L++  +  W++   +F    WI   +E+LL     + + TI         +C+   L     +T+  NL  S   A FA ++    E       E K  + V+   + +  D  T+  +K    K   +I N L+    +H++  + +++V  G +LS+ + + + S  L+  V+  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C     E   ++A+ Q G        Y+KA++ + +   +   S   + +    Q + D   R  K+++QW++L  +   + ++N  +  E  WR   W   K+ +   +L+  +    +++ +R  L  C+          P  + ++   +L       +   +++W+ LP   +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S I +WR+  +  +++   N+     +++++ +  +     +++  +  RKQ L +       ++       + + F   +Q+  C +++     ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK D+A + F  A+Q+     K W+++ D+LEN+F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L        R++   +     PS    QS                    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K      +  H L  +    +   + ++N    SN++ ++S   S    + +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   +++  ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + D      + +    NSLD  N   M P+   W+
Sbjct:   14 QTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTTSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVRQIYKDLSKVVNRYFENPPVIADNTVPA-PEMVGMISTI-VVKVNPERDDSETR--THTIIPKGSLSLKVLAELPIIVVLMYQLYKLNIHNVVSEFVPLIMSTIVTQVSPNARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQD-IVAKHSQQMVKGMLQLLTNCPPETAHLRKELLIAAKHILST-DLRSQFIPSMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLNDLSLAVQLFAKNIDDESIPSSIQTMSCKLLLNLVDCIRSK---SEQENGNGRDILMRMLEVFVLKFHTIARYQLSAIFKKCKPQSELCASDAILPTVPTPAPTTPANAAPTTPATPLTQVSLMVFDKQGEKDKEDKQ-----TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------VPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIR-VANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPQTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAADNEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLQYIVTEIQ-GPSITVEFADCKAS-IQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVAMM-----NLDDNKHALYQLLAHPNFTEKSIP-----------SVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLQCYQVGNQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLIWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLIRCATPLKD---------EEKTEEIENAHKKSFHLVTHDLVREVTSPNPTVRKQAMHSLQVLAQVTGKGVTMIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYSELLNLCEA----------------------------------------------EDATLMKLPCYKSLSSLVPLRIAALNALAACNYLPQSREKIIAALFKALNSTNNELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVMTHKGGQRSEGNPAVEGVEEMKICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDAKPLRDVLAANPNRFITLLL------PGVTQTTVRPGSPSTSTTTMRLDLQFQAIKIISIIVKNDENWLANQHSLVSHLRRVWVSEAFQER-HRKENMVATNWKEPKL---LAFCLLNYCKRNFGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKTYSIAQKRALFFRFVEFSDPNFGDELKAKVLQHILNPAFLYSFE-----KNEGEQLLGPPNPEGDNQESITSVFITKVLDPEKQTDMLDSLRIYLLQFATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARVIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHN---LVQHMVSAMQRLGFTPSVTIEQRKLAVDLAEVVIKWELQRIKDQPDSDLDPNGSGEGGSSATGGVKRGLAVDASQEVKRFRTATGGISTVFGRSQSLPGPDAALSKAIEKQHTDTVVNFLIRIACQVNDNSNTAGSPGELLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLM-------TVEQPN-QANFANICTGLEVLSFLLTVLQNPAILSSFKPLQRGISACMTCGNTKV-----LRAVHTLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATNANPSQLFGTLMIL---KSACSNNPSYIDRLISVFMRSLQKMVREHLNPQATPGTAEANPAGTSELVMLSLDLVKTRLAVMSMEMRKNFIQTILTSLIEKSPDAKILRAVVKIVEEWLKNNTPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDENLSGSELTAKLEPAFLSGLRCAQPLIRAKFIEVFDTSMKR-RVYDRLLYITCSQNWEAMGNHF----WIKQCIELLL--AVCERNTTIG-------TSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESKEED-VEIDIELAPGDQSTNPKTKELSEK---DIGNQLHMLTNRHDKFLDSLREVKTGALLSAFVQLCHISTPLAEKVWIQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLQIKPKQATEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--PETATAIAYEQHGFFEQAQETYEKAMEKAKKEHERCNASPAVFPEY---QLWEDHWIRCSKELNQWEALTDYGQSKGHINPYLVLECSWRVSNWTAMKEALVQVELSCPKEMAWKVNMYRGYLAICH----------PEEQQLNFIERL---VEMASSLAIREWRRLPY--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQAIVNAYDNSTQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAVVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSDDANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KERQLH-LGVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQHQPSSVGTQSHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAK------ITPHTLNFVKKLVSTFGVGLEN---VSNVSTMFSSAAS----ESLARRAQATAQDPVFQKLKSQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVFHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIAWHKKTQEDTSSPLSPAGQPENMDSQQLVSLVQKAVTAIVTRLHNLAQFDGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3845          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Xenopus
Match: TRRAP (transformation/transcription domain-associated protein [Source:NCBI gene;Acc:100158625])

HSP 1 Score: 1232.24 bits (3187), Expect = 0.000e+0
Identity = 1089/4176 (26.08%), Postives = 1973/4176 (47.25%), Query Frame = 3
Query:  195 QISLKEKLIIFFDDAKEI----DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETN----------EKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---YSCTE------STDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTXXXXXXXXXXXXSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLLVTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTS---FNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNED-ADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE--------------------------------------ALTGLSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEEVEQ--------LIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDS--RYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQW---KDIIQNHKLN--QNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANA-----ATDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQE--CKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKLIRELSYSDPSDSNNQSEEIK------------LYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            Q +L +K + F     ++    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FVR +YK+L    N+ F + P    +++   P    ++ T  V K++ ++ D         I+PK   SLKV+ E+P+++VLMYQ +K  I N ++ F+PLIM  +    S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ ++  ++ K++  +V+GM +++ N P    ++RKE  IAA+HIL T +++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L  ++ A  ++ KN+ D+++  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C  ++              P          T   T   ++ L    K  EK  + +      T  + D + L K L+ G+KTIT  ITS      +             + N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +P  SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++Q+   + Q GP I + F +     I LP+++ + TA+  LK    E   +       +AW  +K F+V ++     N++    ++ +    P  +   +                 H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C      C +      +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E++  +I   ++K    V   ++  + + N  VR++A   LQ L+++TG+ +  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F +E+ N+ E                                               +  T+ +   Y  +S+ V L++AA   L+   YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++   ++  ++++     K G     N+ K    I  + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+AKP+RD L   P   I L+       P V         P+ ST+    ++   A+KII  + K++  W  N   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    +   E LF + R+F  R L ++  L++++ +   K   + ++    +   +  +  +  ++   +  +I+ PAF  + E       + E   GPP P  D  + I ++F+ K++D +   D    LR+   QF  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + +   L+Q+ +S +    F P    EQR+  +D+ E++I+W++ R K++                                      A  G+S +        G D    K+I  Q  +++ N ++R+  Q+ D S T  +  +   RR + LL+TA  P +W    L ++   +          TV  P     F N+   L+ L+  L ++ +  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K ++ N +++   L +L   + A  N  +++DR +   +    K+V E +   +     E         ++ +++++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K++E +   ++R  + +R L++  +  W++   +F    WI   +E+LL     + + TI         +C+   L     +T+  NL  S   A FA ++    E       E K  + V+   + +  D  T+  +K    K   +I N L+    +H++  + +++V  G +LS+ + + + S  L+  V+  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C     E   ++A+ Q G        Y+KA++ + +   +   S   + +    Q + D   R  K+++QW++L  +   + ++N  +  E  WR   W   K+ +   +L+  +    +++ +R  L  C+          P  + ++   +L       +   +++W+ LP   +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S I +WR+  +  +++   N+     +++++ +  +     +++  +  RKQ L +       ++       + + F   +Q+  C +++     ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK D+A + F  A+Q+     K W+++ D+LEN+F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L        R++   +     PS    QS                    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++S   S    + +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   +++  ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + D      + +    NSLD  N   M P+   W+
Sbjct:   14 QTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTTSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVRQIYKDLSKVVNRYFENPPVIADNTVPA-PEMVGMISTI-VVKVNPERDDSETR--THTIIPKGSLSLKVLAELPIIVVLMYQLYKLNIHNVVSEFVPLIMSTIVTQVSPNARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQD-IVAKHSQQMVKGMLQLLTNCPPETAHLRKELLIAAKHILST-DLRSQFIPSMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLNDLSLAVQLFAKNIDDESIPSSIQTMSCKLLLNLVDCIRSK---SEQENGNGRDILMRMLEVFVLKFHTIARYQLSAIFKKCKPQSELCASDAILPTVPTPAPTTPANAAPTTPATPLTQVSLMVFDKQGEKDKEDKQ-----TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------VPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIR-VANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPQTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAADNEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLQYIVTEIQ-GPSITVEFADCKAS-IQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVAMM-----NLDDNKHALYQLLAHPNFTEKSIP-----------SVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLQCYQVGNQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLIWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLIRCATPLKD---------EEKTEEIENAHKKSFHLVTHDLVREVTSPNPTVRKQAMHSLQVLAQVTGKGVTMIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYSELLNLCEA----------------------------------------------EDATLMKLPCYKSLSSLVPLRIAALNALAACNYLPQSREKIIAALFKALNSTNNELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMM-QHLRKWMEVVVMT-HKGGQRSEGNEMKICSAI--INLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDAKPLRDVLAANPNRFITLLL------PGVTQTTVRPGSPSTSTTTMRLDLQFQAIKIISIIVKNDENWLANQHSLVSHLRRVWVSEAFQER-HRKENMVATNWKEPKL---LAFCLLNYCKRNFGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKTYSIAQKRALFFRFVEFSDPNFGDELKAKVLQHILNPAFLYSFE-----KNEGEQLLGPPNPEGDNQESITSVFITKVLDPEKQTDMLDSLRIYLLQFATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARVIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHN---LVQHMVSAMQRLGFTPSVTIEQRKLAVDLAEVVIKWELQRIKDQPDSDLDPNGSGEGGSSATGGVKRGLAVDASQEVKRFRTATGGISTVFGRSQSLPGPDAALSKAIEKQHTDTVVNFLIRIACQVNDNSNTAGSPGELLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLM-------TVEQPN-QANFANICTGLEVLSFLLTVLQNPAILSSFKPLQRGISACMTCGNTKV-----LRAVHTLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATNANPSQLFGTLMIL---KSACSNNPSYIDRLISVFMRSLQKMVREHLNPQATPGTAEANPAGTSELVMLSLDLVKTRLAVMSMEMRKNFIQTILTSLIEKSPDAKILRAVVKIVEEWLKNNTPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDENLSGSELTAKLEPAFLSGLRCAQPLIRAKFIEVFDTSMKR-RVYDRLLYITCSQNWEAMGNHF----WIKQCIELLL--AVCERNTTIG-------TSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESKEED-VEIDIELAPGDQSTNPKTKELSEK---DIGNQLHMLTNRHDKFLDSLREVKTGALLSAFVQLCHISTPLAEKVWIQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLQIKPKQATEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--PETATAIAYEQHGFFEQAQETYEKAMEKAKKEHERCNASPAVFPEY---QLWEDHWIRCSKELNQWEALTDYGQSKGHINPYLVLECSWRVSNWTAMKEALVQVELSCPKEMAWKVNMYRGYLAICH----------PEEQQLNFIERL---VEMASSLAIREWRRLPY--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQAIVNAYDNSTQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAVVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSDDANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KERQLH-LGVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQHQPSSVGTQSHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMFSSAAS----ESLARRAQATAQDPVFQKLKSQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVFHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIAWHKKTQEDTSSPLSPAGQPENMDSQQLVSLVQKAVTAIVTRLHNLAQFDGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3838          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Xenopus
Match: TRRAP (transformation/transcription domain-associated protein [Source:NCBI gene;Acc:100158625])

HSP 1 Score: 1231.47 bits (3185), Expect = 0.000e+0
Identity = 1092/4185 (26.09%), Postives = 1970/4185 (47.07%), Query Frame = 3
Query:  195 QISLKEKLIIFFDDAKEI----DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETN----------EKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---YSCTE------STDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTXXXXXXXXXXXXSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILY---EKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTS---FNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNED-ADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE--------------------------------------ALTGLSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEEVEQ--------LIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDS--RYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQW---KDIIQNHKLN--QNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKL---------------------------IHITANAATDSSRVYRNE----IYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLIRELSYSDPSDSNNQSEEIKLYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            Q +L +K + F     ++    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FVR +YK+L    N+ F + P    +++   P    ++ T  V K++ ++ D         I+PK   SLKV+ E+P+++VLMYQ +K  I N ++ F+PLIM  +    S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ ++  ++ K++  +V+GM +++ N P    ++RKE  IAA+HIL T +++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L  ++ A  ++ KN+ D+++  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C  ++              P          T   T   ++ L    K  EK  + +      T  + D + L K L+ G+KTIT  ITS      +             + N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +P  SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++Q+   + Q GP I + F +     I LP+++ + TA+  LK    E   +       +AW  +K F+V ++     N++    ++ +    P  +   +                 H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C      C +      +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E++  +I   ++K    V   ++  + + N  VR++A   LQ L+++TG+ +  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F +E+ N+ E                                               +  T+ +   Y  +S+ V L++AA   L+   YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ + +   ++ + N  + + ++ K    I  + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+AKP+RD L   P   I L+       P V         P+ ST+    ++   A+KII  + K++  W  N   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    +   E LF + R+F  R L ++  L++++ +   K   + ++    +   +  +  +  ++   +  +I+ PAF  + E       + E   GPP P  D  + I ++F+ K++D +   D    LR+   QF  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + +   L+Q+ +S +    F P    EQR+  +D+ E++I+W++ R K++                                      A  G+S +        G D    K+I  Q  +++ N ++R+  Q+ D S T  +  +   RR + LL+TA  P +W    L ++   +          TV  P     F N+   L+ L+  L ++ +  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K ++ N +++   L +L   + A  N  +++DR +   +    K+V E +   +     E         ++ +++++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K++E +   ++R  + +R L++  +  W++   +F    WI   +E+LL     + + TI         +C+   L     +T+  NL  S   A FA ++    E       E K  + V+   + +  D  T+  +K    K   +I N L+    +H++  + +++V  G +LS+ + + + S  L+  V+  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C     E   ++A+ Q G        Y+KA++ + +   +   S   + +    Q + D   R  K+++QW++L  +   + ++N  +  E  WR   W   K+ +   +L+  +    +++ +R  L  C+          P  + ++   +L       +   +++W+ LP   +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S I +WR+  +  +                           +H +A+A     ++ R +    + L +L  +       +  C +    K++QQ+   +  +  + K EC             ++ LE++E+ + + F  K   A+FY  K M  +  NK D+A + F  A+Q+     K W+++ D+LEN+F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L   L  E      S     +  +     ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++S   S    + +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   +++  ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + D      + +    NSLD  N   M P+   W+
Sbjct:   14 QTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTTSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVRQIYKDLSKVVNRYFENPPVIADNTVPA-PEMVGMISTI-VVKVNPERDDSETR--THTIIPKGSLSLKVLAELPIIVVLMYQLYKLNIHNVVSEFVPLIMSTIVTQVSPNARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQD-IVAKHSQQMVKGMLQLLTNCPPETAHLRKELLIAAKHILST-DLRSQFIPSMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLNDLSLAVQLFAKNIDDESIPSSIQTMSCKLLLNLVDCIRSK---SEQENGNGRDILMRMLEVFVLKFHTIARYQLSAIFKKCKPQSELCASDAILPTVPTPAPTTPANAAPTTPATPLTQVSLMVFDKQGEKDKEDKQ-----TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------VPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIR-VANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPQTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAADNEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLQYIVTEIQ-GPSITVEFADCKAS-IQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVAMM-----NLDDNKHALYQLLAHPNFTEKSIP-----------SVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLQCYQVGNQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLIWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLIRCATPLKD---------EEKTEEIENAHKKSFHLVTHDLVREVTSPNPTVRKQAMHSLQVLAQVTGKGVTMIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYSELLNLCEA----------------------------------------------EDATLMKLPCYKSLSSLVPLRIAALNALAACNYLPQSREKIIAALFKALNSTNNELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVMTHKGGQRSEGNCCVQSFSEMKICSAI--INLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDAKPLRDVLAANPNRFITLL------LPGVTQTTVRPGSPSTSTTTMRLDLQFQAIKIISIIVKNDENWLANQHSLVSHLRRVWVSEAFQER-HRKENMVATNWKEPKL---LAFCLLNYCKRNFGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKTYSIAQKRALFFRFVEFSDPNFGDELKAKVLQHILNPAFLYSFE-----KNEGEQLLGPPNPEGDNQESITSVFITKVLDPEKQTDMLDSLRIYLLQFATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARVIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHN---LVQHMVSAMQRLGFTPSVTIEQRKLAVDLAEVVIKWELQRIKDQPDSDLDPNGSGEGGSSATGGVKRGLAVDASQEVKRFRTATGGISTVFGRSQSLPGPDAALSKAIEKQHTDTVVNFLIRIACQVNDNSNTAGSPGELLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLM-------TVEQPN-QANFANICTGLEVLSFLLTVLQNPAILSSFKPLQRGISACMTCGNTKV-----LRAVHTLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATNANPSQLFGTLMIL---KSACSNNPSYIDRLISVFMRSLQKMVREHLNPQATPGTAEANPAGTSELVMLSLDLVKTRLAVMSMEMRKNFIQTILTSLIEKSPDAKILRAVVKIVEEWLKNNTPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDENLSGSELTAKLEPAFLSGLRCAQPLIRAKFIEVFDTSMKR-RVYDRLLYITCSQNWEAMGNHF----WIKQCIELLL--AVCERNTTIG-------TSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESKEED-VEIDIELAPGDQSTNPKTKELSEK---DIGNQLHMLTNRHDKFLDSLREVKTGALLSAFVQLCHISTPLAEKVWIQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPI--PIRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLQIKPKQATEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--PETATAIAYEQHGFFEQAQETYEKAMEKAKKEHERCNASPAVFPEY---QLWEDHWIRCSKELNQWEALTDYGQSKGHINPYLVLECSWRVSNWTAMKEALVQVELSCPKEMAWKVNMYRGYLAICH----------PEEQQLNFIERL---VEMASSLAIREWRRLPY--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQGMGLSNSKAVNAYDNSTQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQ----KIRQQVKCYLQLAVVMGKNEC-------------MQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSDDANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KERQLH-LGVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMFSSAAS----ESLARRAQATAQDPVFQKLKSQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVFHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIAWHKKTQEDTSSPLSPAGQPENMDSQQLVSLVQKAVTAIVTRLHNLAQFDGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3832          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Xenopus
Match: TRRAP (transformation/transcription domain-associated protein [Source:NCBI gene;Acc:100158625])

HSP 1 Score: 1229.93 bits (3181), Expect = 0.000e+0
Identity = 1086/4172 (26.03%), Postives = 1958/4172 (46.93%), Query Frame = 3
Query:  195 QISLKEKLIIFFDDAKEI----DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEHNL-----VLPTLTLQ--DFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---YSCTESTD------FNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTXXXXXXXXXXXXSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLLVTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTS---FNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNED-ADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE--------------------------------------ALTGLSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEEVEQLIG-------AIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDS--RYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQW---KDIIQNHKLN--QNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANA-----ATDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQE--CKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKLIRELSYSDPSDSNNQSEEIK------------LYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            Q +L +K + F     ++    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FVR +YK+L    N+ F + P    +++   P    ++ T  V K++ ++ D         I+PK   SLKV+ E+P+++VLMYQ +K  I N ++ F+PLIM  +    S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ ++  ++ K++  +V+GM +++ N P    ++RKE  IAA+HIL T +++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L  ++ A  ++ KN+ D+++  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C                                          KP+  L     +LPT T Q  D + L K L+ G+KTIT  ITS      +             + N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +P  SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++Q+   + Q GP I + F +     I LP++                           KAW  +K F+V ++     N++    ++ +    P  +   +                 H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C      C +  +      F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E++  +I   ++K    V   ++  + + N  VR++A   LQ L+++TG+ +  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F +E+ N+ E                                               +  T+ +   Y  +S+ V L++AA   L+   YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++   ++  ++++     K G     N+ K    I  + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+AKP+RD L   P   I L+       P V         P+ ST+    ++   A+KII  + K++  W  N   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    +   E LF + R+F  R L ++  L++++ +   K   + ++    +   +  +  +  ++   +  +I+ PAF  + E       + E   GPP P  D  + I ++F+ K++D +   D    LR+   QF  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + +   L+Q+ +S +    F P    EQR+  +D+ E++I+W++ R K++                                      A  G+S +        G D    K+I  Q  +++ N ++R+  Q+ D S T  +  +   RR + LL+TA  P +W    L ++   +          TV  P     F N+   L+ L+  L ++ +  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K ++ N +++   L +L   + A  N  +++DR +   +    K+V E +   +     E   G       +++++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K++E +   ++R  + +R L++  +  W++   +F    WI   +E+LL     + + TI         +C+   L     +T+  NL  S   A FA ++    E       E K  + V+   + +  D  T+  +K    K   +I N L+    +H++  + +++V  G +LS+ + + + S  L+  V+  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C     E   ++A+ Q G        Y+KA++ + +   +   S   + +    Q + D   R  K+++QW++L  +   + ++N  +  E  WR   W   K+ +   +L+  +    +++ +R  L  C+          P  + ++   +L       +   +++W+ LP   +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S I +WR+  +  +++   N+     +++++ +  +     +++  +  RKQ L +       ++       + + F   +Q+  C +++     ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK D+A + F  A+Q+     K W+++ D+LEN+F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L        R++   +     PS    QS                    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K      +  H L  +    +   + ++N    SN++ ++S   S    + +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   +++  ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + D      + +    NSLD  N   M P+   W+
Sbjct:   14 QTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTTSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVRQIYKDLSKVVNRYFENPPVIADNTVPA-PEMVGMISTI-VVKVNPERDDSETR--THTIIPKGSLSLKVLAELPIIVVLMYQLYKLNIHNVVSEFVPLIMSTIVTQVSPNARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQD-IVAKHSQQMVKGMLQLLTNCPPETAHLRKELLIAAKHILST-DLRSQFIPSMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLNDLSLAVQLFAKNIDDESIPSSIQTMSCKLLLNLVDCIRSK---SEQENGNGRDILMRMLEVFVLKFHTIARYQLSAIFKKC------------------------------------------KPQSELCASDAILPTQTFQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------VPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIR-VANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPQTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAADNEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLQYIVTEIQ-GPSITVEFADCKAS-IQLPME---------------------------KAWEVIKCFLVAMM-----NLDDNKHALYQLLAHPNFTEKSIP-----------SVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLQCYQVGNQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLIWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLIRCATPLKD---------EEKTEEIENAHKKSFHLVTHDLVREVTSPNPTVRKQAMHSLQVLAQVTGKGVTMIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYSELLNLCEA----------------------------------------------EDATLMKLPCYKSLSSLVPLRIAALNALAACNYLPQSREKIIAALFKALNSTNNELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMM-QHLRKWMEVVVMT-HKGGQRSEGNEMKICSAI--INLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDAKPLRDVLAANPNRFITLL------LPGVTQTTVRPGSPSTSTTTMRLDLQFQAIKIISIIVKNDENWLANQHSLVSHLRRVWVSEAFQER-HRKENMVATNWKEPKL---LAFCLLNYCKRNFGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKTYSIAQKRALFFRFVEFSDPNFGDELKAKVLQHILNPAFLYSFE-----KNEGEQLLGPPNPEGDNQESITSVFITKVLDPEKQTDMLDSLRIYLLQFATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARVIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHN---LVQHMVSAMQRLGFTPSVTIEQRKLAVDLAEVVIKWELQRIKDQPDSDLDPNGSGEGGSSATGGVKRGLAVDASQEVKRFRTATGGISTVFGRSQSLPGPDAALSKAIEKQHTDTVVNFLIRIACQVNDNSNTAGSPGELLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLM-------TVEQPN-QANFANICTGLEVLSFLLTVLQNPAILSSFKPLQRGISACMTCGNTKV-----LRAVHTLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATNANPSQLFGTLMIL---KSACSNNPSYIDRLISVFMRSLQKMVREHLNPQATPGTAEANPGTSELVMLSLDLVKTRLAVMSMEMRKNFIQTILTSLIEKSPDAKILRAVVKIVEEWLKNNTPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDENLSGSELTAKLEPAFLSGLRCAQPLIRAKFIEVFDTSMKR-RVYDRLLYITCSQNWEAMGNHF----WIKQCIELLL--AVCERNTTIG-------TSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESKEED-VEIDIELAPGDQSTNPKTKELSEK---DIGNQLHMLTNRHDKFLDSLREVKTGALLSAFVQLCHISTPLAEKVWIQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLQIKPKQATEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--PETATAIAYEQHGFFEQAQETYEKAMEKAKKEHERCNASPAVFPEY---QLWEDHWIRCSKELNQWEALTDYGQSKGHINPYLVLECSWRVSNWTAMKEALVQVELSCPKEMAWKVNMYRGYLAICH----------PEEQQLNFIERL---VEMASSLAIREWRRLPY--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQAIVNAYDNSTQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAVVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSDDANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KERQLH-LGVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQHQPSSVGTQSHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAK------ITPHTLNFVKKLVSTFGVGLEN---VSNVSTMFSSAAS----ESLARRAQATAQDPVFQKLKSQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVFHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIAWHKKTQEDTSSPLSPAGQPENMDSQQLVSLVQKAVTAIVTRLHNLAQFDGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3776          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Xenopus
Match: TRRAP (transformation/transcription domain-associated protein [Source:NCBI gene;Acc:100158625])

HSP 1 Score: 1228.39 bits (3177), Expect = 0.000e+0
Identity = 1093/4197 (26.04%), Postives = 1972/4197 (46.99%), Query Frame = 3
Query:  195 QISLKEKLIIFFDDAKEI----DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETN----------EKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---YSCTE------STDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTXXXXXXXXXXXXSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKN------GFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTS---FNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNED-ADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE--------------------------------------ALTGLSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEEVEQLIG-------AIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDS--RYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQW---KDIIQNHKLN--QNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKL---------------------------IHITANAATDSSRVYRNE----IYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRC--LRDKLIRELSYSDPSDSNNQSEEIKLYEN--------VLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            Q +L +K + F     ++    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FVR +YK+L    N+ F + P    +++   P    ++ T  V K++ ++ D         I+PK   SLKV+ E+P+++VLMYQ +K  I N ++ F+PLIM  +    S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ ++  ++ K++  +V+GM +++ N P    ++RKE  IAA+HIL T +++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L  ++ A  ++ KN+ D+++  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C  ++              P          T   T   ++ L    K  EK  + +      T  + D + L K L+ G+KTIT  ITS      +             + N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +P  SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++Q+   + Q GP I + F +     I LP+++ + TA+  LK    E   +       +AW  +K F+V ++     N++    ++ +    P  +   +                 H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C      C +      +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E++  +I   ++K    V   ++  + + N  VR++A   LQ L+++TG+ +  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F +E+ N+ E                                               +  T+ +   Y  +S+ V L++AA   L+   YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ + ++   ++      G +  E      +    + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+AKP+RD L   P   I L+       P V         P+ ST+    ++   A+KII  + K++  W  N   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    +   E LF + R+F  R L ++  L++++ +   K   + ++    +   +  +  +  ++   +  +I+ PAF  + E       + E   GPP P  D  + I ++F+ K++D +   D    LR+   QF  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + +   L+Q+ +S +    F P    EQR+  +D+ E++I+W++ R K++                                      A  G+S +        G D    K+I  Q  +++ N ++R+  Q+ D S T  +  +   RR + LL+TA  P +W    L ++   +          TV  P     F N+   L+ L+  L ++ +  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K ++ N +++   L +L   + A  N  +++DR +   +    K+V E +   +     E   G       +++++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K++E +   ++R  + +R L++  +  W++   +F    WI   +E+LL     + + TI         +C+   L     +T+  NL  S   A FA ++    E       E K  + V+   + +  D  T+  +K    K   +I N L+    +H++  + +++V  G +LS+ + + + S  L+  V+  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C     E   ++A+ Q G        Y+KA++ + +   +   S   + +    Q + D   R  K+++QW++L  +   + ++N  +  E  WR   W   K+ +   +L+  +    +++ +R  L  C+          P  + ++   +L       +   +++W+ LP   +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S I +WR+  +  +                           +H +A+A     ++ R +    + L +L  +       +  C +    K++QQ+   +  +  + K EC             ++ LE++E+ + + F  K   A+FY  K M  +  NK D+A + F  A+Q+     K W+++ D+LEN+F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R   L  K+ +   Y   + S++ S+   +           ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++S   S    + +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   +++  ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + D      + +    NSLD  N   M P+   W+
Sbjct:   14 QTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTTSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVRQIYKDLSKVVNRYFENPPVIADNTVPA-PEMVGMISTI-VVKVNPERDDSETR--THTIIPKGSLSLKVLAELPIIVVLMYQLYKLNIHNVVSEFVPLIMSTIVTQVSPNARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQD-IVAKHSQQMVKGMLQLLTNCPPETAHLRKELLIAAKHILST-DLRSQFIPSMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLNDLSLAVQLFAKNIDDESIPSSIQTMSCKLLLNLVDCIRSK---SEQENGNGRDILMRMLEVFVLKFHTIARYQLSAIFKKCKPQSELCASDAILPTVPTPAPTTPANAAPTTPATPLTQVSLMVFDKQGEKDKEDKQ-----TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------VPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIR-VANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPQTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAADNEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLQYIVTEIQ-GPSITVEFADCKAS-IQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVAMM-----NLDDNKHALYQLLAHPNFTEKSIP-----------SVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLQCYQVGNQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLIWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLIRCATPLKD---------EEKTEEIENAHKKSFHLVTHDLVREVTSPNPTVRKQAMHSLQVLAQVTGKGVTMIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYSELLNLCEA----------------------------------------------EDATLMKLPCYKSLSSLVPLRIAALNALAACNYLPQSREKIIAALFKALNSTNNELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVMTHKGGQRSEGNPLYGHLRAE----MKICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDAKPLRDVLAANPNRFITLLL------PGVTQTTVRPGSPSTSTTTMRLDLQFQAIKIISIIVKNDENWLANQHSLVSHLRRVWVSEAFQER-HRKENMVATNWKEPKL---LAFCLLNYCKRNFGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKTYSIAQKRALFFRFVEFSDPNFGDELKAKVLQHILNPAFLYSFE-----KNEGEQLLGPPNPEGDNQESITSVFITKVLDPEKQTDMLDSLRIYLLQFATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARVIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHN---LVQHMVSAMQRLGFTPSVTIEQRKLAVDLAEVVIKWELQRIKDQPDSDLDPNGSGEGGSSATGGVKRGLAVDASQEVKRFRTATGGISTVFGRSQSLPGPDAALSKAIEKQHTDTVVNFLIRIACQVNDNSNTAGSPGELLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLM-------TVEQPN-QANFANICTGLEVLSFLLTVLQNPAILSSFKPLQRGISACMTCGNTKV-----LRAVHTLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATNANPSQLFGTLMIL---KSACSNNPSYIDRLISVFMRSLQKMVREHLNPQATPGTAEANPGTSELVMLSLDLVKTRLAVMSMEMRKNFIQTILTSLIEKSPDAKILRAVVKIVEEWLKNNTPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDENLSGSELTAKLEPAFLSGLRCAQPLIRAKFIEVFDTSMKR-RVYDRLLYITCSQNWEAMGNHF----WIKQCIELLL--AVCERNTTIG-------TSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESKEED-VEIDIELAPGDQSTNPKTKELSEK---DIGNQLHMLTNRHDKFLDSLREVKTGALLSAFVQLCHISTPLAEKVWIQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLQIKPKQATEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--PETATAIAYEQHGFFEQAQETYEKAMEKAKKEHERCNASPAVFPEY---QLWEDHWIRCSKELNQWEALTDYGQSKGHINPYLVLECSWRVSNWTAMKEALVQVELSCPKEMAWKVNMYRGYLAICH----------PEEQQLNFIERL---VEMASSLAIREWRRLPY--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQGMGLSNSKAVNAYDNSTQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQ----KIRQQVKCYLQLAVVMGKNEC-------------MQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSDDANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KERQLH-LGVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSGTQSHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMFSSAAS----ESLARRAQATAQDPVFQKLKSQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVFHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIAWHKKTQEDTSSPLSPAGQPENMDSQQLVSLVQKAVTAIVTRLHNLAQFDGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3842          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Mouse
Match: Trrap (transformation/transcription domain-associated protein [Source:MGI Symbol;Acc:MGI:2153272])

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 635/2670 (23.78%), Postives = 1196/2670 (44.79%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNST-SFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE------------------------------------ALTG-LSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNP-QINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEII--KTNSQSEEV------EQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLS-VNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAA-----TDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKLIRELSYSDPSDSNNQSEEIK------------LYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I +    K G     N+ K    I  + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      D  ++  F +  L  K+A+P+RD L   P   I L+       P           P+ S    ++   A+KII  + K++  W  +   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    Y   E LF + R+F  R L ++  L++++ +   K   + ++    +   + ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   Q+  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ +S +    F P    EQRR  +D+ E++I+W++ R K++                                    A TG +SA+        G D    K I  Q  +++ N ++R+  Q+ D + T  +  +   RR + LL+TA  P +W    L ++   +          TV  P Q+N  + N+   L+ L   L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K +S N +++   L +L   + A  N  +++DR +   +    K+V E +  +T S S E       E ++ +++++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K+ E +   ++R  + ER L++  +  W++       WI   +E+LL          +  KS     +C+   L     +T+  NL  S   A FA ++    E       E K     +   +  I     DQ S     +LS  +I N L+    +H++  + +++V  G +LS+ + + + S  L+   +  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C    +E   ++A+ Q G        Y+KA+  + +   +S  S   + +    Q + D   R  K+++QW++L +F   + ++N  +  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + +S   +L       +   +++W+ LP+  +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S + +WR+  +  ++    N++     ++++ +  +     +++  +  RKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LE++F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L        R++   +     PS + NQS                    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++    S   ++ +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   ++++ ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + D      + +    NSLD  N   M P+   W+
Sbjct: 1378 YLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITH----KGGQRSDGNEMKICSAI--INLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEATLNDPQWSRMF-MSFLKHKDARPLRDVLAANPNRFITLLL------PGGAQTAVRPGSPSTSNMRLDLQFQAIKIISIIVKNDDAWLASQHSLVSQLRRVWVSETFQER-HRKENMAATNWKEPKL---LAFCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKRALFFRFVEFNDPNFGDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHH---LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVNSVSIKRGLSVDSAQEVKRFRAATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNFLIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWCKSELKLQWFDKLLM-------TVEQPNQVN--YGNICTGLEVLNFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATSANPSQLFGTLMIL---KSACCNNPSYIDRLISVFMRSLQKMVREHLNPQTASGSTEATAAGTSELVMLSLDLVKTRLAVMSMEMRKNFIQTILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDEALSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKR-RVYERLLYVTCSQNWEAMGSHF--WIKQCIELLL---------AVCEKSTAIGTSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESK-----EEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--MRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLPIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--SETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEY---QLWEDHWIRCSKELNQWEALTEFGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICH-----PEEQQLSFIERL---VEMASSLAIREWRRLPH--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSVFMWRQHHYQAIVTAYENSSHHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLESIFV------KERQLHL-GVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQQQPSSAGNQSHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMF----SSAASESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLHIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGVLKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFDGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3847          

HSP 2 Score: 342.813 bits (878), Expect = 3.111e-93
Identity = 278/900 (30.89%), Postives = 453/900 (50.33%), Query Frame = 3
Query: 1737 TLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIG-VNYDSTN------EHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            T  + D + L K L+ G+KTIT  ITS     A              I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +PT SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++ +   + Q GP I + F++     + LP+++ + TA+  LK    E   +       +AW  ++ F+V                        M S  + +   YQ +   N+           H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C           S   +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E+   +I    EK    V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:  541 TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGAQF------------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRV-ANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPTTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLHYVVTEVQ-GPSITVEFSDCKAS-LQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIRCFLVA-----------------------MMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKD---------EERAEEIVLAQEKSFHHVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYTELLNLCEA 1345          

HSP 3 Score: 331.257 bits (848), Expect = 1.025e-89
Identity = 176/467 (37.69%), Postives = 293/467 (62.74%), Query Frame = 3
Query:  195 QISLKEKLIIFFDDAKEI----DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC 1583
            Q +L +K + F     ++    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FV+ +YKEL    N+ F +      +++   P E   + T    K++ +++D        +I+P+   SLKV+ E+P+++VLMYQ +K  I N +A F+PLIM  + +  S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ +++ L+ KY+  +V+GM +++ N P+   ++RKE  IAA+HIL T E++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L+ ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C
Sbjct:   14 QTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEILHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQGIPENTVP--PPEMVGMITTVAVKVNPEREDSETR--THSIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVAEFVPLIMNTIAIQVSTQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE-LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHIL-TTELRNQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKC 471          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Mouse
Match: Trrap (transformation/transcription domain-associated protein [Source:MGI Symbol;Acc:MGI:2153272])

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 635/2653 (23.94%), Postives = 1194/2653 (45.01%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNST-SFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE------------------------------------ALTG-LSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNP-QINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEII--KTNSQSEEV------EQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLS-VNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAA-----TDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLI---RELSYSDPSDSNNQSEEIKLYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I +    K G     N+ K    I  + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      D  ++  F +  L  K+A+P+RD L   P   I L+       P           P+ S    ++   A+KII  + K++  W  +   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    Y   E LF + R+F  R L ++  L++++ +   K   + ++    +   + ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   Q+  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ +S +    F P    EQRR  +D+ E++I+W++ R K++                                    A TG +SA+        G D    K I  Q  +++ N ++R+  Q+ D + T  +  +   RR + LL+TA  P +W    L ++   +          TV  P Q+N  + N+   L+ L   L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K +S N +++   L +L   + A  N  +++DR +   +    K+V E +  +T S S E       E ++ +++++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K+ E +   ++R  + ER L++  +  W++       WI   +E+LL          +  KS     +C+   L     +T+  NL  S   A FA ++    E       E K     +   +  I     DQ S     +LS  +I N L+    +H++  + +++V  G +LS+ + + + S  L+   +  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C    +E   ++A+ Q G        Y+KA+  + +   +S  S   + +    Q + D   R  K+++QW++L +F   + ++N  +  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + +S   +L       +   +++W+ LP+  +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S + +WR+  +  ++    N++     ++++ +  +     +++  +  RKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LE++F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L   L    RE   SDP      +   +    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++    S   ++ +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   ++++ ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + D      + +    NSLD  N   M P+   W+
Sbjct: 1378 YLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITH----KGGQRSDGNEMKICSAI--INLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEATLNDPQWSRMF-MSFLKHKDARPLRDVLAANPNRFITLLL------PGGAQTAVRPGSPSTSNMRLDLQFQAIKIISIIVKNDDAWLASQHSLVSQLRRVWVSETFQER-HRKENMAATNWKEPKL---LAFCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKRALFFRFVEFNDPNFGDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHH---LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVNSVSIKRGLSVDSAQEVKRFRAATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNFLIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWCKSELKLQWFDKLLM-------TVEQPNQVN--YGNICTGLEVLNFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATSANPSQLFGTLMIL---KSACCNNPSYIDRLISVFMRSLQKMVREHLNPQTASGSTEATAAGTSELVMLSLDLVKTRLAVMSMEMRKNFIQTILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDEALSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKR-RVYERLLYVTCSQNWEAMGSHF--WIKQCIELLL---------AVCEKSTAIGTSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESK-----EEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--MRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLPIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--SETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEY---QLWEDHWIRCSKELNQWEALTEFGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICH-----PEEQQLSFIERL---VEMASSLAIREWRRLPH--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSVFMWRQHHYQAIVTAYENSSHHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLESIFV------KERQLHL-GVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDPGPIRATAPMWRC-SRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMF----SSAASESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLHIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGVLKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFDGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3829          

HSP 2 Score: 342.428 bits (877), Expect = 3.667e-93
Identity = 278/900 (30.89%), Postives = 453/900 (50.33%), Query Frame = 3
Query: 1737 TLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIG-VNYDSTN------EHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            T  + D + L K L+ G+KTIT  ITS     A              I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +PT SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++ +   + Q GP I + F++     + LP+++ + TA+  LK    E   +       +AW  ++ F+V                        M S  + +   YQ +   N+           H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C           S   +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E+   +I    EK    V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:  541 TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGAQF------------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRV-ANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPTTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLHYVVTEVQ-GPSITVEFSDCKAS-LQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIRCFLVA-----------------------MMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKD---------EERAEEIVLAQEKSFHHVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYTELLNLCEA 1345          

HSP 3 Score: 330.872 bits (847), Expect = 1.292e-89
Identity = 176/467 (37.69%), Postives = 293/467 (62.74%), Query Frame = 3
Query:  195 QISLKEKLIIFFDDAKEI----DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC 1583
            Q +L +K + F     ++    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FV+ +YKEL    N+ F +      +++   P E   + T    K++ +++D        +I+P+   SLKV+ E+P+++VLMYQ +K  I N +A F+PLIM  + +  S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ +++ L+ KY+  +V+GM +++ N P+   ++RKE  IAA+HIL T E++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L+ ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C
Sbjct:   14 QTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEILHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQGIPENTVP--PPEMVGMITTVAVKVNPEREDSETR--THSIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVAEFVPLIMNTIAIQVSTQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE-LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHIL-TTELRNQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKC 471          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Mouse
Match: Trrap (transformation/transcription domain-associated protein [Source:MGI Symbol;Acc:MGI:2153272])

HSP 1 Score: 627.091 bits (1616), Expect = 9.079e-180
Identity = 634/2689 (23.58%), Postives = 1199/2689 (44.59%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILY---EKFDKNGFID----------------TENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNST-SFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE------------------------------------ALTG-LSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNP-QINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEII--KTNSQSEEV------EQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLS-VNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAA-----TDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKLIRELSYSDPSDSNNQSEEIK------------LYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I +   ++ D N  +                  E  E+  +    + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      D  ++  F +  L  K+A+P+RD L   P   I L+       P           P+ S    ++   A+KII  + K++  W  +   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    Y   E LF + R+F  R L ++  L++++ +   K   + ++    +   + ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   Q+  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ +S +    F P    EQRR  +D+ E++I+W++ R K++                                    A TG +SA+        G D    K I  Q  +++ N ++R+  Q+ D + T  +  +   RR + LL+TA  P +W    L ++   +          TV  P Q+N  + N+   L+ L   L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K +S N +++   L +L   + A  N  +++DR +   +    K+V E +  +T S S E       E ++ +++++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K+ E +   ++R  + ER L++  +  W++       WI   +E+LL          +  KS     +C+   L     +T+  NL  S   A FA ++    E       E K     +   +  I     DQ S     +LS  +I N L+    +H++  + +++V  G +LS+ + + + S  L+   +  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C    +E   ++A+ Q G        Y+KA+  + +   +S  S   + +    Q + D   R  K+++QW++L +F   + ++N  +  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + +S   +L       +   +++W+ LP+  +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S + +WR+  +  ++    N++     ++++ +  +     +++  +  RKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LE++F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L        R++   +     PS + NQS                    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++    S   ++ +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   ++++ ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + D      + +    NSLD  N   M P+   W+
Sbjct: 1093 YLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRSDGNESLSECGRCSLSPFCQFEPAMEGVEEMKICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEATLNDPQWSRMF-MSFLKHKDARPLRDVLAANPNRFITLLL------PGGAQTAVRPGSPSTSNMRLDLQFQAIKIISIIVKNDDAWLASQHSLVSQLRRVWVSETFQER-HRKENMAATNWKEPKL---LAFCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKRALFFRFVEFNDPNFGDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHH---LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVNSVSIKRGLSVDSAQEVKRFRAATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNFLIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWCKSELKLQWFDKLLM-------TVEQPNQVN--YGNICTGLEVLNFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATSANPSQLFGTLMIL---KSACCNNPSYIDRLISVFMRSLQKMVREHLNPQTASGSTEATAAGTSELVMLSLDLVKTRLAVMSMEMRKNFIQTILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDEALSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKR-RVYERLLYVTCSQNWEAMGSHF--WIKQCIELLL---------AVCEKSTAIGTSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESK-----EEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--MRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLPIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--SETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEY---QLWEDHWIRCSKELNQWEALTEFGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICH-----PEEQQLSFIERL---VEMASSLAIREWRRLPH--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSVFMWRQHHYQAIVTAYENSSHHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLESIFV------KERQLHL-GVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQQQPSSAGNQSHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMF----SSAASESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLHIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGVLKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFDGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3587          

HSP 2 Score: 341.658 bits (875), Expect = 5.393e-93
Identity = 278/900 (30.89%), Postives = 453/900 (50.33%), Query Frame = 3
Query: 1737 TLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIG-VNYDSTN------EHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            T  + D + L K L+ G+KTIT  ITS     A              I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +PT SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++ +   + Q GP I + F++     + LP+++ + TA+  LK    E   +       +AW  ++ F+V                        M S  + +   YQ +   N+           H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C           S   +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E+   +I    EK    V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:  256 TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGAQF------------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRV-ANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPTTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLHYVVTEVQ-GPSITVEFSDCKAS-LQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIRCFLVA-----------------------MMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKD---------EERAEEIVLAQEKSFHHVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYTELLNLCEA 1060          

HSP 3 Score: 159.458 bits (402), Expect = 8.926e-38
Identity = 80/190 (42.11%), Postives = 131/190 (68.95%), Query Frame = 3
Query: 1014 TLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC 1583
            TLSFLAY+++ +++ L+ KY+  +V+GM +++ N P+   ++RKE  IAA+HIL T E++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L+ ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C
Sbjct:    2 TLSFLAYIIRIYQE-LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHIL-TTELRNQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKC 186          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Mouse
Match: Trrap (transformation/transcription domain-associated protein [Source:MGI Symbol;Acc:MGI:2153272])

HSP 1 Score: 623.239 bits (1606), Expect = 1.857e-178
Identity = 632/2676 (23.62%), Postives = 1193/2676 (44.58%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKNGFIDTEND------------EKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNST-SFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE------------------------------------ALTG-LSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNP-QINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEII--KTNSQSEEV------EQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLS-VNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAATDSSRVYRNEIY----------------LLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLI---RELSYSDPSDSNNQSEEIKLYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I ++   ++   ++ ++            E+  +    + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+A+P+RD L   P   I L+       P           P+ S    ++   A+KII  + K++  W  +   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    Y   E LF + R+F  R L ++  L++++ +   K   + ++    +   + ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   Q+  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ +S +    F P    EQRR  +D+ E++I+W++ R K++                                    A TG +SA+        G D    K I  Q  +++ N ++R+  Q+ D + T  +  +   RR + LL+TA  P +W    L ++   +          TV  P Q+N  + N+   L+ L   L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K +S N +++   L +L   + A  N  +++DR +   +    K+V E +  +T S S E       E ++ +++++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K+ E +   ++R  + ER L++  +  W++       WI   +E+LL          +  KS     +C+   L     +T+  NL  S   A FA ++    E       E K     +   +  I     DQ S     +LS  +I N L+    +H++  + +++V  G +LS+ + + + S  L+   +  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C    +E   ++A+ Q G        Y+KA+  + +   +S  S   + +    Q + D   R  K+++QW++L +F   + ++N  +  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + +S   +L       +   +++W+ LP+  +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S + +WR+  +      +   ++     Y N  +                  +++  +  RKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LE++F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L   L    RE   SDP      +   +    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++    S   ++ +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   ++++ ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + D      + +    NSLD  N   M P+   W+
Sbjct: 1378 YLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRSDGNESLSECGRCSLSPFCQFEEMKICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDARPLRDVLAANPNRFITLLL------PGGAQTAVRPGSPSTSNMRLDLQFQAIKIISIIVKNDDAWLASQHSLVSQLRRVWVSETFQER-HRKENMAATNWKEPKL---LAFCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKRALFFRFVEFNDPNFGDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHH---LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVNSVSIKRGLSVDSAQEVKRFRAATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNFLIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWCKSELKLQWFDKLLM-------TVEQPNQVN--YGNICTGLEVLNFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATSANPSQLFGTLMIL---KSACCNNPSYIDRLISVFMRSLQKMVREHLNPQTASGSTEATAAGTSELVMLSLDLVKTRLAVMSMEMRKNFIQTILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDEALSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKR-RVYERLLYVTCSQNWEAMGSHF--WIKQCIELLL---------AVCEKSTAIGTSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESK-----EEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--MRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLPIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--SETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEY---QLWEDHWIRCSKELNQWEALTEFGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICH-----PEEQQLSFIERL---VEMASSLAIREWRRLPH--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSVFMWRQHHYQGKPTWSGMHSSSIVTAYENSSHHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLESIFV------KERQLH-LGVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDPGPIRATAPMWRC-SRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMF----SSAASESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLHIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGVLKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFDGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3858          

HSP 2 Score: 342.043 bits (876), Expect = 5.031e-93
Identity = 278/900 (30.89%), Postives = 453/900 (50.33%), Query Frame = 3
Query: 1737 TLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIG-VNYDSTN------EHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            T  + D + L K L+ G+KTIT  ITS     A              I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +PT SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++ +   + Q GP I + F++     + LP+++ + TA+  LK    E   +       +AW  ++ F+V                        M S  + +   YQ +   N+           H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C           S   +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E+   +I    EK    V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:  541 TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGAQF------------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRV-ANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPTTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLHYVVTEVQ-GPSITVEFSDCKAS-LQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIRCFLVA-----------------------MMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKD---------EERAEEIVLAQEKSFHHVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYTELLNLCEA 1345          

HSP 3 Score: 330.872 bits (847), Expect = 1.288e-89
Identity = 176/467 (37.69%), Postives = 293/467 (62.74%), Query Frame = 3
Query:  195 QISLKEKLIIFFDDAKEI----DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC 1583
            Q +L +K + F     ++    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FV+ +YKEL    N+ F +      +++   P E   + T    K++ +++D        +I+P+   SLKV+ E+P+++VLMYQ +K  I N +A F+PLIM  + +  S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ +++ L+ KY+  +V+GM +++ N P+   ++RKE  IAA+HIL T E++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L+ ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C
Sbjct:   14 QTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEILHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQGIPENTVP--PPEMVGMITTVAVKVNPEREDSETR--THSIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVAEFVPLIMNTIAIQVSTQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE-LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHIL-TTELRNQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKC 471          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Mouse
Match: Trrap (transformation/transcription domain-associated protein [Source:MGI Symbol;Acc:MGI:2153272])

HSP 1 Score: 623.239 bits (1606), Expect = 2.023e-178
Identity = 632/2676 (23.62%), Postives = 1193/2676 (44.58%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKNGFIDTEND------------EKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNST-SFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE------------------------------------ALTG-LSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNP-QINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEII--KTNSQSEEV------EQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLS-VNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAATDSSRVYRNEIY----------------LLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLI---RELSYSDPSDSNNQSEEIKLYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I ++   ++   ++ ++            E+  +    + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+A+P+RD L   P   I L+       P           P+ S    ++   A+KII  + K++  W  +   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    Y   E LF + R+F  R L ++  L++++ +   K   + ++    +   + ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   Q+  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ +S +    F P    EQRR  +D+ E++I+W++ R K++                                    A TG +SA+        G D    K I  Q  +++ N ++R+  Q+ D + T  +  +   RR + LL+TA  P +W    L ++   +          TV  P Q+N  + N+   L+ L   L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K +S N +++   L +L   + A  N  +++DR +   +    K+V E +  +T S S E       E ++ +++++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K+ E +   ++R  + ER L++  +  W++       WI   +E+LL          +  KS     +C+   L     +T+  NL  S   A FA ++    E       E K     +   +  I     DQ S     +LS  +I N L+    +H++  + +++V  G +LS+ + + + S  L+   +  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C    +E   ++A+ Q G        Y+KA+  + +   +S  S   + +    Q + D   R  K+++QW++L +F   + ++N  +  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + +S   +L       +   +++W+ LP+  +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S + +WR+  +      +   ++     Y N  +                  +++  +  RKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LE++F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L   L    RE   SDP      +   +    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++    S   ++ +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   ++++ ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + D      + +    NSLD  N   M P+   W+
Sbjct: 1379 YLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRSDGNESLSECGRCSLSPFCQFEEMKICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDARPLRDVLAANPNRFITLLL------PGGAQTAVRPGSPSTSNMRLDLQFQAIKIISIIVKNDDAWLASQHSLVSQLRRVWVSETFQER-HRKENMAATNWKEPKL---LAFCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKRALFFRFVEFNDPNFGDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHH---LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVNSVSIKRGLSVDSAQEVKRFRAATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNFLIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWCKSELKLQWFDKLLM-------TVEQPNQVN--YGNICTGLEVLNFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATSANPSQLFGTLMIL---KSACCNNPSYIDRLISVFMRSLQKMVREHLNPQTASGSTEATAAGTSELVMLSLDLVKTRLAVMSMEMRKNFIQTILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDEALSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKR-RVYERLLYVTCSQNWEAMGSHF--WIKQCIELLL---------AVCEKSTAIGTSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESK-----EEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--MRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLPIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--SETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEY---QLWEDHWIRCSKELNQWEALTEFGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICH-----PEEQQLSFIERL---VEMASSLAIREWRRLPH--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSVFMWRQHHYQGKPTWSGMHSSSIVTAYENSSHHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLESIFV------KERQLH-LGVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDPGPIRATAPMWRC-SRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMF----SSAASESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLHIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGVLKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFDGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3859          

HSP 2 Score: 342.043 bits (876), Expect = 4.990e-93
Identity = 277/900 (30.78%), Postives = 453/900 (50.33%), Query Frame = 3
Query: 1737 TLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIG-VNYDSTN------EHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            T  + D + L K L+ G+KTIT  ITS      +             I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +PT SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++ +   + Q GP I + F++     + LP+++ + TA+  LK    E   +       +AW  ++ F+V                        M S  + +   YQ +   N+           H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C           S   +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E+   +I    EK    V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:  541 TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRV-ANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPTTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLHYVVTEVQ-GPSITVEFSDCKAS-LQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIRCFLVA-----------------------MMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKD---------EERAEEIVLAQEKSFHHVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYTELLNLCEA 1346          

HSP 3 Score: 330.872 bits (847), Expect = 1.310e-89
Identity = 176/467 (37.69%), Postives = 293/467 (62.74%), Query Frame = 3
Query:  195 QISLKEKLIIFFDDAKEI----DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC 1583
            Q +L +K + F     ++    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FV+ +YKEL    N+ F +      +++   P E   + T    K++ +++D        +I+P+   SLKV+ E+P+++VLMYQ +K  I N +A F+PLIM  + +  S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ +++ L+ KY+  +V+GM +++ N P+   ++RKE  IAA+HIL T E++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L+ ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C
Sbjct:   14 QTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEILHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQGIPENTVP--PPEMVGMITTVAVKVNPEREDSETR--THSIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVAEFVPLIMNTIAIQVSTQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE-LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHIL-TTELRNQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKC 471          
BLAST of Transformation/transcription domain-associated protein vs. UniProt/SwissProt
Match: sp|Q8I8U7|TRA1_DROME (Transcription-associated protein 1 OS=Drosophila melanogaster OX=7227 GN=Nipped-A PE=1 SV=4)

HSP 1 Score: 1133.24 bits (2930), Expect = 0.000e+0
Identity = 1032/4024 (25.65%), Postives = 1867/4024 (46.40%), Query Frame = 3
Query:  201 SLKEKLIIFFDDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQK-DMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLP-KIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINI--RFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHC------KYSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERITAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVH--YDIDVDN--HEKFINEIRNILETSTGTDEEI----NAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTXXXXXXXXXXXXSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRE--NYTLATNRQLYFCARLFHASFSERMCESLLVTKVKPVLDILYEKFDK-----NGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTSFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYV-WKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKP-NEDADDIVAIFLNKLIDNQDCGDGGLRVAYCQFCILILEYAPNYIH--EISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDIR------------TKEEAL-------------------------TGLSAIGQD-------KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWG-PINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSK--PLCDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKT-----------NSQSEEVEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLPKQEEHF-APGIREKSELLVKLWGKYH-TWSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWD---SRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTTEMQQS---MAFAQ--QGQYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDS-LDKFLNGENVNYLIKAESLWRKGQWKDI-IQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGI--HNNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLI-HITANAATDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQE--CKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLIRE-----------------------LSYSDPSDSNN--------QSEEIKLYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQI-------VSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNSK--ALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNKIEHLQSKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIK-FAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSED-AHLENLSSLPFRLSPNI 11807
            + +  L I  D + + +L+LKA QE S+ FE   Q+  YP  L    +   + L   EPQF+QEN +Q +RK  LE+  ++P  E  +Q+ K  + +++K+++ +NEEN ++C+++++++HK  RP+F++E+  FL FV+ +Y  L NH   IF  S    +  + +  +E  + E+++V  IH ++  D N  +  +N+LP+   SLKV+QE+P+++VLMYQ +K+ +  E++ FIPLI+  +NL P+  ++      + +Y++F+ AQ+KTLSFLAY+V+ F++ ++   + S+  GM  ++ N P    ++RKE  IAARHI  T +++ +F+  +  L +ED+LIG G T++  +RPLAYSTLADL H V+  LN+  + KA N++ KN+HD++L   IQ MS KLLLN ++ +++   H+  E    + LL K+L   VK+  TI+K  LP + + C         +         +        +  P L   I    +    +  + ++ + +F+ L K L+ G+KTIT    +S                       D + ++ +K      V  Y  L+ Y +  +D+Y I     Q  QR  ++ L ++  +EK +LE    IFL +   NF+E+F T I +++ER   N    Q  Q+I ++S   +PT S + A +++ YLL+ ME +G     ++L+ RLFK +F SV    V  E +L  HL +IV   M+ AL +++P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   +RDL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   ISQGLRTLELCVDN+ P++LY ++ PVR  +M A+ ++ R   +     AF+VLGK G  NR  ++E Q +   S+     P I+I   F E+ E  I+ PV E + +A + L     +   + +S  V++   FL +FI  + DE   ++ +  F+   F          VE     W      ST +H+     N    +TH+                      +AL+G+ +      +R +    +  +V+  T+ A+A+         Y  T   D              +L+D++   M +E+K+  + G  C+  I     +   NK  A  +PI    A++++ L +   WY++ GGC  +  L + +    L+ +L +FLK   + + DL   +  GA+ + K+ ++ ++E  L  I +           + I +  +  K    V   ++  + + N  VRE++  +L+ +  I  + ++ ++ PH  V++DI+PP   + +  P + QI +++ N        C       + ID+ N  H+ F +E+  + E    T  ++    N P +   P+ + A                               AC Y                 S + Y    K+K    +FK M S   E+  TAF C++ F++   +  E   + ++PLL    +  N ++   ++L +  ++F   F+E++ E +L      +++I   ++       N F  ++  E    ++  +E+F  + +AS KY++ L +LVLK E+ +   ++S  R+ LI +L + PTETV LFL                  +D +  +     L+++  +    + K S  +  ++      + P  +  + + H AV II  L +S+  W    + + +AL   W +  + S L   D +    W  I  I  LL  F +   D  E LF + R+   R +  ++ LR FL     +   V WK+N F Y++   +N   + ++   I   +I+P F V+ +      E  +L G PP P  ED  +IV++F+NK+ D     D  +R+A  Q   L++E A  +IH  + +NK+QG+K R ++TFAWP + ++    D   +Y G   ++++I++  I++KI+++VF  L KG+ +E + ++  AL VL PA   R +D N ++ H TKK+ +++  +  QL HI  LI+RH  +Y+  +     L+Q+ I+ +    F P    E ++  +D+ E+II+W++             T+EE +                         T +  +G         +SI     +++ N ++RL  Q+ D      +  ++  RR + LL+ A  P +W  P ++ +  L +       V  TV  P  N   NN+   +DFLT    ++  + ++  ++   +   LC I  N     +R ++   M L  I+  FP +  +K +     +L  LY+ V K I E  + YE+ P  PN++ +   L +L   +    N  +++DR L+  + + + L  + I T           +S +  +E L+ ++E+IK+R  V+  ++R+  +  I V  I    + K++K ++  L  W+K  +       P IREKS LLVKL       ++D  ++  + L ++  ++ +E L+  +  N  + AF  G+  Q  +VR K+ E     +RR  L +R L++I +  WD   S Y     WI   +E+L+L             + M +I C  E    P  +TS   + + ++     SF +  ++H    ++           +   +    +  +       V +  ++Y+  +     + +    +L +   + +   QL+ SV+  +FP++W++      D    + +E++ FLS+ G N +     P+ +  F+E++ K  P  +     +   +L  SHNLW   I+V+ED     S   K I  G +   + D  +SN I      F SL+ +Y  + EED   GLW +      T +  S   M F +  QG YD A+    +  S  + ++    ++++ +  +    R  K+++QWD  LD     ++ N  +  ES WR   W  + I   K  Q  ++          Y + + + K       ++   T  ++      +   +++W+ LPN  I++  H+  LQA    +E  +  Q+  G+    NN   ++K+++K+W+NR P  SD  S  SDI  WR+  +  +  H+   +   S+ +  +     ++   +  RK +L+   +    ++       + + F   +Q+  C ++M     ++   E+LE++E+ + + F  + + A+FY  K +L +   + +EA + F  A Q+     K W+++ D++E +F     ER+              +  A  AL      S N + + K    +AK LW ++ D++  ++   LE+    +P S  LPW   ++ CL + EG  ++++L ++   +P+AVY   R L   L  E                       LS+   +   N         +  +     V+   ++ + + L  ++    Q+ W   SW+E++L Q+        +I     D +    ++       +KL   F + + N+          +  I N     ++ R                R          Q ++ +F+NDF  SK  A+ L   ++KL K WI +L   V     +  ++++ R L+  +Q + ++ LPG+L +     +++ IA   P VE V  N    RR+ IR +NG  + Y +          V+DS      +     +E++ Q+ R+LN  L K++E+ RR LN+  PR++ I+                 Q  +  +N   +SL  I+   C +                         Q+  D+ ++   ++     ++E + R        +   ++ I      + ++K +A    +   D+W  RK LT   A+  + ++ + ++ L A    +      + IS  +  +++D   L     +PFRL+PN+
Sbjct:   11 TFRNYLNILNDSSSKDELKLKATQELSEHFEMIMQSPAYPSFLDNSLKIFMRILQDGEPQFIQENTMQHIRKLILEMIHRLPITESLRQHVKTIITMMLKILKTDNEENVLVCLRIIIELHKHFRPSFNSEIQLFLGFVKEIYTNLPNHLTSIFETSNDVWVTDLKDLNLEVLLSESYSVRTIHVEKALDSNSQQQIYNLLPRGILSLKVLQELPIIVVLMYQIYKNAVHQEVSEFIPLILTTINLQPTVTRRNSPQ--KEIYVEFMGAQIKTLSFLAYIVRIFQEVVIAS-SLSVTSGMLNLMKNCPKEAAHLRKELLIAARHIFAT-DLRQKFIPSIEQLFDEDLLIGKGVTLDS-IRPLAYSTLADLAHHVRQSLNIDVLIKAVNLFSKNVHDESLAVGIQTMSCKLLLNLVDCLRH---HSETEPQRSKALLSKLLKVFVKKFETIAKIQLPLIIQKCKGHAFSGALV--------NSSGNASLSHINAPDLKDDISNIQVSASGSQWIYSVNVAEFRSLVKTLVGGVKTITWGFFNSK------------------FQLTDTKLANHEKIFGPEIVCSYIDLVYYAMEALDIYTINVNPNQ--QR--TSGLISRSKEEKEVLEHFSGIFLMMHSQNFQEIFSTTINFLVERIYKN----QSLQVI-ANSFLANPTTSPLFATVLVEYLLNKMEEMGSNLERSNLYLRLFKLVFGSVSLFPVENEQMLRPHLHKIVNRSMELALISEEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLEGLNRLQSGFHKQHMRDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSPTLISQGLRTLELCVDNLQPDFLYDHIQPVRAALMQALWKTLR-NQDNAALVAFRVLGKFGGGNRKMMVEPQAL---SYIINDKPTISIVTYFQEY-ETPIDFPVDEAIKSAFRALGSNSTDQFYRRQSWEVIR--CFLAAFI-SLDDE--KHMLLKLFTHVDF----------VENKIMNW------STFQHK---AGNETVRETHQ----------------------TALIGMLVASATKDLRDSVCPVMAAVVRHYTMVAIAQQAGPFPQKGYQATHGID------------PMILIDALASCMGHEEKELCKPGIACMGIILDTATNIMGNKDRACKLPIIQYLAEKMVSLCYDRPWYSKVGGCQAIQFLCKHMSLRALFQNLFNFLKAFMFVLMDLEGDVSNGAIEITKSYMKSMLEICLTPINECY---------KNIDLKDLQAKATYEVIHELVRHITSPNTIVREESMVLLKHIGTIQSKTVSEVMDPHKDVLADIIPPKKHLLRHQPANAQIGLMDGNTF------CTTLEPRLFTIDLTNTYHKLFFHELLTLSEAEDATLAKLDCYKNVPNL--IPLRTSA--------------------------LRALAACHYI----------------SDIGY----KEKIINIIFKVMESDKSELQTTAFHCMKHFITGVTLEKEKVQSAMRPLLLKLGDHRNLSIPAIKRLSYFTQIFPQMFNEKLSEQIL-QHCSKIMEIFVSEYKSTSPNVNFFASSKGGEYEQKIVILIEMFFYI-SASVKYIEKLCQLVLKTEKNLMIEASSPYREALIKFLQRFPTETVDLFLTESLM-------------IDPQWNRLFIYLLKHETGVSFRAVIKSSRYNNLIHYLNTHTEFP-EALKYEIQHQAVLIIFTLMESDDQWIPTRQDIVDALKNCWQN--YLSTLSSED-VLCDLWHLIGKI--LLHYFSNNTNDI-ELLFQLLRALCFRFIPDVYFLRDFLQHTVAQSFTVNWKRNAFFYFVENFNNSFLSEELKAKIITAVIIPCFAVSFDK----GEGNKLIGAPPTPYQEDEKNIVSVFINKVFDPDKQYDDAVRIALLQLACLLVERASQHIHDGDANNKRQGNKLRRLMTFAWPCLLSKSS-VDPTARYHGHLLLSHIIARLAIHKKIVLQVFHSLLKGHALEARSIVKQALDVLTPAMPLRMEDGNTMLTHWTKKIIVEEGHAMQQLFHILQLIIRHYKVYFPVRHQ---LVQHLINYMQRLGFPPTASIEHKKLAVDLAEVIIKWELHRIKDDRETKTDGTEEELIQESSVKRSGIDLVETRKKSFDIIRETTVQGVGSHTKPDDILRSIDKSYCDTVLNFLIRLACQVNDPQAPILSPGESLSRRCVMLLKMAMRPEIWPQPFDIKLNWLDK-------VLATVETPHHN--LNNICTGIDFLTFLTTILSPDQLVSIIRPVQRGLSLCIIHQN-----TRIVRLMHMFLTRIMAIFPPDTQHKHE-----DLDLLYTAVSKMIAENLTSYEKSP-QPNASSLFGTLMIL---KACTTNNASYIDRILVQFIRVLNHLTRDHINTIGGNTVISQSPDSNALPLELLVLSLELIKNRIFVMSVEIRKLFIGTILVSLIEKSTEVKIIKCIIKMLDEWIKTKEPNVMTQVPSIREKSALLVKLMQNVEKKFTDEIELNIQFLEIINFIYRDEILKQTELTNKLEGAFLNGLRFQNPNVRSKFFEILDSSMRR-RLHDRLLYIICSQAWDTIGSHY-----WIKQCIELLILT-----------ANTMMQIQCSNEQFKIP-SITSV--IPVNSSETQENSFVSFLSSHSESFDIIQTVDDKDDVYDIDLNADRKEDCQQILPNRRVTLVELVYKQAEFLEANRNIRTDQMLVATSQLCHIDTQLAQSVWLSMFPRIWSIFTE---DQRCNITKELIPFLSS-GTNVNQKDCHPSTLNTFVESLTKCAPPIY--IPPNLLAYLGKSHNLWHRAILVLEDMAVNQSMQSKDIDGGENQFSDLDVQQSNNI------FDSLSKMYSSMHEEDLWAGLWLKFAHYPETNIAVSYEQMGFFEEAQGAYDLAMTKFKQDLSNGVVNTYVNSELLLWENHW---MRCAKELNQWDILLDYAQTNKDKNMFLILESSWRVPDWNLMKIALAKTEQCYLKH---------YGFKINLYKGYLSILHQEERQTGNIERYVEIASSLCIREWRRLPN--IVSHIHLPYLQASQQIMELHEASQIHQGLAQSRNNSLHDMKAIVKTWRNRLPIISDDLSHWSDIFTWRQHHYQIITQHLEQQSDQGSTMLGVHASAQAIISFGKIARKHNLTGVCQETLSRIYTIPSVPIVDCFQKIRQQVKCYLQMPSTSGKNEINEALEVIESTNLKYFTGEMN-AEFYALKGLLLAQIGRSEEAGKSFSVAAQLHDGLTKAWAMWGDYMEQIFLK---ERK--------------ITLAVDALICYLQASRNQI-ESKTRKYIAKVLWFLSYDNNTKILISTLEKHVAGIPPSYWLPWIPQLLCCLEQFEGDVILNLLSQIGRLYPQAVYFPIRTLYLTLKIEQREKHKTAEQAVKSSCSNIDGTTLSFGRGASHGNIPSINPIKATPPMWRCSKVMQLQREVHPTILSSLEGIVDQMVWFRESWTEEVLRQLRQGLIKCYAIAFEKRDTVQHSTITPHTLHFVKKLGSTFGIGIENV------PGSVTSSISNSAASESLAR----------------RAQVTFQDPVFQKMKEQFTNDFDFSKPGAMKLHNLISKL-KTWIKVLETKVKKLPTSFLIEDKCRFLSNFSQKTAEVELPGELLIPLSSHYYVRIARFMPRVEIVQKNNTAARRLYIRGTNGKIYPYLV----------VLDS-----GLGDARREERVLQLKRMLNYYLEKQKETSRRFLNITVPRVVPISP----------------QMRLAEDNPNSISLLKIFKKCCQSM------------------------QVDYDMPIVKYYDR-----LSEVQARGTPTTHTLLREIFSEIQWTMVPKTLLKHWALKTFLAATDFWHFRKMLTLQLALAFLCEHALNLTRLNADMMYLHQDSGLMNISYFKFDVNDDKCQLNQHRPVPFRLTPNV 3664          
BLAST of Transformation/transcription domain-associated protein vs. UniProt/SwissProt
Match: sp|Q80YV3|TRRAP_MOUSE (Transformation/transcription domain-associated protein OS=Mus musculus OX=10090 GN=Trrap PE=1 SV=2)

HSP 1 Score: 624.009 bits (1608), Expect = 8.420e-180
Identity = 632/2673 (23.64%), Postives = 1198/2673 (44.82%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTSFNVH---HF-AVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE------------------------------------ALTG-LSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNP-QINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEII--KTNSQSEEV------EQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLS-VNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAA-----TDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKLIRELSYSDPSDSNNQSEEIK------------LYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I +    K G     N+ K    I  + LFH++ AA    V+P  E+V++ E+ +   + S  R+PLI +L++ P++TV+LF+      D  ++  F +  L  K+A+P+RD L   P   I L+        P  ++      P +S++ N+     F A+KII  + K++  W  +   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    Y   E LF + R+F  R L ++  L++++ +   K   + ++    +   + ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   Q+  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   +Y G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI + IV+H  +YY  + H   L+Q+ +S +    F P    EQRR  +D+ E++I+W++ R K++                                    A TG +SA+        G D    K I  Q  +++ N ++R+  Q+ D + T  +  +   RR + LL+TA  P +W    L ++   +          TV  P Q+N  + N+   L+ L   L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K +S N +++   L +    + A  N  +++DR +   +    K+V E +  +T S S E       E ++ +++++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K+ E +   ++R  + ER L++  +  W++       WI   +E+LL          +  KS     +C+   L     +T+  NL  S   A FA ++    E       E K     +   +  I     DQ S     +LS  +I N L+    +H++  + +++V  G +LS+ + + + S  L+   +  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C    +E   ++A+ Q G        Y+KA+  + +   +S  S   + +    Q + D   R  K+++QW++L +F   + ++N  +  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + +S   +L       +   +++W+ LP+  +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S + +WR+  +  ++    N++     ++++ +  +     +++  +  RKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LE++F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L        R++   +     PS + NQS                    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++    S   ++ +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   ++++ ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + D      + +    NSLD  N   M P+   W+
Sbjct:   96 YLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITH----KGGQRSDGNEMKICSAI--INLFHLIPAAPQTLVKPPLEVVMETERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMGATLNDPQWSRMF-MSFLKHKDARPLRDVLAANPNRFITLLL-------PGGAQTAVR--PGSSSTSNMRLDLQFQAIKIISIIVKNDDAWLASQHSLVSQLRRVWVSETFQER-HRKENMAATNWKEPKL---LAFCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKRALFFRFVEFNDPNFGDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACRYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHPIVQHFKVYYPVRHH---LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVNSVSIKRGLSVDSAQEVKRFRAATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNFLIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWCKSELKLQWFDKLLM-------TVEQPNQVN--YGNICTGLEVLNFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATSANPSQLFGTLMI---HKSACCNNPSYIDRLISVFMRSLQKMVREHLNPQTASGSTEATAAGTSELVMLSLDLVKTRLAVMSMEMRKNFIQTILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDEALSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKR-RVYERLLYVTCSQNWEAMGSHF--WIKQCIELLL---------AVCEKSTAIGTSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESK-----EEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--MRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLPIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--SETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEY---QLWEDHWIRCSKELNQWEALTEFGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICH-----PEEQQLSFIERL---VEMASSLAIREWRRLPH--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSVFMWRQHHYQAIVTAYENSSHHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLESIFV------KERQLHL-GVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQQQPSSAGNQSHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMF----SSAASESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLHIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGVLKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFDGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 2565          
BLAST of Transformation/transcription domain-associated protein vs. UniProt/SwissProt
Match: sp|Q9Y4A5|TRRAP_HUMAN (Transformation/transcription domain-associated protein OS=Homo sapiens OX=9606 GN=TRRAP PE=1 SV=3)

HSP 1 Score: 625.55 bits (1612), Expect = 2.764e-178
Identity = 634/2679 (23.67%), Postives = 1191/2679 (44.46%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILY---EKFDKNGFIDTEND---------EKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNST-SFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEE---------------------------------------ALTGLSAI--------GQD----KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNP-QINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEEVEQLIG-------AIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDS--RYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLS-VNIQNILY----QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAATDSSRVYRNE-------------IYLLLLELVRNGRKQHLSSCTKLYADKLKQ--QLPEM-VSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLI---RELSYSDPSDSNNQSEEIKLYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I +   ++ D N  I              E+  +    + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+A+P+RD L   P   I L+       P           P+ ST   ++   A+KII  + K++ +W  +   L   L + W S  FQ R  R + +  ++W + +    L  C ++Y    Y   E LF + R+F  R L ++  L++++ +   K   + ++    +     ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   Q+  L++E+AP++IH+ +NK +  K R ++TFAWP + ++    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ +S +    F P    EQRR  +D+ E++I+W++ R K++                                       A   +SA+        G D    K I  Q  +++ N ++R+  Q+ D + T  +  +   RR + LL+TA  P +W    L ++   +          TV  P Q+N  + N+   L+ L+  L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE K ++ N +++   L +L   + A  N  +++DR +   +    K+V E +   + S   E   G       ++E++K+R  V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + ++ ++  + L ++  V+ +E L   +     + AF +G+      +R K+ E +   ++R  + ER L++  +  W++   +F    WI   +E+LL          +  KS     +C+   L     +T+  NL  S   A FA ++    E       E K     +   +  I     DQ S     +LS  +I N L+    +H++  + +++V  G +LS+ + + + S  L+   +  +FP+LW +L ++       +  E+  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLWF   +++E   +     EK +   +      +  E   I       L SL  LY LL+EED   GLW ++C    +E   ++A+ Q G        Y+KA+  + +   +S  S   + +    Q + D   R  K+++QW++L ++   + ++N  +  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + +S   +L       +   +++W+ LP+  +++  H  +LQA    +E  +  Q+ +G+       NN   ++K+++K+W+NR P  SD  S  S I +WR+  +      +   ++     Y N              ++     +++ G+         +  D L +   +P + + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LEN+F       ++R  H  G+ AIT  + A             H  + K    LAK LWL++ DD +  ++  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L   L    RE   SDP      +   +    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++S   S    + +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++   ++++ ++ L      I      L ++  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++ +LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + +      + +    NSLD  N   M P+   W+
Sbjct: 1378 YLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRSDGNESISECGRCPLSPFCQFEEMKICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDARPLRDVLAANPNRFITLL------LPGGAQTAVRPGSPSTSTMRLDLQFQAIKIISIIVKNDDSWLASQHSLVSQLRRVWVSENFQER-HRKENMAATNWKEPKL---LAYCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKRALFFRFVDFNDPNFGDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHD-NNKNRNSKLRRLMTFAWPCLLSK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHH---LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVNSVSSSIKRGLSVDSAQEVKRFRTATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNFLIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLM-------TVEQPNQVN--YGNICTGLEVLSFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYE-KATNANPSQLFGTLMIL---KSACSNNPSYIDRLISVFMRSLQKMVREHLNPQAASGSTEATSGTSELVMLSLELVKTRLAVMSMEMRKNFIQAILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQ-TPTLREKSILLVKMMTYIEKRFPEDLELNAQFLDLVNYVYRDETLSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKR-RVYERLLYVTCSQNWEAMGNHF----WIKQCIELLL---------AVCEKSTPIGTSCQGAMLP---SITNVINLADSHDRAAFAMVTHVKQEPRERENSESK-----EEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHA---LAGEISPFLCS-GSHQVQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWFRSTLMLEHQAF-----EKGLSLQIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKY--SETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEY---QLWEDHWIRCSKELNQWEALTEYGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICH-----PEEQQLSFIERL---VEMASSLAIREWRRLPH--VVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQGKPTWSGMHSSSIVTAYENSSQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KERQLH-LGVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDPGPIRATAPMWRC-SRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMFSSAAS----ESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQSNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3859          

HSP 2 Score: 345.51 bits (885), Expect = 3.034e-93
Identity = 279/900 (31.00%), Postives = 453/900 (50.33%), Query Frame = 3
Query: 1737 TLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIG-VNYDSTN------EHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            T  + D + L K L+ G+KTIT  ITS      +             I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   +PT SA+ A +++ YLLD +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++ +   + Q GP I + F++     + LP+++ + TA+  LK    E   +       +AW  +K F+V                        M S  + +   YQ +   N+           H+YK  D   A KT E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C           S   +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  +   FLK L + + DL  ++  GA+ MAKT LE L+      +           E+   +I    EK    V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:  540 TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRV-ANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANPTTSALFATILVEYLLDRLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGGSNRKMLKESQKLHYVVTEVQ-GPSITVEFSDCKAS-LQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVA-----------------------MMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTP-ARKTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKD---------EERAEEIVAAQEKSFHHVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVVEHKVFYTELLNLCEA 1345          

HSP 3 Score: 330.872 bits (847), Expect = 9.089e-89
Identity = 176/467 (37.69%), Postives = 293/467 (62.74%), Query Frame = 3
Query:  195 QISLKEKLIIFFDDAKEI----DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC 1583
            Q +L +K + F     ++    + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  ++V+ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FV+ +YKEL    N+ F +      +++   P E   + T    K++ +++D        +I+P+   SLKV+ E+P+++VLMYQ +K  I N +A F+PLIM  + +  S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ +++ L+ KY+  +V+GM +++ N P+   ++RKE  IAA+HIL T E++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L+ ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C
Sbjct:   14 QTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRFLETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQVIPENTVP--PPEMVGMITTIAVKVNPEREDSETR--THSIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVAEFVPLIMNTIAIQVSAQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE-LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHIL-TTELRNQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKC 471          
BLAST of Transformation/transcription domain-associated protein vs. UniProt/SwissProt
Match: sp|G5EEV2|TRR1_CAEEL (Transcription-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=trr-1 PE=2 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 2.761e-76
Identity = 281/992 (28.33%), Postives = 498/992 (50.20%), Query Frame = 3
Query:  186 SHHQISLKEKLIIFFDDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQ-RPNFSNEVINFLKFVRNVYKEL--QNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNK----IDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNL-IPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKF--FKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKL--EKGCLV-------ETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKI-------------DEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTIT---LTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCF--ENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXX---XXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRT-AFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDF---INLPVKEIV 3023
            S+H   L+ ++    D+++  D++LK  QE     E     S + +V++ L     +    T PQF+ EN  QQLRK  LE+  ++ + E  K +SK  +  +M+L+  ENEEN  + +K++ D  +S  +  +  EV   +   + +  +L        +F      E  +      + +V+  +  T  + +   +N  +    + +N++P +  S KV+ E+P L++  YQ  K+ I  E   F+ L ++FLN+ +P E + K    N+ +  DF++AQ + LSF+  + K   F   +M+     LV G  +M+   P+++ ++R+E  +A ++   + E+K +F  +L  L+ E++++G G+T  + LR   Y  LADL+H +++ ++   I     ++ + +HD      +Q MS +LL +  E +    +H   +  + R+LLI+IL + V +L T++ +++P L  + G  +       E + ++P     +  ++        RL + ++ ++             DE    P     LP  T +  K   + ++  + T+T   L I  +  LV       +  +    I+       H  K  D F+     +L+RY +  MD++++     Q     P    + +  DEK  LE +  +F  +  A F+E+F+  + ++IER    +  +QL         E         A+ +LS+L+  M+++     +  L+ +LFK IF+++  N      + +L  +L  I+      AL+A++P ++  LLR LFRSIGGGA + LY +FL LLP +L     L++L    H  Q+R+L  ELC+ VPVRLS+LLP+L LLM+PLV  +  S N ++QGLRTLELCVDN+ PEYL +NM PVRG +M  + +      +  + T AF++LGK G  NR  L + Q +Q  +  +     IN+ F+    D    I+LP+ E++
Sbjct:   18 SNHLTELETRIQNLADNSQRDDVKLKMLQEIWSTIENHFTLSSHEKVVERLILSFLQVFCNTSPQFIAENNTQQLRKLMLEIILRLSNVEAMKHHSKEIIKQMMRLITVENEENANLAIKIVTDQGRSTGKMQYCGEVSQIMVSFKTMVIDLTASGRAGDMFN---IKEHKAPPSTSSDEQVITEYLKTCYYQQTVLLNGTEGKPPLKYNMIPSAHQSTKVLLEVPYLVIFFYQHFKTAIQTEALDFMRLGLDFLNVRVPDEDKLKT---NQIITDDFVSAQSRFLSFVNIMAKIPAFMDLIMQN-GPLLVSGTMQMLERCPADLISVRREVLMALKY-FTSGEMKSKFFPMLPRLIAEEVVLGTGFTAIEHLRVFMYQMLADLLHHMRNSIDYEMITHVIFVFCRTLHDPNNSSQVQIMSARLLNSLAESLCKMDSH---DTFQTRDLLIEILESHVAKLKTLAVYHMPILFQQYGTEIDYEYKSYERDAEKPGMNIPKDTIRGVPKRRIRRLSIDSVEELEFLASEPSTSEDADESGGDPNK---LPPPTKEGKKTSPEAILTAMSTMTPPPLAIVEARNLVKYIMHTCKFVTGQLRIARPSQDMYHCSKERDLFE-----RLLRYGVMCMDVFVLPTTRNQ-----PQMHSSMRTKDEKDALESLANVFTTIDHAIFREIFEKYMDFLIERIYNRNYPLQLMVNTFLVRNE-----VPFFASTMLSFLMSRMKLLEVSNDKTMLYVKLFKIIFSAIGANGSGLHGDKMLTSYLPEILKQSTVLALTAREPLNYFLLLRALFRSIGGGAQDILYGKFLQLLPNLLQFLNKLTNLQSCQHRIQMRELFVELCLTVPVRLSSLLPYLPLLMDPLVCAMNGSPNIVTQGLRTLELCVDNLQPEYLLENMLPVRGALMQGLWRVVSKAPDTSSMTAAFRILGKFGGANRKLLNQPQILQVATLGDTVQSYINMEFSRMGLDGNHSIHLPLSELM 980          

HSP 2 Score: 173.326 bits (438), Expect = 3.552e-41
Identity = 339/1660 (20.42%), Postives = 657/1660 (39.58%), Query Frame = 3
Query: 5364 FAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLM--------RF-DKIHYSHWTD-----IETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFL-TDLFVKRNYVWKQNLFRYYI--------TQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPP----------KPNEDADDIVAIFLNKLIDNQDCGDGGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVL-HTKKVSMDDVTS-QSQLHIGNLIVRHSDIYYQAKMHIL-PLMQYFISRLSNQN-----FQPEQRRCLLDMIELIIRWD---------IRTKEEAL----------TGLSAIGQD-------KSISDQQKESL---ANLIVRLMVQI------------LDQSQTNSANVDASCRRALFLLETAFHPLVWGP-INLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVM----CLDFLTTFLKLMDSNNILQNMKSFSKPLCDILNNQKVAQS-RFIKFFGMVLKAILLRFPAEPSNKQKITQNV--ELMDLYSTVLKFIQEAFSCYE--QKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEE-----------VEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLPKQEEHFAPGIREKSELLVKLWGKYHTWSDNA-DIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYL---EFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINC---------KEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILYQHNQT-WNKVKKVPVGDVLSSV--LLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK---LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTT-----EMQQSMAFAQQGQYDKALKISVESGSQSLN-----SSVEYKDIVMRQKFYDFNYRYLKKIS---QWDSLDKFLNGENVNY---LIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYC--------YSLIMNKMTSMPSGEDVSNTPQLDN---EFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDG-------MQLFSGIHNNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIH---------ITANAATDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLK--QQLPEM-----VSNSFTLYKQECKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLEN 9827
            FA  I+ +++KS P W ++       + K +   EF  R +        +F ++I     T+      + ILN    ++      Y+    +A  F    +  L  LR++L T++  K    W++ LF   +        T   +  +   + Y++     +P    A E      +  E+ G  P           P   +D++VA   + +  +++    G+ + + Q C L ++ A  +IH  + KKQG + RI++ FAWP +T      D   +Y G   +A +I +F INRKI+++VF  L      + +  I  A+ +L PA   R +D +  +L H KK+ +++  + Q   H+  ++VR+  +YY  ++ +L PL+      L   N     F  + RR  +++ E++I+W+         I + EEAL          T  S    D       + + D Q+  +   A++IV ++V+               QS  +   +   C+    LL  A  P +WG  ++  +  + ++  I  +  N + N   +T + N +      LD L   + +M   +++  M+   +PL   LNN   AQ+ +  +    ++  +L         K  ++ N   EL  L   + +F+ E F      +  S P    V   L   ++ +    +  A++D  +   V +  +   E +   + S++            E L   +E+++ R + +  +++R+ V  I  + II     K+++  +  L   +    Q+  F   I     LLV++     T   N  D+  + L V++ VFEN + +  +  +     F  G+ S     REK+    E     +  +++  R  +++   +W    FK   W+   L  +L  I        N +  +  +NC           +  DQPM+V +                K +E     + E                D   D      P +       +L    Q   ++       D L +V  +  + N +Q++S ++  +F   W+ L     + +T +   +V F+S+  HN +      + +  +LEAV     LP+           F++S H  W  GI ++E+ ++        I   ++N +  +   + G+    +   SL  LY  + E D    +W  +     T      MQ       Q   +K++  + E+ + ++N     +S ++   ++ +++  +   Y+   S   QW ++    NG+++ +   LI A S             H  + N V+E    +SQ+  C        Y+L     T M   E+ S T   +       + T   + +W++LP+  +++  HV +LQA NL  E  +        ++  S   +  +  ++KS++K ++NR P  SD   F S    WR  +   ++          +   A  + S V  + +    L + ++ +     + TK   +KL     +P M     V       +        E        E+LE+LE+V     + K  +A    ++A + S  ++ + A   F  A Q+    N + +     ++N
Sbjct: 1729 FAFSIVDRISKSCPEWLISPNSPIPRIKKLFSETEFNERYVVRALTEVKKFQEEIIVKRMTEHKYKVPKLILNTFLRYLRLNIYDYDLFIVIASCFNGNFVTDLSFLREYLETEVIPKVPLQWRRELFLRIMQKFDTDPQTAGTSMQHVKALQYLV-----IPTLHWAFERY----DTDEIVGTAPIDDSDSSMDVDPAGSSDNLVARLTSVIDSHRNYLSDGMVIVFYQLCTLFVQNASEHIHNNNCKKQGGRLRILMLFAWPCLTMY-NHQDPTMRYTGFFFLANIIERFTINRKIVLQVFHQLMTTYQQDTRDQIRKAIDILTPALRTRMEDGHLQILSHVKKILIEECHNLQHVQHVFQMVVRNYRVYYHVRLELLTPLLNGVQRALVMPNSVLEKFSWQTRRHAVEICEMVIKWELFRTLKTDHIISDEEALEVDKQLDKLRTASSTDRFDFEEAHNKRDMPDAQRTIIKEHADVIVNMLVRFCMTFHQNSGSSSTSQSGNHGVELTKKCQ---LLLRAALRPSMWGEFVSFRLTMIEKFLSIPND--NALRNDISSTAYANTIQNAQHTLDMLCNIIPVMPKTSLMTMMRQLQRPLIQCLNNG--AQNFKMTRLVTQIVSRLL--------EKTNVSVNGLDELEQLNQYISRFLHEHFGSLLNCRNLSGP----VLGVLGAFSLLRTICGHEPAYLDHLMPSFVKVMERAAKEHLAYVANSQDGNMVKNFFPDVAELLCACMELVRPRVDHISMEIKRSIVGGIIAELIIKSNHDKIIQTSVKLLGAMIS--TQDMEFT--ILTVLPLLVRIQSIIVTKFKNCKDLIADYLVVVITVFENSEYRNSEAGSRLWEGFFWGLKSSDPQTREKFSIVWEKTWPHMATVDIAHRMKYIMQNQDWSK--FKHAFWLKFALWGMLRTIAKRPTDPNNKRKKVILLNCATPWRTIEYAAKLKDQPMEVET--------------EMKREEPEPMEVDE---------------KDSQDDSKDAGEPKEKEKLTLELLLAGQQELLDEASNYDFADALDTVSQITFALNENQVTSKMWVVLFKSFWSSLSQSEIEDFTAL---VVPFMSSGVHNNYQTGVQDSVLAVWLEAVGDAVHLPSRL-------IEFISSKHECWHTGIRLLENHIWT-------IPKQLNNTLLREMKVAPGLAGDIETLESLGTLYNEISEFDQFAAIWERRAVFPDTMRAMSAMQLGDMELAQSYLEKSMSSTYETLAPTINPNNTSNSEKHVSPIIDKEYDHWMEMYITNCSELLQWQNVADVCNGKDMQHVRGLINAAS-------------HIPDWNVVEEC---KSQIAGCIPPSFHLDYTLFNLMSTVMRMNENSSPTHMKERCKIAIQECTEAHISRWRALPS--VVSYGHVKILQAMNLVREIEESTDIRIALLEAPSNKVDQALMGDMKSLMKVFRNRTPTTSDDMGFVSTWYDWRNQIHGMMLQRFEYWDKVGLNVAATGNQSIVPIHSMAQAQLAVAKHAKNLGFHNLTKDLLNKLAGLTAIPMMDAQDKVCTYGKTLRDMANSAADERVKNELLCEALEVLEDVRIDDLQ-KDQVAALLYHRANIHSVLDQAENADYTFSAASQLVDLQNSVTTTGIKLMKN 3288          

HSP 3 Score: 57.3806 bits (137), Expect = 4.226e-6
Identity = 60/288 (20.83%), Postives = 125/288 (43.40%), Query Frame = 3
Query: 3567 TRLLVDSITETMAYEDKDCIRIGTICLERITAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIE-YSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQL---SRITGR------NLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINA 4400
            + ++VD++   ++      I  G + L  I   +     +    S +P+     +++ +L H  AWYAR GG   +  +I      ++ D ++D +  +   I     +I  G+   A  CL+ ++  Y + E G+         E+E + + TI+   ++++ ++  H     N+ VRE A  ++      SR+               +P L  V   + PT ++  A      +     NY+F    NC +   ++ D+D ++++++ + +I +T T T  + NA
Sbjct: 1130 SSVMVDALIICLSETSSSFIIAGVMSLRHINETLSLTLPDIDQMSKVPMCKYLMEKVFKLCHGPAWYARSGGINAIGYMIESFPRKFVMDFVIDVVDSIMEVILGTVEEISSGSADSAYDCLKKMMRVYFIKEEGQ---------EEENLTLATIF---VSAISKHYFH----SNERVREFAIGLMDHCMVHSRLAPSLDKFYYRFKEFFEPELMRVLTTV-PTMSLADAGGSLDGV----QNYMF----NCPDGFDFEKDMDMYKRYLSHLLDIAQTDTFTLNQRNA 1392          
BLAST of Transformation/transcription domain-associated protein vs. UniProt/SwissProt
Match: sp|P38811|TRA1_YEAST (Transcription-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRA1 PE=1 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 3.931e-54
Identity = 147/487 (30.18%), Postives = 247/487 (50.72%), Query Frame = 3
Query:  225 FFDDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMN----------DNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNL-------IPSEAQKKDEHF--------NETLYLDFLAAQVKTLSFLAYV-VKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETNEKQ 1607
            F DD   +  R     E  D  E      DY   L+ +       L +    +   +P Q+LR   L++F +   N+  + Y+   +  L+ ++  ENEEN ++C+K+L  + KS +    +++ +F++ +  +YK   N  N+ F  +   E   +D  P E +  E       + ++KD            +N    N L  S +S K++ E P+ +V +Y  +K   +  +  F PLIM  LN+          +A+ + EHF        N   Y DF+ AQ+K  SFLAYV ++ +    ++ Y + +   + R++ + PS +++ RKE   A RHIL T   K  F+  L  L +E ILIGNG+T+++ LRPLAYST+AD IH ++SEL L++I K   +Y   + D++L  ++Q MS KLLLN +E I      NPQE    ++LL+ I+ + + R  T+++ Y   ++     ET++K+
Sbjct:   14 FRDDDATLQSRYSTLSELYDIMELLNSPEDYHFFLQAVIPLLLNQLKEVPISYDAHSPEQKLRNSMLDIFNRCLMNQTFQPYAMEVLEFLLSVLPKENEENGILCMKVLTTLFKSFKSILQDKLDSFIRIIIQIYKNTPNLINQTFYEAGKAEQGDLDS-PKEPQADELLDEFSKNDEEKDFPSKQSSTEPRFENSTSSNGLRSSMFSFKILSECPITMVTLYSSYKQLTSTSLPEFTPLIMNLLNIQIKQQQEAREQAESRGEHFTSISTEIINRPAYCDFILAQIKATSFLAYVFIRGYAPEFLQDYVNFVPDLIIRLLQDCPSELSSARKELLHATRHILSTN-YKKLFLPKLDYLFDERILIGNGFTMHETLRPLAYSTVADFIHNIRSELQLSEIEKTIKIYTGYLLDESLALTVQIMSAKLLLNLVERILKLGKENPQEAPRAKKLLMIIIDSYMNRFKTLNRQYDTIMKYYGRYETHKKE 498          

HSP 2 Score: 128.257 bits (321), Expect = 1.461e-27
Identity = 182/764 (23.82%), Postives = 340/764 (44.50%), Query Frame = 3
Query: 2028 PSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEAS-LHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVLS--CNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDI---MFAMLQSFRCKSEQVNRTAFKVLGKMGRYNR------CDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKS-----FIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCKYSCTESTDFN-DSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI--TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELH--PCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPA-VFKAYPMSKQIA 4250
            PS  ++A   D + +++ +  +F+ +  A F E+ + ++ ++ ER   +S ++ + Q  L+S        S   A ++L +L   ++ +G      S +  RLFK  F SV+      E VL  HL  ++L  +KY+ +A++P  +  L+R LFRSIGGG  E LYR   P+L ++L  L+ ++ +      R+L  ELC+ VPVRLS L P+L  LM+PLV  L    + +SQGLRTLELC+DN++ EY    + PV  D+   +F +LQ  +  +  ++    ++LGK+G  NR       DL E  ++  D+         + +    PED + L V   + +A+  L+  K +   ++ + + +     L +     F     + L + VN       K  ++ +    ++EP           + N+  Y   +N F       + L++S + + + +KE                   ++ + +D +  L+    +  +          +  FN D +  ++   + L++D+I   ++Y   +   +G +  +RI   + ++   E  ++ S +P     A++ I L +   +Y + GG   + +LI  +     +L  +  +   GL + + D      +    +  +  +LLI+        L  +     ++E +    +   L   VC+     L N N  VR      L  +S +TG  +  L+    H    +L P  A   +A P + QI 
Sbjct:  669 PSLPVSAT-KDARELMDYLAFMFMQMDNATFNEIIEQELPFVYERMLEDSGLLHVAQSFLTSE-----ITSPNFAGILLRFLKGKLKDLGNVDFNTSNVLIRLFKLSFMSVNLFPNINEVVLLPHLNDLILNSLKYSTTAEEPLVYFYLIRTLFRSIGGGRFENLYRSIKPILQVLLQSLNQMILTARLPHERELYVELCITVPVRLSVLAPYLPFLMKPLVFALQQYPDLVSQGLRTLELCIDNLTAEYFDPIIEPVIDDVSKALFNLLQP-QPFNHAISHNVVRILGKLGGRNRQFLKPPTDLTEKTELDIDAIA-------DFKINGMPED-VPLSVTPGIQSALNILQSYKSDIHYRKSAYKYLTCVLLLMTKSSAEFPTNYTELLKTAVN-----SIKLERIGIEKNFDLEP-----------TVNKRDYSNQENLF-------LRLLES-VFYATSIKE-------------------LKDDAMDLLNNLLDHFCLLQVNTTLLNKRNYNGTFNIDLKNPNFMLDSSLILDAIPFALSYYIPEVREVGVLAYKRIYEKSCLIYGEELALSHSFIP---ELAKQFIHLCYDETYYNKRGGVLGIKVLIDNVKSSSVFLKKYQYNLANGLLFVLKDTQ---SEAPSAITDSAEKLLID--------LLSITFADVKEEDLGNKVLENTLTDIVCE-----LSNANPKVRNACQKSLHTISNLTGIPIVKLMD---HSKQFLLSPIFAKPLRALPFTMQIG 1352          

HSP 3 Score: 125.176 bits (313), Expect = 1.439e-26
Identity = 156/730 (21.37%), Postives = 308/730 (42.19%), Query Frame = 3
Query: 8106 VNIQNILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAKLPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQGQYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNY-RYLKKISQWDSLDKFLNGENVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIHNNNV------FSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFD-------KLIHITANAATDS---SRVYR--NEIYLLLLELVRNGRKQHL-----SSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEGWRH-----SYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRD 10208
            + + N +  H  +   + ++   D + S++ + Y   +     +  +FPQ++  +     + +  V+  ++  LS P H + I   T N +   L++++K+ +     H     +LA S+N W+  I ++E      S            + N   IE+N      D  L L   Y  L+EED  +GLW  +     TE    +++ Q G +DKA ++   +  ++ + ++ Y         ++ N+ +  +K+  WD L +    E    L+  E  WR   W       + +  SV ++   R Q+   +  + N   S    ++V    +L +E  +++   L +W SLP     TP H  +L      +E  +  Q+++ +H   V        E+K ++++W++R P+  D  +  +D+V WR+  F         LI     + ++S   +  YR  +EI  ++       RK ++     S   ++Y       LP        +  QE  +K+ E+   H          L+++ N +   F   +  A+F+  K M  S     +EA + F  A+QID    K W+ +  F +   S  P      ++      AI+  ++AA   K           + K+   L + LWL+++DD+  +++   +    ++P    + +   ++T L   E   V  +LIR+A  +P+A++   R  ++
Sbjct: 2517 LELSNFVKGHIASMQGLCRIISSDFIDSLIEIFYQDPKAIHRAWVTLFPQVYKSIPKN--EKYGFVRS-IITLLSKPYHTRQISSRT-NVINMLLDSISKIESLELPPH--LVKYLAISYNAWYQSINILESIQSNTS------------IDNTKIIEANE-----DALLEL---YVNLQEEDMFYGLWRRRAKY--TETNIGLSYEQIGLWDKAQQLYEVAQVKARSGALPYSQ--SEYALWEDNWIQCAEKLQHWDVLTELAKHEGFTDLL-LECGWRVADWNSDRDALEQSVKSVMDVPTPRRQMFKTFLALQNFAESRKGDQEVR---KLCDEGIQLS---LIKWVSLP--IRYTPAHKWLLHGFQQYMEFLEATQIYANLHTTTVQNLDSKAQEIKRILQAWRDRLPNTWDDVNMWNDLVTWRQHAFQVINNAYLPLIPALQQSNSNSNINTHAYRGYHEIAWVINRFAHVARKHNMPDVCISQLARIYT------LP-------NIEIQEAFLKLREQAKCHYQNMNELTTGLDVISNTNLVYFGTVQK-AEFFTLKGMFLSKLRAYEEANQAFATAVQIDLNLAKAWAQWGFFNDRRLSEEPNNISFASN------AISCYLQAAGLYK-----------NSKIRELLCRILWLISIDDASGMLTNAFDSFRGEIPVWYWITFIPQLLTSLSHKEANMVRHILIRIAKSYPQALHFQLRTTKE 3176          
BLAST of Transformation/transcription domain-associated protein vs. TrEMBL
Match: E0VJQ2 (Transformation/transcription domain-associated protein, putative OS=Pediculus humanus subsp. corporis OX=121224 GN=8238793 PE=3 SV=1)

HSP 1 Score: 1289.25 bits (3335), Expect = 0.000e+0
Identity = 1062/3996 (26.58%), Postives = 1921/3996 (48.07%), Query Frame = 3
Query:  273 EFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGC--LVETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEHN-LVLPTLTLQDFKI-----LTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDG-----QLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAF---AFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCKYSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERITAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTXXXXXXXXXXXXSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRE--NYTLATNRQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVK-LFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTS---FNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYV--WKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNED-ADDIVAIFLNKLIDNQD--CGDGGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEEA----LTGLSAIG--------------------------------------QDKSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWG-PINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPLCDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIK-TNSQSEEVEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK-LPK--------QEEHFAPGIREKSELLVKLWGKY-HTWSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTI-NFKSFMPKINCKEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAKLPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTTEM-----QQSMAFAQQGQYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGE-NVNYLIKAESLWRKGQW---KDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGI----HNNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLI-HITA--NAATDSSRVYRNEIYLLLLELVRNGRKQHLS-----SCTKLYADKLKQQLPEM-VSNSFTLYKQE--CKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLIRELSYSDPSDSNNQSEEIKLYE--NVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYD--VLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQSKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHL-SEDAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMI 11885
            E +D FE    +  YP  L+   +   K L ++ P F+ E  LQQ+RKQ LE+   +P NE  + Y K  + +++KL+E ENEEN ++C+++++++HK  RP F++E+  FL+FV+++YK+L +H NKIF   P  ++  + E  IE+ +++T+TVT I T  K  + + I +N++PK   SLKV+QE+P+++VLMYQ +K  +  ++  FIPLIM  + L PS  Q+ +  FN+ +++DF+ AQ+KTLSFLAY+++ F++ L+ +++ S+V+GM  ++   P  V ++RKE  IAARHIL T +++ +FV  +  L NEDI +G G+T  + LRPLAYSTLADL+H V+  L L  + K  +++ KN+HDD++   IQ MS KLLLN ++ ++ R   +  +   GRELL+++L   V +  TISK  LP L   C    + N + P +  S+   ++    + +  KLP    + E     E +    PT   Q++ +     L K L+ G+KTIT  I S   +                + N    P          +  +Y  L+++ ++ +D+Y +           +  R PS   + +  +EK +LE    +F +++P  F E+F T I Y++ER   N  +      I+ +S   +P+ S+I A +++ YLLD ME +G    +++L+ +LFK +F SV       E +L  HL +IV   M+ A+SAK+P ++  LLR LFRSIGGG H+ LY+EFLPLLP +L GL+SL    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   ISQGLRTLELCVDN+ P++LY ++ PVR D+M A+ ++ R   +QV   AF+VLGK G  NR  ++E Q+++++   NQ  P I I F ++  D I+LPV +++ TA+  LK    +   +       +AW  ++ F+V                          + I+++           D  +  Q  F+  +F      +H P     S +  +++    D  + AL G+F+     ++R+  +  ++ +V+  T+ A+ +           F    K+S      +L+DS+   M +E+K+  + G + L  I     +   +K  A  +P+    ++R+  L ++ AWYA++GGC  + +L   +   W++DHL  FL+ L + + DL  ++  GA+ MAK  LE L+      I      +S    +E I      +K +  V   ++ ++   N  VR++A   L  L++I  + +  +++PH  V++D++PP   + + + ++ QI I+E N  F   +N       D+++  H+ F +E+ ++ E     DE I        P+T+  Q                       +QC +R   +Y                     Y+   ++K F  L++A+  +  E  + AF+C+Q F++ + +  E+    ++PLL T  +  N  L   ++LY   +LF A+F+E+ CE LL  + K++ V     +   KNG    EN++K   LI    +FH + AAS K+ + L  LVL+ E+ +   ++S  R+PL+ +L K P ET+  LFL        +     ++  +  KE K  R+ LQN P  LI+L+   S                NN T+   + V    ++II  L K +  W    + L +AL   WCS ++       D + + HW + + ++ +L  +  ++P   + LF + R+   R +     LR FL +  V +NY   WK++ F  ++ +  N   + ++   I   +++P F +  E      E  +L G P  P++D  D+IV++F+NK+ID ++       +R+   QF  L++E A  +IH + NK+QG K R ++TFAWP +  +    D   +Y G   ++++I+KF I+++I+++VF  L K + +E + V+  AL +L PA   R +D N ++ H TKK+ +++  +  QL HI  L+V+H  +YY  + H   L+Q+ I  +    F P    +Q++  +++ E+II+W++ R K+E+    +T   + G                                        K I     +++ N ++RL  Q+ DQS    +  +   RR + LL+ A  P +W  P +L +  L + F   +N+ +       N  + N+   L+ LT  L +M    IL ++K   K L   + +     S+ I+     L  ++L FP EP      ++  EL  LY+ + KF+ E  + YE+ PS+  S    + + L    + A  +  A++DR +   + +  ++  E I+ T+S     E LI +++++K+R   +G+DMR+  +  + V  I   +D K++K +   L  W+K  P         +E    P +REKS LLVKL       + D+A++  + L ++  V+ +  L+  + +   + AF  G+      +R K+ E +   ++R  L +R L+L+ +  W++       WI   +E++ +         + + KS +P I          +++  +++  I++ ++A+M  +  E    P       +L D  F  +  +  T +      ++ +  +Q I  Q ++  + V+++     L +   + +    L+  V+  +FP++W++L  +     + ++ E+V F+ +  H        P+ +  F+EA+++  N       S   +L  SHNLW    + +E         E      V +  +F+ I S     + +   SL+ +Y  L E+D   GLW +      T +     QQ      Q  Y+  +  S E  S +   S    +  + +K +    R  K+++QWD L ++ N   ++N  +  ES WR   W   KD +   ++ Q   +E+  W+ +L   Y   +N  +   +    +N   ++    K +   +++W+ LP+  I++  H+ +LQA    +E  +  Q+  G+     + +   ++K+++K+W+NR P  +D  S  SDI  WR+  +  +  H  +  + + + S +  +     ++   +  RK +L+     S +++Y       +P + + + F   +Q+  C ++M     ++   + LE++E+ + + F  K   A+FY  K ML +   + D+A + F  A+Q+     K W+++ D+LE +F+N        ++ + G+ AIT  + A             H  + K    LAK LWL+T DD +  + + L++ S  +P    LPW   ++TCL+R EGK +++++ ++   FP+AVY   R L   L  E      +++N       ++    ++   +  + + L  ++    Q+ W   +W E++L Q     ++     ++    ++ +  +P            H L  +    +   + I+N +   N     +   S+     VT      +     Q ++ +F+ DF  +   A  L   + KLKK WI +L+    +  K+  ++E+ R L    Q + ++ LPG+  + K   + + I+   P V+ V  +    RR+ IR  NG  + Y + +      S + D++ +          E++ Q+ R+LN  L K++E+  R L++  PR++ ++                 Q  +  +N   +SL DI+   C  + I+H       +  I    +   + Q        + P   +L  + +E  RN +P                KD A+  F+        DYW  RK      ++   ++Y+  ++ L  +   I      + +S  + ++ +    L+    +PFRL+PN+   +   G           PLTA  I
Sbjct:    2 ELTDNFEVILTSPHYPAFLEHSIKLFLKVLQESPPLFVSEYNLQQVRKQILEMIYLLPANEQLRPYVKQILTLMLKLLEIENEENVLVCLRIIIELHKQYRPQFNSEIQQFLQFVKSIYKDLPSHMNKIFEPKPIIKVKELTEIDIESMLVDTYTVTVIQTDNKTPDGSVISYNLIPKGVLSLKVLQELPIIVVLMYQLYKQNVQQDLTDFIPLIMSTITLQPSSQQRNNPLFNKEIFVDFMGAQIKTLSFLAYIIRVFQE-LVAQHSHSMVKGMLGLLQLCPMEVVHLRKELLIAARHILAT-DLRSKFVPYMEHLFNEDIWLGRGWTTRESLRPLAYSTLADLVHHVRQMLQLNDLDKVIHLFSKNVHDDSVPTCIQTMSCKLLLNLVDCVRCR---SENDNGRGRELLMRMLQVFVLKFKTISKLQLPFLMNKCKNQQQGNSQYPTSNSSQTNSQSGSEVKNEDQKLP----LSESGGTAEKSKFGFPTSQAQNYLVADCRSLVKTLVCGVKTITWGIASCKSISTEGV----------VVPNKQFHPK---------ETLVYISLVKWAMQALDIYTLNVNPSGGTFPHISPRVPSPQ-SVRTKEEKEVLEYFAGVFSSMAPQTFHEIFSTTIDYLVERIYRNYALQ-----IVGNSFLANPSTSSIFATILVEYLLDRMEEMGSNLEKSNLYLKLFKLVFGSVSLFPTENEQMLRPHLHQIVNRSMELAMSAKEPYNYFLLLRALFRSIGGGCHDLLYQEFLPLLPNLLQGLNSLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSHTLISQGLRTLELCVDNLQPDFLYDHIQPVRADLMQALWRTLRNPQDQVAHVAFRVLGKFGGGNRKMMIEPQKLEYNDVSNQR-PSIVIYFQDY-ADPIDLPVSKVIDTAMTALKTSTSDPFYRR------QAWEVIRYFLV--------------------------ASIQLQ-----------DKKSALQTLFSHPSFYDGNIASHHP-----SPIYKLTDNHSRDTHQVALTGMFVAAAIKELRQFVLPTMVAVVRHYTMVAIGQQAGPFAITGRKF----KLSGMDAL-VLIDSLVTIMGHEEKELCKPGHLALVLILETATTILGSKERACQLPLMEYLSERMCSLCYERAWYAKYGGCLAIKLLFERMAMKWVYDHLFVFLRALLFVMMDLTGEVSTGAIDMAKANLEKLLTVCATPI------ESNGSNEELINAQ---KKSLYDVTHELVRLVTGSNTLVRQQAMNSLTLLAKIQNKTVTEVMEPHREVLADMVPPRKHLLRHHAVNVQIGIMEGN-TFCTTLN-PRLFTIDLNIMEHKVFFHELMSLCE----ADENILVKYPCYKPLTNLVQL----------------------RQCALRALSSYH--------------------YIPNYREKIFNVLYRAL--EKPESQKVAFECMQNFIAGSKIDNEVVRGVMRPLLLTLGDYRNLNLNNTKRLYQLTKLFPATFNEKFCEQLLQHLKKLQEVAATTLKNISKNG----ENEQKIATLI---SIFHQIPAASPKFCEGLCRLVLQTEKSLSIEASSPFREPLLKFLLKYPQETINDLFLNDNIKDPQWSRFLQYL--IKHKEGKSFREVLQNNPGKLINLVTAVSQRT-------------NNWTTSEKYEVQFQGIRIISLLIKYDEQWLSCQRELVQALKDLWCSEQYHEHHREVDSVDFVHWKEPKLLVKILLHYFCHHPTEVDLLFHLLRATCERYIPDFQFLRDFL-ETTVAQNYTVEWKRSAFFRFVEEFQNPNMSQELKSKILQLVLIPCFAIGFER----GEGEKLVGSPVSPDQDNPDNIVSVFINKVIDPENPFGNTDAVRILLLQFSCLLVEQASPHIHNVLNKRQGQKLRRLMTFAWPCLLGK-NCVDPSTRYHGHLLLSHIIAKFAIHKRIVLQVFHSLLKAHAMEARAVVRQALEILTPAMPHRMEDGNTMLTHWTKKIIVEEGHNMQQLFHILQLVVKHYKVYYPVRHH---LLQHMIQSIQKMGFNPAATIDQKKLAVELAEVIIKWELERIKDESEGQEITTNPSTGAVKKTCPDDNQEQHRKRLATGNVTPTHFATFVPKVDPSSSKPIEKHHADAILNFLLRLACQVNDQSSAVGSQGELLSRRCVALLKMAMKPDLWPQPWDLKLAWLDKIF---INIESQ------NPNYGNICTALELLTFLLGVMKKEQILASIKPLQKGLAVCVTS---PSSKVIRLVHAFLAKLMLIFPTEPPASTVASKYEELECLYACIGKFVFEGLANYEKSPSASPSTLFGTLMIL----KAACVSNPAYIDRLITPFMRVLQRMHKEHIQATDSNPVATELLIVSLDLVKNRLGGMGSDMRKGFIGTVLVKLIEGTRDVKVMKAITKMLDEWIKNQPSTAINTQNVRESSPFPVLREKSILLVKLMTYVERNFPDDAELNAQFLEIVNYVYRDPVLKESELSTKLEPAFLQGLRCVQPQIRAKFFEIFDNSMKR-RLYDRLLYLVCSQNWEA--IGPHYWIKQCIELIFVTAVPTTQIQLSSAKSLLPSITSI-------IELGDASDKKIYD-VYASMKSELSEATESPESHENNDDL-DMEFNGTSGETSTKKEETPQSNRKAALMQLIARQ-SKFLDTVREIKTFHFLLATAQLCHMDTNLAERVWLDVFPRIWSMLSER---QRSTLQSEIVPFICSGAHEIQ-KDCQPSALNTFIEALSRC-NPPIPIRPSLMKYLGKSHNLWHRMTLNLEQLALEQGNVEVMRSRNV-DCYDFEPISSP----QQEVLDSLSEMYSCLCEQDMWAGLWQKHARYCQTNIAIASEQQGFFENAQSTYEMVMANSREDFSSTPAPSSLRSEYALWEKHW---IRCSKELNQWDILLEYGNSRGSINPFLVLESSWRIPNWNLMKDALI--QVEQICPKEL-VWKVEL---YKGFLNICSPDDAQHGQAN---IEKCVEKASASCMREWRRLPH--IVSHIHLPLLQAAQQIMELQEAAQIHQGLTHSRSSGSSLHDMKAIVKTWRNRLPVIADDLSHWSDIFTWRQHHYQFIASHYDSQHDQSVNHSMLGVHASAQAIIHFGKIARKHNLTGVCLGSLSRIYT------IPSVPIVDCFQKIRQQVKCYLQMSTVSGKNELQQGLEVIESTNLKYF-TKEMTAEFYALKGMLLAQIGRSDDANKAFSAAVQMHDTLVKAWALWGDYLEQIFTN------DFSNISYGVQAITCFLHAC-----------RHQNESKSRKYLAKVLWLLTYDDEEFSLVQALDKYSVGVPPIQWLPWIPQLLTCLVREEGKLILNLISQVGRIFPQAVYFPLRTLYLTLKIEQRERQSTETNPIRATPSMWRCSRIMHMQRDVHPTVLSCLEGMVDQMVWFRENWYEEVLRQSKQGLAKCYAIAFEKRGCVAEATITP------------HTLNFVKKLVSTFGIGIENINSSVNFTSSSAASESLARRAQVT------IQDPVFQRMKCQFTTDFDFTLPGATKLQNLIEKLKK-WIAVLQTKTKMLPKSILIEEKCRFLCNFNQQTAEIELPGEFLLPKHSHYFVKISRFMPRVDIVQKHNTAARRLYIRGHNGKVYPYLVVND-----SYIGDARRE----------ERVLQLLRMLNHYLGKQKETSSRFLHITVPRVVAVSP----------------QMRLVEDNPASISLHDIYKENCAKRAIDH-------DAPIARYYERLQNVQT-----AGVQPGHHILKEIFKEVQRNMVP------------KHMLKDWALQTFSST-----TDYWTFRKMFMLQLSLACFVEYIFHLTRLNPNMMYIHKDSGLVNVSYFKFNIDNASTDLDPNHPVPFRLTPNLTELISTIG--------VKGPLTACGI 3654          
BLAST of Transformation/transcription domain-associated protein vs. TrEMBL
Match: A0A232F8W5 (Uncharacterized protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_010076 PE=3 SV=1)

HSP 1 Score: 1281.54 bits (3315), Expect = 0.000e+0
Identity = 1086/4148 (26.18%), Postives = 1971/4148 (47.52%), Query Frame = 3
Query:  255 RLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKL---EKGCLVETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEHNLVLPTL-----TLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKD-GQLYQRP-PSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCKYSC--TESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERITAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNC----VHYDIDVDNHEKFINEIRNILETSTGTDEEINAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTXXXXXXXXXXXXSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLLVTKVKPVLDIL--YEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTSFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYV-WKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDA-DDIVAIFLNKLIDNQD--CGDGGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEEA---LTGLSAI------------------------------------------------GQDKSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWG-PINLNIESLSRYF-KIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPLCDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALY-LLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSE-IIKTNSQSEEV--EQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLPKQ-EEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTI-NFKSFMPKINCKEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDY-FTDQYSKNNPSKLSVNIQNILYQ--HNQT--WNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQST--PNPMTCFLEAVAKLPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPD------FFLSLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG---QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNY-RYLKKISQWD-SLDKFLNGENVNYLIKAESLWRKGQWKDIIQN-HKLNQNSVQE----IDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIHNNNVFS--EVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLI-HITANAATDSSRVYRNEIYLLLLELVRNG---RKQH-----LSSCTKLYADKLKQQLPEM-VSNSFTLYKQE--CKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL-------RDKLIRELSYSDPSDSNNQSE----------EIKLYENVLAQM--------KKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGML---------LDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFG-NSKALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLE---DIWHWYCNNKIEHLQSKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLSSASEQIYNRISTVGRMDD-DSITRDKIQNSLDPLNQALMKPSHQIW 12188
            +LKAAQE S+ FE    ++ YP  L  L +   K L + +P F+ E  +QQ+RK  LE+  ++P N+H + Y K  +++++KL+E ENEEN ++C+++++++HK  RP F+ E+ +FL+FV+++Y EL  +  KIF   P   +  + E  ++T + ETFT+T I +++K  + + + +N++PK+  SLKV+QE+P+++VLMYQ +K  +  +++ FIPLIM  + L PS   +    FN+ +++DF+ AQ+KTLSFLAY+++ ++  ++ +++  +V+GM  ++   P  V ++RKE  IAARHIL T +++ +FV  +  L +E++L+G+G+T  + LRPLAYSTLADL+H V+  L L+ +A+A +++ KN+HD +L  SIQ MS KLLLN +E I+ R   + +  N+GRELL+++L   V +  TI+K  +P L    K     T + +P T E                  P + ++ E+    +     P+      ++ D++ L K L+ G+KTIT    +                  G ++        + K     +  ++ +L+++ L+ +D+Y I     G L Q   P+     +  +EK +LE    +F  ++P  F+E+F T I Y++ER   N+ +      I+ +S   +PT S I A +++ YLL+ M+ +G     ++L+ RLFK +F SV       E++L  HL +IV   M+ A+SAK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY+++ PVR D+M A+ ++ R  ++QV   AF+VLGK G  NR  ++E Q+++++    +T P   + + + P   I+ PV++++ TA   LK    +   ++K   V+  +    +  +++ D+  +     +    K  K+P +             G +Y S +                                   ++ ++AL GLF+     ++R++ +  +  +V+  T+ A+A+     C   +S      + +       +L+D++   M +E+K+  + G + L  I     +   +K  A  +P+    A ++  L ++ AWYA+ GGC  +  L   +   W+ +HL  FL+ L + + DL  ++  GA+ MAK  LE ++   +N      V + G+ E    Q   +YE     V   ++  + + +  VRE+A A L+ L+ I  + +  +++PH  V++D++PP     K + +  Q A  +   + GN   C          D+    H+ F  E+  + E      E+IN                                   N+  C       Y  +   + L+ +A + L+   Y+  ++   F+ L+ A+   + E+ E AF+C+Q+F++   + +E  +A ++P+L T  ++  L+ N  ++L +  +LF ++FS  +CE LL    K + +++  ++   K G    EN++K   +I    +FH + AA+ K++  L  LV++ E+ +   ++S  R PL+ +L + PTET+ LFL   N  D  ++       +  KE KP RD L      LI ++   S     +NS         +S    + H A++I+  L K +  W     +L  AL + WC+ ++ +   + D + + HW + + I+ +L  +  ++P+  + LF + R+   R +     LR FL +   +   V WK++ F  ++ +    + +P++   I   II+P F V+ E      E I+L G  P P +D+ D++V++F+ K+ID ++       +R+A  Q   L++E A  YIH+ +NK+QG+K R ++TFAWP +  +    D + +Y G   ++++I+KF I++KI+++VF  L K + VE + V+  AL ++ PA   R +D   ++ H TKK+ +++  S  QL HI  L+VRH  +YY  + H   L+Q+ ++ +    F P    + RR  +++ E+II+W++ R K+EA    TG + +                                                G  K I     +++ N ++RL  Q+ D + T     +   RR + LL+ A  P VW    +L +  L + F  +E N  N          + N+   L+ +T  L +M    IL + K   + L   + N     ++ I+    +L  ++  FP EP+     +++ EL  LY TV KF+ +  + YE+     N++   S+LY  L M + A  N  +++DR +   + + H++  + +  T +++ +V  E LI +++++K+R  V+G DMR++ +  I V  I   +D K++K +   L+ WMK       + AP +REKS LLVK+       + D+ ++  + L ++  V+ +E L+  +  +  + AF +G+      +R K+ E +   +RR  L ER L++I +  WD+       WI   +E+L++         + N  + +P I     ++D     +           F   S   +E    P   ++ G++     K+ I D   ++      P +++   Q  L Q   NQ     + KK+    +L++   + +    LS  V+   FP+LWN+L     +    +K E+V F+ +     H+ Q    P+ +  F+EA+A   N       +   +L  SHNLW    + +E   +     E                ES+   ++PD         SL+ +Y LL EED   GLW +       E  Q+ A  QQG   Q   A  +++    Q   S+            ++ ++ R  K+++QWD  LD        N  +  ES WR   W  + +   ++ QN  +E    ++ +R  L  C+S            ED  +   ++      +G  +++W+ LP+  I++  H+ +LQA    +E  + MQ+  G+ +    S  ++K+++K+W+NR P  +D  S  SDI  WR+  +  +  H  ++  + +       ++     ++  G   RKQ+     L S +++Y       +P + + + F   +Q+  C ++M     ++   E LE++E+ + + F  K   A+FY  K ML S   + D+A + F  A+Q+     K W+++ D+LE++F+      R     + G+ AIT  +            S  H  + K    LAK LWL+T DD +  +   +++ +  +P    LPW   ++ CL+R EG  ++++L ++   FP+AVY S R L       + +  +    +   D  ++S           E+K    +   M        ++ + + L  ++    Q+ W   +W E++L Q+                        + L  C+ +   N G +         L+F        +N     NI   +        N+ +  R  + +     Q ++ +F +DF  N+    L+  L    K WI +L        K+  ++E+ R L+  +  + ++ LPG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y           LV++    G A      +E++ Q+ R LN  L K++E+ RR L+   PR++ ++ +   + +    M+ +   D+  + C  + +E    I  +Y  +++  +Q++             +   Q+L D  +L + + +++              S+ ++  +               A+ F     DYW  RK  T   ++    +Y++ ++ L      +      + I+  +  + +    L+    +PFRL+PNI+ FL  +G         S PLTAS IAT   L      I  ++RA+LRD  I  H     + +       +++  +L   ++ A   I +R++++   D  DS     +  +    N   M PS   W
Sbjct:   30 KLKAAQEMSENFEVIMCSTQYPAFLDHLMKNFLKILQEGKPHFISEYNIQQVRKLILEMIHRLPTNDHLRPYVKQILSLMLKLLETENEENILVCLRIIIELHKQYRPTFNPEIQHFLQFVKSIYSELPKNLPKIFEPRPPIRVKDLSEINLDTLLKETFTITPIQSEKKAADGSVLSYNLIPKAVLSLKVLQELPIIVVLMYQIYKQNVHQDVSDFIPLIMTTITLQPSPQHRASPAFNKEVFVDFMGAQIKTLSFLAYIIRIYQD-VVAQHSTMMVKGMLGLLSLCPMEVAHLRKELLIAARHILAT-DLRTKFVPHMERLFDEEVLLGHGWTTYESLRPLAYSTLADLVHHVRQLLPLSDLARAVHLFSKNVHDQSLPTSIQTMSCKLLLNLVECIRQR--SDAENSNQGRELLMRMLEVFVLKFKTITKLQMPILLNKAKQLPAPTIDTKPATAEDVK---------------PNIAELHEEKECTKTKFGFPSTHNQNCSVVDYRSLVKTLVCGVKTITWGCANCKS---------------GEVA--------QSKQFQPKETLVFIRLVKWALQALDIYTIGPPALGALAQSGRPAQPQTVRSKEEKEVLEHFSGVFSMMNPQTFQEIFSTTIDYMVERIFKNAALQ-----IVGNSFLANPTTSPIFATVLVEYLLERMDDMGSNVDRSNLYLRLFKLVFGSVSLFPAENEHMLRPHLHQIVNRSMELAMSAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLEGLNRLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSHTLVSQGLRTLELCVDNLQPDFLYEHIQPVRADLMQALWRTLRNPTDQVAHVAFRVLGKFGGGNRKMMIEPQKLEYND--RETNPPAIVAYFQEPSKGIDFPVEKVIETAFTALKSNTTDPFYRKKCWEVINCYL---AASLRLDDDRATLYKFFTHPSFKEGKIPHQQ------------GPHYKSLD-------------------------------TVARNVQQTALTGLFVAAAIKELRQSVLGTMFSIVRHYTMVAIAQQAGPFCLTNKSNRLQGQDPL-------VLIDALAVIMGHEEKELCKPGNLALVLILETATNILGSKERACQLPLMEYLADKMCSLCYERAWYAKLGGCMAIKFLFERMATKWVLNHLFVFLRALIFVMMDLTGEVSNGAIDMAKANLEKMLRVCVNP----GVQEPGNSELLEAQNKALYE-----VTHELVRQVTSPHTIVREQAMASLRLLAEIQNKTVTEVMEPHKEVLADMIPP-----KKHLLRHQPANAQIGLMDGNTF-CTTLSPRLFTIDLKTVEHKVFFEELLTLNEA-----EDIN----------------------------------LNRLPC-------YKSVPNLIPLRKSALRALAACHYIADKRQNIFEVLYAALEKPNTELQEAAFECMQKFIAGFQIDMESVHAIMRPMLLTLGDHRNLSLNCVKRLSYLTQLFPSTFSITLCEQLLQHLKKLLENLIQAHKGVSKTG----ENEQKIATIIG---IFHQIPAATPKFIDVLCRLVMQTEKSLLVEASSPFRMPLMKFLLRYPTETLNLFLNDNNIKDQQWSRYLEF-LIKHKEGKPFRDVLHKSTTRLITMLLAHSQ----INSNL------THSEKSELQHQAIRIVSVLIKFDEQWLSTQTQLVTALRQIWCNDDYHALHKKVDSVDFCHWKEPKLIVKILLHYFCHHPNDIDLLFQLLRATCGRYVPDFQFLRDFLENTVAQEYTVEWKRSAFFRFV-EHFPTSMSPELKAKIVQLIIIPCFAVSFEK----GEDIKLVGSTPVPYQDSPDNVVSVFITKIIDPENPLTATDCVRIALLQCSCLMVELASQYIHDAANKRQGNKLRRLMTFAWPCLLGK-NCVDPVTRYHGHLLLSHVIAKFAIHKKIVLQVFHSLLKAHAVEARNVVRQALEIITPAMPVRMEDGFKMLTHWTKKIIVEEGHSMQQLFHILQLVVRHYKVYYPVRHH---LVQHMVNSIQRLGFSPTATIDHRRLAVELAEVIIKWELHRIKDEAENVETGGTGVMTGNLKRSPSYEPEAKRMATQAGINQVAVAVTAAAASPGLLVTQKMEPGATKPIERAHADAILNFLLRLACQVNDTTTTQGNPGEQLSRRCVALLKMALKPDVWPQSCDLKLGWLDKVFASVETNQPN----------YGNICTALELVTFLLGVMKREQILASFKPLQRGLGACIAN---TNAKVIRLVHGLLSRLMTIFPTEPTTSTVASKHEELETLYGTVGKFVIDGLAAYEK-----NASAQTSSLYGTLMMLKAACTNNQSYIDRIISPFMRVLHRMAKDHLHPTQTENNQVGSELLIMSLDLVKNRVAVMGVDMRKSFIGSILVGLIEKTQDIKVMKAITKMLEEWMKNKSPVAVNQAPSLREKSILLVKMMQYVEKRFPDDLELNGQFLELVNYVYRDETLKSSELTSKLEPAFLSGLRCIQPHIRAKFFEVFDGSMRR-RLHERLLYIICSQSWDA--MGPHYWIKQCIELLIVTANSTTQVQMSNQDTLLPSITSLINNVDSEEQKS-----------FLMYSMVKEE----PQDMMESGDV-----KDDIMDMDLSNIDPVTAPEEVTTGTQTTLAQLIANQAEFLEQSKKIRTEQLLNAAAQLCHMDTNLSERVWLDTFPRLWNILDEHQQN---TLKTEIVPFVCS---GTHVIQKDCHPSAIATFVEALAHC-NLPVPMRPALMKYLGRSHNLWHRMTLSLEQMAFENGNNEIKAKR-----------ESDCYDFEPDNSPHTEVLDSLSDMYSLLCEEDMWSGLWQKHAHY--KETLQATALEQQGFFEQAQNAYDLAMTKFKQDYVSTPAPFKAQREALLWEHHWIRCAKELNQWDLLLDYGSKKAEKNPFLILESSWRIPNWSMMKEALAQVEQNCPKEMMWKVNLYRGFLAICHS------------ED-QHLSAVERYVELASGLCMREWRRLPH--IVSHIHLPLLQAAQQIMELQEAMQIHQGLLHGRSSSLHDMKAIVKTWRNRLPVIADDLSHWSDIFTWRQHHYTFIASHYESHQESQTPNHSMLGVHASAQAIIHFGKIARKQNLCGVCLDSLSRIYT------IPSVPIVDCFQKIRQQVKCYLQMASVSGKNELQEGLEVIESTNLKYFT-KEMTAEFYALKGMLLSQIGRSDDANKAFSAAVQLHDTLVKAWALWGDYLESIFT------RDARQISIGVSAITCFLH-----------SCRHQNESKSRKYLAKVLWLLTYDDEKSSLMDVVDKYAVGVPPIQWLPWIPQLLMCLVRYEGNVILNLLSQVGRMFPQAVYFSIRTLYLTLKIEQRERFKSTELAKGHDGGDRSASGAQQAQQQQEVKAKATIPMWMCSKIMHIQREIHPTILSSLEGIVDQMVWFRETWYEEVLRQL-----------------------RQGLAKCYAIAFENRGAVSEATITPHTLNFVKKLVSTFENISSSQNITNTF----GSAGNESLARRAQATVQDPDFQKMKSQFISDFDFNTPGARLLHNLISKFKKWIKILEGKTKQLPKSFLIEEKCRFLSNFSLKTAEVELPGEFLLPKHSHYYVKIARFMPRVEVVQRHNTAARRLHIRGHNGRLYPY-----------LVVNDAGLGDA----RREERVLQLLRFLNHYLAKQKETSRRFLHFTVPRVVAVSPQMRLVEDNPASMSLL---DIYKQGCAKLGIEHDAPIARYY--DRLATVQAR-----------GTQASHQVLRD--ILKEVQDSMV--------------SRTMLRAWA--------------AKTFPAA-TDYWTFRKMFTLQLSLACFAEYVLHLTRLNPDMMYVHQDSGLINIAYFKFDVDDTSGELDANRPVPFRLTPNILEFLTTTG--------VSGPLTASAIATARCLVQPSFKIHTILRAILRDEVIADHSKKQEDSKNTAEGPTDMKAELLITMVTRAVSAIVSRLNSLAHFDGTDSKVSTLVAAANSDDNLCRMDPSWHPW 3790          
BLAST of Transformation/transcription domain-associated protein vs. TrEMBL
Match: E9FRG7 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_300174 PE=3 SV=1)

HSP 1 Score: 1261.51 bits (3263), Expect = 0.000e+0
Identity = 1092/4160 (26.25%), Postives = 1949/4160 (46.85%), Query Frame = 3
Query:  231 DDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPE---HNLVL----------------PTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCKYSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI--TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDE--RIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTXXXXXXXXXXXXSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLLVTKVKPVLDILYEKFDKNG--FIDTENDE-----------KFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTSFNVH--HFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYV--WKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNED-ADDIVAIFLNKLI--DNQDCGDGGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEEALTG------------LSAIGQD-----------------------KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFK-----IELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPLCDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSE--IIKTNSQSEEV------------EQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLPKQ-EEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLL-DIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLS-VNIQNILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAKLPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQGQYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDF--------NYRYL--------KKISQWDSLDKF-LNGENVNYLIKAESLWRKGQW---KDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIHNN--NVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLI-HITANAATDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQ--QLPEM-VSNSFTLYKQE--CKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLI---RELSYSDPSDSNNQSEE----IKLYE------NVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTD-----------ASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQSKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIK-FAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDM-YSAELENCILEKWLSSASEQIYNRISTVGRMDDDS---ITRDKIQNSLDPLNQALMKPSHQIWI 12191
            D   + + +LKAAQE S+  E    +  YP  L    +   K L  +EP F+ E  +QQ+RK  LE+F ++P NEH + Y K  +N++ +L+E ENE+N +IC+++++++HK  RP +S E+  FL+FV+ +Y++L N  NKIF      ++  + E  IE  + ETFT T + T+ +  + N I +N++PK   SLKV+QE+P+++VLMYQ +K  +  ++A FIPLIM  + L PS   K +  FN+ +++DF+ AQ+KTLSFLAY+++ +++ + ++ A  +V+G+  ++   P  V ++RKE  IA+RHIL T +++  F+  +  L +E++L G G+T N+ LRPLAYSTLADL+H V+  L +  +A+A +++ KN+HD++L  SIQ MS KLLLN +E I+ R   +  E   GRELLI++L   V +  +I K  LP L      + N     T  +E       +  ++    P+         KPE    +LVL                P  ++ + + L K L+ G+KTIT    +    + +T+SV          +  ++QP          +  I+ +L+++ ++ +D+Y +        +   +  + +K  +EK +LE    +F  ++P  FKEVF T I Y++ER   NS +      ++++S   +P+ SA+ A +++ YLL++ME +G     ++L+ +LFK +F SV       E +L+ HL  IV   M+ ALSAK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L  L+SL    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY+++ PVR ++M A+ ++ R  ++Q+   AF+VLGK G  NR  ++E Q++  D W  ++GP I I F E  +  ++LPV++I+ TA   LK     + S E   R  + W  ++ F++       S++++    +T  R +   S +E +                                 ++ + S     S+ +   + ++A+  +F+     ++R+  +  ++ LV+  T+ A+ +              ++++       +LVD++   M +E+K+  + G + L  +  TA I+  S+ +  A  +P+    A+R+  L +  AWYA+ GGC  +  L   +   W+ +H   FLK L + + DL  ++  GA+ MAK  LE           K+ +L +    D     +I +  +K +  V   ++  + + N  VRE+A  +LQ L+RIT +    +++PH  V++D++PP   + +  P++ QI +++ N  F   +        D+++  H+ F +E+ ++ E     D+ +                +P   S SN+     S             AC Y                          +DK    +FKA+   + E+ ETAF C+++ L  T + +E  +  ++PLL    +  +L+TN   +L    +LF   F+E++CE LL   ++  L+++   F   G   + T+              +  + I  + LFH + AAS ++++ L +LVL+ E+ +     S  R+PLI +L + PTET+ L L+     D  +        +   E KP RD ++     L++ +                  +P+ ST+   H     V+I+  +   +  W      L   L K WCS  ++ +  +   +  +   +   +  +L  +   +P+  E LF + R+   R +   + L++FL +  V ++Y   WK+  F  ++    N     ++   I  +II+P F V+ E      E   L G PP P++D ++ +V++F+NK+I  DN       +R+   Q   L++E A  +IH+ +NK+QG+K R ++TFAWP + ++    D   +Y G   ++++I+KF I+++I+++VF  L K + VE + V+  AL +L PA   R +D N ++ H TKK+ +++  + +QL HI  L+VRH  +YY  + H   L+QY I+ +    F P    E ++  +++ E++++W++ R K+EA +G            +   G D                       K I     +++AN ++RL  Q+ D + T +++ +   +R + LL+ A  P VW    L +    R F+            +         F N+   LD LT  L ++    IL   K   + L  ++N       + I+    +L  ++  FP EP+N    +++ EL  LY+ V K I E    YE+  ++P++    S L  L + + A  N   ++DR +   +    ++  E  I  TN +                E LI +++++K+R  V+G +MR+  +  I V  +    ++K+++ ++  L  WMK       +  P +REKS LLVK+       + D+ ++    L ++  V+  E L+  +  +  + AF  G+       R K+ +     +RR  L +R L+++ +  W++       WI   LE++L+  +      T    + +P +      +    D +     S+   I        D  AH     +K  + +D    N+  D  T       PS ++   +  ++ +  +     K+V     L +V  +++    L+  ++  +FP++W +L  +     ++   E+V FL +  H        P+ +  F EA++      +        +L  SHNLW    +++E   +  +    +       +     +E   + ++ +   +L+ +Y  L+EED   GLW  +  L  T +   +A+ QQG +++A              + E     +RQ+F +          YR L        K+++QW+ L +F L+ E +NY +  ES WR   W   +D +   +L Q   +E   W+  L   +  + +     P+         ++      +   +++W+ LP   I++  H+T LQA    VE  +  Q+  G+  +      +VK+++K+W+NR P  +D  S  SD+  WR+  +  ++ H    +   +S      ++     ++  G+     + T +  D L +   +P + + + F   +Q+  C ++      ++   E LE++E+ + + F  K   A+ Y  K ML +   + D+A + F  A+Q+     K W+++ D LE VF+      +   +   G+ AIT  + A             H  + K    LAK LWL+T DD +L ++  L++    +P    LPW   ++ CL+R EGK V+++L ++   FP+AVY   R L   L    RE   S    +N  S E    IK  E       ++   +  + + L  ++    Q+ W   +W E++L Q+                        + L  C+ +   N G + + +             A+  I  E    NI    S   S   ++ +  R  +       Q ++ +FS DF  +   A+ L   ++KLKK WI +L     L  ++  ++E+ R L+     + ++ LPG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y           LV++    G A      +E++ Q+ R+LN  LNK +E+ +R LN   PR++ ++                 Q  +  +N    +L DI+   C  + IEH                         D+ +    E+ L T     + R +    + + + +  + Q      +++ +A V       YW  RK LT   A++N+ +Y++ ++ L A    I      L +S  +  + + +  L+    +PFRL+PN+V FL   G         + PLTASMIA    L      + A+++A+LRD  I WHK    + ++KD   S ++E  IL   ++ A   I NR+  +   D +     T     NS D  N   M P+   W+
Sbjct:   28 DPGAKDENKLKAAQELSENLEVIVSSPQYPAFLDHAMKNFLKILQDSEPLFIAEYNIQQVRKLILEMFHRLPTNEHLRPYVKQSLNLMFRLLERENEDNVLICLRIIIELHKQYRPQYSVEIQTFLQFVKGIYRDLPNQLNKIFEPRSPIKVKDLSELNIEAVLAETFTATVVLTETRTPDGNNISYNLIPKGVLSLKVLQELPIIVVLMYQLYKHNVHQDVAEFIPLIMTTITLQPSAQHKANPAFNKEIFVDFIGAQIKTLSFLAYIIRIYQEAVAQQ-ATLMVKGILGLLSLCPMEVAHLRKELLIASRHILAT-DLRLHFIPFMERLFDENLLFGKGWTTNESLRPLAYSTLADLVHHVRQHLPMLDLARAVHLFSKNVHDESLPTSIQTMSCKLLLNLVECIRQR---SDVENGPGRELLIEMLEVFVLKFKSIVKLQLPILAGTKNKQDNSGTNATPSTEPPSSPSLSWSQNGAAPPSSSPSSANETKPEDTRSSLVLLDEKEKTMKFAVRVAGPVFSITECRSLVKTLVCGVKTITWGCAACKTPLDTTTSV--------ATTGKNLQPK---------ETVIFIRLVQWAMKALDVYALNIPSAVGAETSGTQTIRSK--EEKEVLEHFAGVFAMMNPQTFKEVFATTIDYVVERIYRNSALQ-----VVANSFLANPSTSAVFATILVEYLLNHMEEMGLNMERSNLYLKLFKLVFGSVSLFAAENEQMLKPHLPHIVNKSMELALSAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQSLNSLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSSLNGSQTLVSQGLRTLELCVDNLQPDFLYEHIQPVRAELMQALWRTLRNPNDQIAHVAFRVLGKFGGGNRKMMVEPQRL--DYWDKESGPCIVIHFQELKQP-VSLPVEKIMETAFSALK-----SSSTEPFYR-TQCWEVVRCFLL-------SSLHLDDDRLTMQRLLSHHSFLEGD---------------------------------IHPVQSPSFQCSDKQARHVHQTAVTAMFVAAAIKELRQAVLPTMVSLVRHYTLVAVVQQAG-PFPMLVPGRSAQRILGMD-PLVLVDALATIMGHEEKELCKPGHLALVLMLDTASIVLGSQER--ACKLPLMEYLAERMCSLCYDRAWYAKLGGCIAIKFLFERMAFKWVLEHQYVFLKALLFVMMDLTGEVSSGAIDMAKANLE-----------KMLLLCATPLPDSSPSPEILSAQKKSLHDVTHELVRQVTSPNSTVREQAMHLLQVLARITNQTPTAIMEPHKEVLADMIPPKKHLLRHQPVNAQIGLMDGNT-FCTTLK-PRLFTIDLNIVEHKVFFHELLSLCE----VDDTV-------------LLKLPCYKSVSNLTPLRKSA-------LQALAACHYITQC----------------------RDKILNVIFKALSCNNAELQETAFSCMKKILVGTQIEMETVHTAVRPLLLLLGDYRSLSTNVILRLSHTTQLFPHVFNEKLCEQLL-QHLRKWLEVVIVAFKTGGNRPVATQTSHGPFSSSSLCSNEVKVAIGIIGLFHQIPAASARFLEILCKLVLQTERALGLEPGSPFREPLIKFLLRYPTETIDLLLREDIIADADWNRFLE-HFVRHSEGKPFRDAIKANTNRLVNFV---------------LGGLPSESTTPKPHALQVTVRILRIMICKDDQWISEQPDLITVLTKAWCSGRYEEK--KTTSLSIAERKEQRQLAKILLYYFQQHPEEVELLFHLMRALCDRTIPDFYFLKEFL-EKTVGQSYGADWKRASFFKFVELFRNPNLGQELKAKILQHIIIPGFAVSFER----GEGEILIGTPPTPDQDNSESVVSVFINKVIDPDNPFGTSDAVRILLLQLSCLLVEQASQHIHDAANKRQGNKLRRLMTFAWPCLLSK-NCVDPTTRYHGHLLLSHIIAKFAIHKRIVLQVFHSLLKAHAVEARNVVRQALEILTPAMPLRMEDGNTMLTHWTKKIIVEEGHTIAQLVHILQLLVRHYKVYYPVRHH---LVQYMITSIQRLGFTPTATLEHKKLAVELAEVVLKWELQRMKDEADSGGESCDETMPSGSVKRSGNDGLPEAKKPRLASSSSSGKILEVSKPIEKTHCDAIANFLLRLACQVNDATSTANSSGEQLSKRCVALLKMALKPDVWPNCELKLAWFDRLFQTADSPAAATAAASAAAAASAPNFTNICTALDLLTFLLSILRKEQILAGFKPLQRGLSSLMN---CTNPKVIRCLHGLLSRLMSVFPTEPTNSNVASKHEELEGLYAAVTKAIYEGLGAYERNTTAPST----SLLGTLMLLKAACTNNPCYIDRLITSFMRALQRMTREHLIPATNDRQANATTTVPESGFSSCELLILSLDLVKNRVGVMGVEMRKAFIGSILVGLLEKSSESKVVRSIVRMLDEWMKTKTPIAINQGPSLREKSILLVKMMQCLEKRFPDDVELNIAFLELINFVYCEESLKGSELVSKLEPAFLAGLRCPQPATRAKFFQVLDTSMRR-RLHDRLLYIVCSQNWEA--ISAHYWIKQCLELILVTSVSGTPIHTAPASALLPGVT----SVIATADASERETFSVAGNIKEEPEELLDVFAH-----VKEDD-IDMDLSNAPNDPLT-------PSGMNKTGLATLVNRQVKFLESGKEVTSSQFLEAVAQLAHMDTSLAEVLWLDLFPRIWKVLGERQQQALSV---ELVPFLCSGAHVIQ-KDCQPSAINTFAEALSLCSPPIR-IKPCLLKYLGKSHNLWHRMTLMLEQLAFDTANSPAHTKVKQKEIGAEYDLEPGALSHQ-ETLDALSEMYSTLKEEDLWSGLWQRRAHLPETII--GVAYEQQGFFEQA------------QGTYELAMTKVRQEFINTPAPVSLQSEYRLLEEHWIRCGKELNQWELLQEFGLSPECLNYQLVLESAWRTPNWVVVRDALT--QLEQACPKEY-AWKVNLYRGFLAMCHPEEQHPN--------MVERYVELASSLCIREWRRLP--AIVSHVHLTTLQAAQQVVELQEAAQIHQGLLQSRPGTLHDVKAIVKTWRNRLPVIADDLSHWSDVFTWRQHHYQFIVSHYDQQSDQQASAQSMLGVHASAQAIIHFGKVARKHNLTGVCLDSLARIYSIPSVPIVDCFQKIRQQVKCYLQAANVLGKNELQEGLEVIESTNLKYFA-KEMTAELYALKGMLLAQIGRADDANKAFSAAVQMHDTLVKAWALWGDHLEQVFT------KDSRNIGIGVSAITCFLHAC-----------RHQNESKSRKYLAKVLWLLTYDDDKLSLAESLDKYCVGVPPVQWLPWIPQLLVCLVRDEGKLVLNLLSQVGRMFPQAVYFPIRTLYLTLKIEQRERYKSAELAANQASTETTGPIKATEPMWRCSRIMHMQRDLHPTVLSSLEGIVDQMVWFRENWYEEVLRQL-----------------------RQGLAKCYAIAFENRGSVAEATITPHTLSFVKKLVATFGIGIE----NIANSASGSFSSAASESLARRAQATAQDPVFQRMKTQFSTDFDFTLPGAMKLHNLIHKLKK-WIKILEAKTKLLPRSFLIEEKCRFLSNFNLQTAEVELPGEFLLPKHTHYYVRIARFLPRVEIVQKHNTAARRLYIRGHNGKIYPY-----------LVVNDAGLGDA----RREERVLQLLRMLNNYLNKHKETSKRFLNFTVPRVVAVSP----------------QMRLVEDNPSSATLLDIYRLRCVKRNIEH-------------------------DMPIAKYYER-LATI----QARGSQASHQVLRDIHKDVQQIMVPRTLLREWANVTFPSATFYWTFRKMLTLQMALVNLAEYVLHLTRLNADMLYIHQDSGLLSVSYFKFDVEDSNGELDANRPVPFRLTPNMVEFLTMIG--------VAGPLTASMIAAARCLVQPSVKVAAILKAVLRDEMIAWHKKKTADEKEKDTGGSGQVEGEILIGLVNKAVNAIINRLQGLSTFDGNESKVSTLVAAANSND--NLCRMDPAWHPWL 3841          
BLAST of Transformation/transcription domain-associated protein vs. TrEMBL
Match: E2BLG5 (Transformation/transcription domain-associated protein OS=Harpegnathos saltator OX=610380 GN=EAI_15453 PE=3 SV=1)

HSP 1 Score: 1258.05 bits (3254), Expect = 0.000e+0
Identity = 1090/4156 (26.23%), Postives = 1960/4156 (47.16%), Query Frame = 3
Query:  231 DDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEH----NLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRP--PSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVLSCN--TISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAW--AFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK-YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERITAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTXXXXXXXXXXXXSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLLVTKVKPVLDILYEKFDKNGFIDT-ENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECL-DLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTSFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYV-WKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNED-ADDIVAIFLNKLID------NQDCGDGGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDI-RTKEEALTGLSAIGQDKSISDQQKE----------------------------------------SLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPI-NLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPLCDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEE----VEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLPKQ-EEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLL------------------------LDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEA-------VAKLPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSE----KCALLTTEMQQSMAFAQ-QGQYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGENV-NYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIHNNNVFS--EVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLI-HITANAATDSSRVYRN-EIYLLLLELVRNG---RKQH-----LSSCTKLYADKLKQQLPEM-VSNSFTLYKQ--ECKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKLIRELSYSDPSDSNNQSEEIKLYENVLAQMKKSNG------------------------SKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNIN--RLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNSKALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLED---IWHWYCNNKIEHLQSKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLSSASEQIYNRISTVGRMDD-DSITRDKIQNSLDPLNQALMKPSHQIWI 12191
            D   + +L+LKAAQE S+ FE    ++ YP  L  + +   K L + EP F+ E  +QQ+RK  LE+  ++P NE+ + Y +  + ++ KL+E +NEEN ++C+++++++HK  +P F+ E+  FL+FV++VY EL  +  KIF   P   +  + E  IE  + ETFT+T I +++K  +   + +N++PK+  SLKV+QE+P+++VLM Q +K  +  +++ FIP+++  ++L PS   +    FN+ +++DF+ AQ+KTLSFLAYV++ +++ ++ +++  LV+G+  +    P  V ++RKE  IA+RHIL T +++ +F+  +    NE+I IG+G+T  + LRPLAYSTLADL+H V+  L L+ ++ A ++Y KN+ D +L  ++Q +S KLL+N ++ ++ R   + +   +GRELL++IL   V +   +SK Y+P L        N+ + +   +       E T ++ ++L      +EK +        N  + +  + D++ L K L+HG K IT    +S                  T SN  +QP          +  IY +L+++ L  +D+Y I         +P  P+ A   +  +EK +LE+ G IF  ++P  F+E+F   + Y++ER   NS +  +    LSS     PT S+  A +++ YLL+ M  +G     ++L+ RLFK +F SV       E++L  HL ++V   M+ A+SAK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP ML GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L+ +   +SQGLRTLELCVDN+ P++LY+++ PVR D+M A+ +     ++Q +  AF+VLGK G  NR  ++E Q++Q++  +  + P + I + + P+   +  +++++ TA   LK    +   +++   VV  +  A L+      +D++G N+    F+   F++           GE  +   +       QYK  D                           D+ ++A+  LFI     ++R   I  VI +V+  T+ A+A+    +S TE       +         +LVD++   M++E+KD  R+  + L  I         +K  A  +PI    A R+  L ++ AWY + GGC  +  L   +   W+ DH   FL+ L + + DL  ++  GA+ MAKT L+ +I   ++           S ++   ++     K +  V + ++  + + +  VRE+A A L+QL+ I  + +  +++PH  V++D++PP   + +  P + QI +++    F   +N       D+ V  H+ F  E+  + E                                               ++  + +   Y  ++  + L+ +A + L+   Y+   ++K F  L+KA+   + E+ E AF+C++ F+S   V +EL +  ++P+L T  ++  L+ N  ++L +  +LF ++FS  +CE LL    K + +++     + G + T EN++K   +I    +FH + AA+ K++  L  LVL  E+ +    +S  R PL+ +L + P +T+ LFL            + ++E L   K+ KPIRD L N    L+ ++   S  +  +   E  +          + + A+KII  L + +  W     +L  AL + WC+ ++Q+   + + + Y HW + + I+ +L  +    P+  + LF + R+   R +     LR FL +   +   V WK++ F  ++        + ++   +   II+P F V+ E      E  +L GG P P +D  +++V++F++K+ID      + DC    +R++  QF  L++E A  +IH+++NK+QG+K R ++TFAWP +  +    D   +Y G   ++++I+KF I+++I+++VF  L K + V+ + V+  AL +L P+   R +D N ++ H TKK+ +++  S  QL HI  L+VRH  +YY  + H   L+Q+ ++ +    F P    E R+  +++ E+II+W++ R KEEA       G   S S  +++                                        ++ N ++RL  Q+ D S  +    +   +R + LL+    P +W  + +L +  L +       V  +V + Q N  + N+   LD LT  L +M    IL + K   + +   + +   + ++ I+    +L  ++  FPAEP++    +++ EL  LY+ V +FI +  + YE+  ++  S    S    L M + A  N   ++DR +   + + H++  E + +++Q+E      E LI +++++K+R  V+GA+MR++ +  I V  I   +D K++K +   L+ WMK       +  P +REK+ LL K+       + D+ ++ R+ L ++  ++ +E L+  D NN  + AF +G+      VR K+ E  L+      L ER +++IS   W++       WI   +E++L                        + + +D D     K+FM     KEE +D    V  +    +     +NMS     T            + D M ++S+ D    Q S                       + KK+    +L +V+ + +    L+  V+  IFP+LW++L   +  + T    E+V F+++  H        P+ +  FLEA       VA  P   K        +L  SHN+W    + +E   +   +P+   Y    N       +       P+  + +L  +Y LL EED   G+W +    K  L    +QQ   F Q QG YD  +    +    + +     K++VM    +    R  K+++QWD L ++   ++  +  +  ES WR   W  + +   L +++  +   W+  +   +  I N      S E   N   ++      +   +++W+ LP+  +I+  H+ +LQA    +E  +  Q+  G+      S  ++K+++K+W+NR P  +D  S  SDI  WR+  ++ +  H  +      +  +    ++  +  ++  G   RKQ+     L S +K+Y       +P + + + F   +Q  +C ++M   G ++   E L+++E  D  R+  K   A+FY  K +L S   + D+A + F  A+Q+     K W+++ D+LE +F+      R     + GI AIT  + AA            H  + K    +AK +WL+T DD +  +   L++ S  +PA   LPW   ++  L+R EG  ++++L ++   FP+AVY S R L        R++   EL+     +S   S+E +   N   Q     G                        + L  ++    Q+ W   +W E++L Q+    ++     ++   S S  +          +  H L  +    +   + I+N     N +     S  L+    D V       +  ++  D       DF    A  L   ++KLKK WI +L        ++  ++E+ R L+  +  + ++ LPG+  + +   + + IA   P VE V  +    RR+RIR  NG  + Y           LV++  + G A      +E++ Q+ R+LN  L K++E+ RR L+   PRL+ ++     +R V      +   DV  + C  + +E    I  +Y   K+  +Q++                  I    +VL D  K + + M          +SK ++          KD A   F      G  DYW  RK  T   ++    +Y++ ++ L      +      + I+  +  + +    L+    +PFRL+PNI  F+  +G         S PLTAS IAT   L      + A++RA+LRD  I  HK    + E       +L+  +L K ++ A   I +R++++   D  DS     +  +    N   M PS   W+
Sbjct:   21 DPVSKDELKLKAAQELSENFEIIMCSTQYPAFLDHMMKIFLKILQEGEPHFISEYNIQQVRKLILEMIHRLPSNEYLRPYVRQILTLISKLLETDNEENVLVCLRIIIELHKQYKPTFNPEIQYFLQFVKSVYSELPKNLPKIFEPRPPLRVKDLSEINIEALLKETFTITAIQSEKKAADGTVLTYNLIPKAVMSLKVLQELPIIVVLMNQLYKQNVHQDVSDFIPIVITTISLQPSPQHRASPGFNKEVFVDFMGAQIKTLSFLAYVIRVYQE-VITQHSQMLVKGILGLFTLCPMEVAHLRKELVIASRHILAT-DLRNQFIPHMEYFFNENIFIGHGWTTQEALRPLAYSTLADLVHHVRLLLPLSDVSHAVHLYSKNLLDPSLPTTVQMVSCKLLMNLVDTVRQR--SDAENSTQGRELLMRILLVFVLKFKVLSKIYIPILR-------NKTKQLRANATADASATEDTLKNIVEL-----TEEKELGKSKFGFPNWQVMSYNVADYRNLVKSLVHGAKAITANCVNSR------------TGGEATQSN-QLQPK---------ETLIYIQLVKWALPALDIYTIGSTVVGTPVQPGRPAQAQTIRTREEKEVLELFGNIFTQMNPHTFQEIFSLSVDYMVERIFKNSALQIIGSAFLSS-----PTISSRFATILVQYLLERMNDMGSNVERSNLYLRLFKLVFGSVSLFPAENEHMLRPHLNQVVNRAMELAMSAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNMLEGLNRLQSGLHRQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSYCLVSQGLRTLELCVDNLQPDFLYEHIQPVRADLMQALWRILHNSTDQAH-VAFRVLGKFGGGNRKMMIEPQKLQYND-RETSSPTVVI-YLQGPKKPFDFSMEKVIETAYIALKSSTTDLYYRKQCCEVVNCYLAATLR------LDDVG-NILHKLFTHPSFQE-----------GEISFCHAS------SQYKCPDTV-----------------------ARDVQQTAVTSLFIAAETKELRPLVIGMVISIVRHYTMIAIAQQAGLFSWTERDIRMQGQD------PLVLVDALASIMSHEEKDLHRMAYLVLMLILDTATKILGSKERACRLPIIEYAADRMCMLCYERAWYTKLGGCIGIKFLTERMAIKWVLDHQFMFLRALIFVMMDLTDEVSNGAIDMAKTSLDRMIRICVDP----------SIQEGNAELLDARNKGVHDVTRELVRQVTSPHTIVREQAMASLRQLAEIQNKTVTEVMEPHKEVLADMIPPRKHLLRHQPANAQIGLMDGT-TFCTALN-PRLFTIDLKVAEHKVFFQELLGLCEA----------------------------------------------EETQLAKLSCYKSVTNLMPLRKSALRALAATHYISECREKIFAVLYKALEKSNGELQEAAFECMRTFISGFQVDMELVHTTMRPMLLTLGDHRNLSLNCVKRLSYLTQLFPSTFSITLCEQLLQHLKKLLENLIQ---SQKGILKTGENEQKITTIIG---IFHEIPAATPKFIDLLCRLVLHTEKTLLVEVSSPFRVPLMKFLLRYPADTLNLFLHD--NNIKDQQWSRYLEYLIKHKDGKPIRDILHNSTGRLVAMLLAHSQTNSNLTHMEKSE----------LQYRAIKIIALLIRFDEQWLSTQTQLVGALKRIWCNDDYQALHKKVENVEYYHWKEPKLIVKILLHYFRQQPNDIDLLFQLLRATCDRFVPDFQFLRDFLENTVAQEYTVEWKRSAFFRFVEHFPTNNLSQELKANVLQLIIIPCFAVSFER----GEGTKLVGGAPMPYQDNPENVVSVFISKIIDPDNPFGSADC----VRISLLQFSCLLVEQASQHIHDVTNKRQGNKLRRLMTFAWPCLLGK-NCVDPTTRYHGHLLLSHIIAKFAIHKRIVLQVFHSLLKAHAVDARNVVRQALEILTPSMPVRMEDGNTMLTHWTKKIIVEEGHSMQQLFHILQLVVRHYRVYYPVRHH---LVQHIVNSIQRLGFSPTATIEHRKLAVELAEVIIKWELYRIKEEAEVADGNSGNRSSASTLKRQVTSDDSTKRLANQSPSTSMCMPLTASKTESMKAIDRVHSDAILNFLLRLACQVNDVSSIHGNPGELLSKRCVNLLKMGLKPDIWTELCDLKLVWLDK-------VLTSVDSAQPN--YGNISTALDVLTFLLGVMKREQILASFKPLQRGISSCIAS---SNTKIIRLVHGLLSRLMTLFPAEPTSSNVCSKHEELDTLYTAVGRFIADGLTTYEKSTAATPS----SLFGTLMMLKAACTNNPNYIDRMITPFMRVLHRMAKEHLHSSTQAETNPVGSELLILSMDLVKNRVVVMGAEMRKSFIGTILVSLIEKTQDIKVMKAITKMLEEWMKSKSTIAMNQTPTLREKTILLCKMMQYVEKRFPDDLELNRQFLELVNYIYRDESLKSSDLNNKLEQAFLSGLRCVQPQVRAKFFEV-LDASMGKKLHERLVYIISIQNWEN--IGPHYWIKQCIELILASANPNAHIQMTNQDLLLPSITSIIHMGMDKD-NKEHKNFMAYCAVKEEPIDTSEPVNDAPEADLSEMDLSNMSISEFTT-----------TVDDIMAQSSLADMINKQKS--------------------FIERAKKIKTEQLLLAVVQLCHMDTNLAERVWLDIFPRLWSILDEHHQSLLT---AEVVPFIASGAHVIQ-KDCHPSALGTFLEALSHCSPSVAIKPYVMK--------YLGKSHNVWHRMTLTLEQMAF---EPDNITYVKGRNEPALYHEQPVPAEELPNETMDALADMYSLLLEEDMWSGIWQKHAYYKETLHAIALQQQGFFEQAQGAYDVVMTKFQQDWVSTPSPYKIQKEVVMIANQW---IRCAKELNQWDMLLEYSTTKDFRDPFVALESSWRISNWAVMKEALALVEHNCPKEMTWKVNMYRGFLAICN------SEEQHLNA--VERYVEIASSLCMREWRKLPH--VISHIHLPLLQAAQQIMELQEAAQIHQGLMLARATSLHDMKAIVKTWRNRLPVIADDLSHWSDIFAWRQQHYNFIANHYESQPDPHPTPTHSVLGVHASMQSIIHYGKIARKQNLYGVCLDSLSKIYT------IPSVPMIDCFQKVRQRVKCYMQMATMGGQNELQEGLDVIECTD-MRYFSKEMTAEFYALKGLLLSQLGRSDDANKAFSTAVQLHDTLVKAWALWGDYLEQIFA------RDARQISIGIAAITCFLHAA-----------RHQNETKSRKYIAKVIWLLTYDDDKSSLMETLDKYSVGVPAIQWLPWVPQLLMYLVRNEGNSILNLLSQVGRMFPQAVYFSIRTLYLTLKIEQRERYNSELTAGKIQES---SQEDRATGNASQQGASETGHTVRATAPMWRCSKIMHLQRDIHPTVLSSLEGIVDQMVWFRETWYEEVLRQLTQGLAKCYALAFENRGSVSEAT----------ITQHTLNFVKKLVSTFGIGIENISSSQNTSFYSAASESLARRAQDTVQDPVFHRMKGQFTSDF------DFTVPGARLLHNLISKLKK-WIKILEEKTKQLPRSFLIEEKCRFLSNFSLKTAEVELPGEFLIPRHSHYSVKIARFMPRVEVVQRHNTAARRLRIRGHNGRLYPY-----------LVVNDASVGDA----RREERVLQLLRMLNHYLAKQKETSRRFLHFTVPRLVAVS---PQMRLVEDNPAAVSLLDVFKQGCAKLGMEHDAPIARYY--EKLAAVQAR-----------------GIQASHQVLRDILKEVQSTM----------VSKTML----------KDWARKTFP-----GATDYWTFRKMFTLQLSLTCFAEYVLHLTRLNPDMMYMHQDSGLINIAYFKFDIDDISGELDANRPVPFRLTPNIYEFITTTG--------VSGPLTASAIATARCLVQPSYQLHAILRAILRDEVIAEHKR-QEDTESTSQTPTDLKGELLIKMVTHAVTAIISRLNSLANFDGIDSKVSTLVAAANSHDNLCRMDPSWHPWL 3795          
BLAST of Transformation/transcription domain-associated protein vs. TrEMBL
Match: A0A224YZY6 (Histone acetyltransferase saga trrap/tra1 component pi 3 kinase superfamily OS=Rhipicephalus zambeziensis OX=60191 PE=3 SV=1)

HSP 1 Score: 1247.26 bits (3226), Expect = 0.000e+0
Identity = 1068/4185 (25.52%), Postives = 1937/4185 (46.28%), Query Frame = 3
Query:  231 DDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKID------------FNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKL-----EKGCLVETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRPP---------------------------STALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIV---------KVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCKYSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERIT---AIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDER-IQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGN----CVHYDIDVDNHEKFINEIRNILETSTGTDEEINA-PIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTXXXXXXXXXXXXSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKP---LLTTFRENYTLATNRQLYFCARLFHASFSERMCESLLVTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTSFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYV-WKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDA-DDIVAIFLNKLIDNQD--CGDGGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDIR----------------TKEEALTGLSAIGQ--------DKSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPLCDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKT----------NSQSEEVEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLPKQEEHFA----PGIREKSELLVKLWG-KYHTWSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDS--RYFKLVNWIPTFLEVLLLDIKIDDDF-TINFKSFMPKINCKEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQST--PNPMTCFLEAVAKLPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQGQYDKALKISVESGSQSLNSSVEYKDIVMRQ---KFYDFNY-RYLKKISQWDSLDKFLNGEN-VNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGI--HNNNV-------FSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLI-HITANAATDSSRVYRNE------IYLLLLELVRNGRKQHLSSCTKLYADKLKQ--QLPEM-VSNSFTLYKQE--CKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDL-AKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKL-IRELSYSDPSD--SNNQSEEIKLYENVLAQMKKS----------------------------NGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSN--DFGNSKALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEH------LQSKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLSSASEQIYNRISTVGRMDD-DSITRDKIQNSLDPLNQALMKPSHQIWI 12191
            D A + + +LKA QE S+  E    +  YP  L        + L + +PQF+ E+ +QQLRK  LE+  ++P N+H + Y K  +N++ +L++ ENEEN ++C+++++++HK  RP F+ E+  FL+FV+ +Y+EL NH N IF   P  +   + E  ++  + ETFT+T +  ++K  + +               +N++P++  SLKV+ E+P+++VLMYQ +K  + +++A FIPLI+  + L P    + +  FN  +++DF+AAQ+KTLSFLAY+VK +++  +  +   L QGM  +++  P  V ++RKE  IAARHIL T +++ +FV  +  L +E+ILIG+G+T  + LRPLAYSTLADL+H V+  L L  ++ A  ++ +N+HD++L  SIQ MS KLLLN +E I+ R   + QE   GRELLI++L   V +  TI+K  LP L     ++G   E N                     D  +           +K E N    + T+ D + L K L+ G+KTIT  I +                  G +     QP          +  ++ +L++Y L+ +D+Y +          PP                            +A+ +K  +EK +L+  G +F  +SP+ F+EVF T I+Y++ER N NS +  +    L++        S I A +++ YLL+ ME +G    +++L+ +LFK +F SV       E +L+ HL RIV   M+ ALSA++P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   ISQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ + + AF+VLGK G  NR  L+E Q++++   ++  GP I + F +  +  I LPV +++ TA   LK      QS   S    + W  ++ F+V         + + +L S+ + G+  ++  + VP                          YK  D                       ++   + + AL G+F      ++    + F++ LV   T+ A+A+       ++     +          +LVD++   MA+E+K+  ++G + +  IT   A +L++ E    A  +P     A+R+  L +  AWYA+ GGC  +  L+  L   W+  H   FLK LF+ + DL  ++  GA+ MAK+ LE +    L   G  A L + + +D R +Q  +++E  +  V Q       + N CVR++A   L+ L+++ G ++  L++PH  V++D++PP   + +  P++ QI ++E N        C +        D+ V  H+ F +E+ ++ E     DE +   P   G      A  V    +      T H                                       YL   +++ F  L++A+ ++D E+ E AF+C+ +F++  N+ +E+ +  ++    LL  FR+  +L+  ++L +  +LF  +F+E++C+ LL   +   L++      +       N  +       + +FH + AA   +V+PL  LVL+ EQ++   ++S  + PL  +L + P   ++L L            N F+E L L++    R  LQ      ID + +  ++  P                  +   AV+I+  +A+  P +      L   L   W S  FQ+          + W + + +   L   +   P   E LF + R+F  R L     LR FL     K   V WK+  F  ++    + A+   +L  +   +++PAF  + E      E   L GGPP+P  D+ D+++++F+N++ID ++       +R+   QF  L++E A  +IH+ +NK+QG K R ++TFAWP +  +    D   KY G   +A++I+KF I+++I+++VF  L K + VE + V+  AL +L PA   R +D N ++ H TKK+ +++  + +QL H+  L+ RH  +YY  + H   L+Q+ +S +    F P    E ++  +D+ E++IRW+++                T EE+   L   G+        D+ I     ++L N ++R+  Q+ + S    +  +   RR + LL+TA  P VW    L    L+ + K+ + V +   N      + N+   L+ L   L ++    IL ++K   + +   +       S+ I+    +L  ++  FP+EP+     +++ EL  LY+++ K + E  + YE+ P++P S    +    L + + A  N   ++DR +   +++  K+  E +             S S   E LI +++++K+R  V+G +MR+  +  I V  I    D K+L+ +   +++W+   K +  FA    P +REKS LLVK+       + D  ++  + L ++  V+ +E L+  +  +  + AF  G+      +R K+ E +   +RR  L ER LF++ +  W++   +F    WI   +E++L    I+    +    + +P      + L+   D+ ++   ++          K + T     ++++  +       + + D      ++        N+Q ++ +  +    ++++ +G  L++ + + +    L+  ++Q + P+LW +L ++     +++  E+V FL +     H+ Q    PN +  F+EA+A+  N       +   +L  SHNLW    +++E               G         +             +L  LY LL EED   GLW  +     T +  ++A  QQG +++A          ++  +  ++   M Q   + ++ ++ R  K+++QW+ + ++ + ++  N  +  ES WR   W  + +     + S  +   WR  L   Y  I +     P  + +S    ++     +TG  +++W+ LP   I++  HV +LQA    +E  +  Q+  G+    +NV         ++++++K+W+NR    +D  S  SDI  WR+  +  ++ H     A+  + V  N+      ++     ++  G+         +  D L +   +P + + + F   +Q+  C +++     ++   E L+++E+ + + F   RD+ A+FY  K +  +   + +EA +    ++Q+       W+++ D+ E +F     + RQ         A++AL     A +        H  + K    +AK LWL+T D+ Q +++  +++ ++ +P    LPW   ++TCL+RPEG+ ++++L+++   +P+AVY   R L        R++    E + + PS   S+  S+  +  E    Q   S                            + + L  ++    Q+ W   +W E++L Q+    ++     Y V   +     D        V  H L  L    +   + I+N    +          S   ++ +  R  +       Q ++ +F+   DFG   A+ L   +NKLKK WI +L     L  K+  ++E+ R L+  +Q + D++LPG+  + K   +++ +A   P VE V       RR+ +R  NG  + Y +               ND C +     +E++ Q+ R+LN  L+K++E+ RR L+L  PR++ ++                 Q  +  +N   VSL  I+   C  + +EH         ++   ++  SQ   +    IL D++  + P   L                              +D A+  F       P  YW  RKQ T   A+    +++M ++ L      +      +  S  +  + +    L+    +PFRL+PN+  F+   G + S        +TA MIAT   +      + AL+RA+LRD FI WHK   ++         +++  +L   +S A   + +R+ T+   D  DS     +  +    N   M P+   W+
Sbjct:   23 DPAAKDESKLKAVQELSEELETIVTSVHYPTFLDHAMRVFLRILQEGKPQFIAEHNMQQLRKLILEIIHRIPTNDHLRPYVKQILNLMFELLKVENEENVLVCLRIIIELHKQFRPQFNPEIQQFLEFVKTIYRELPNHLNAIFEPRPPLKFKDLSELNLDAVLQETFTLTNVQLEKKGPDGSCASMQWSLRGTSYQMYNVIPRAVLSLKVLAELPIIVVLMYQLYKQSVHDDVAEFIPLILNTITLQPLPQHRMNPAFNREVFVDFMAAQIKTLSFLAYIVKIYQE-TVGVHCSQLAQGMLGLLMLCPQEVAHLRKELLIAARHILAT-DLRNKFVGCMEQLFDENILIGSGWTAYESLRPLAYSTLADLVHHVRQHLPLNNLSSAVAVFSRNVHDESLPASIQTMSCKLLLNLVECIRTR---SDQENGNGRELLIRMLEVFVLKFKTIAKCQLPVLMQKSRQQGPPSEANRPD------------------DSARASLQFSASLADLKEEKN---NSYTVADCRSLVKTLVCGVKTITWGIGTCK-------------MPGGPLEEKQFQPK---------ETLVFIRLVKYALQALDVYTL----------PPGTGAIAAGATGGAAAAASSAHARTAALQSAVRSK--EEKEVLDHFGGVFTMMSPSTFREVFSTTIEYVVERLNKNSALQIVANFFLANR-----ATSPIFATILVEYLLERMEEMGANPDKSNLYLKLFKLVFGSVSLFAAENELMLKPHLHRIVNRSMELALSAREPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPSLLQGLNGLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLISQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPTDSIAQVAFRVLGKFGGGNRKMLMEPQRLEYCD-RDTPGPCITVHFQDH-KTPIALPVDKLIETAFNALK------QSGTDSFYRRQCWEIIRGFLVANLQLDDDRQTMLQLFSHPSFGTGDISPPQTVP--------------------------YKCQD-----------------------VETRKVHQMALTGMFAAAAIKELHSQVLPFLVSLVHHYTLVAVAQ-------QAGPLRQTRPPMQGMDPSVLVDALAAIMAHEEKELCKVGQLAMLLITENSATVLTSRER---ACQLPHMEYLAERLCALCYDRAWYAKSGGCFAIKCLVERLPLRWVLGHQYLFLKALFFIMMDLTGEVSNGAVDMAKSNLEKM----LTVCG--APLPADASDDLREVQRKSLHEVTLELVRQVT-----SPNTCVRQQAIHSLEVLAQVIGCSVGALMEPHRDVLADMVPPKKHLLRHQPLNAQIGLMEGN------TYCTSLQPRLFALDVSVTEHKTFFSELVSLCEAD---DEALRKLPCYKGC---GPASLVSLRRAALRALATCH---------------------------------------YLPC-RERVFHVLYRALNARDPELQEAAFQCMSDFVAACNIDMEMVHKAIRSLLMLLGDFRQ-LSLSVIQRLSYLTQLFPHTFNEKLCDQLL-QHLGCWLEVAVRTPHRG-----PNATEVRQCAAIIAIFHQIPAAGPAFVKPLVTLVLRHEQQLMVEASSPFQAPLRKFLERHPATALELLL--AEPQVQDEQLNRFLEHL-LRDGATFRAALQRNTG-CIDRLAQLLDEGGP-----------------ELQRLAVRIVAAVARREPQFLAERPALVARLRAVWVSDSFQTAC---GAAGLAQWREPKLLCRCLLGVVQQRPHEIELLFQLLRAFTGRFLPDFGFLRDFLDTWAAKGQTVEWKRAAFFRFVEAFGDPAFPQPLLAKVLQQLLIPAFAASFER----GEGEALIGGPPQPERDSPDNVISVFINRVIDPENPFGTSDAVRILLLQFSCLLVEQASPHIHDAANKRQGIKLRRLMTFAWPCLLGK-NCVDPATKYHGHLLLAHIIAKFAIHKRIVLQVFHSLLKAHAVEARSVVRQALEILTPAMPARMEDGNTMLTHWTKKIIVEEGHTLAQLVHMLQLLYRHYRVYYPVRHH---LVQHMVSSVQRLGFTPNANIEHKKLAVDLAEVVIRWEMQRHREEQQQPPAPPPPQTSEESRRLLDQSGRARQAAPRPDRPIEKHHADALVNFLLRMACQVNESSTNIGSQGEVLSRRCVALLKTALKPDVWPNSELK---LAWFDKLLMTVESAQPN------YGNICTALELLAFLLSILRPEAILSSLKPLQRGIAACMT---CPNSKVIRAVHALLSRLMGLFPSEPTTSSMASRHEELESLYTSISKVVYEGLTTYEKSPAAPPS----TLFGCLMILKAACVNHPCYIDRLITPFMHVLQKMAREHLSPGGIGGGAGGQESSSMGTELLILSLDLVKNRVGVMGQEMRKAFIGAILVGLIEKSPDVKVLRAITKMVEDWV---KSKSPFAVNQSPTLREKSILLVKMMQFMEKRFPDELELNGQFLELVNHVYRDETLKGTELTSKLEPAFMAGLRCVQPTIRAKFFEVFDSSMRR-RLHERLLFIVCSQNWETIGPHF----WIKQCIELVLGTAVINAPLRSAQPATLLPAATAGLQSLE---DIATTCPTAL----------KEEPTDTEEEIDIELPS------SSEVLDGGVAGRARQ-------NLQQLVQRQGRFLEGLRELRLGAFLNATVQLCHLDTPLAQHLWQQLMPRLWKVLSDR---QQSVLAGELVPFLCS---GSHVVQKDCHPNAIGVFVEALAQC-NPPVAIKPALIKYLGRSHNLWHRACLLLEQA--------ALTGRGGSGASCSSVVRGAAEEAGSAAEDALAELYSLLREEDLLGGLWQRRARHPETPL--ALALEQQGCFEQAQAAL----EAAMARAPRHEAAGMLQSECRLWEEHWLRCCKELNQWELVLEYGSSKSCANPHLVLESAWRVPNWPLMKEALSQVELSCPKEQAWRVNLYRGYIAICH-----PEEQHLS---LVERVVEVITGQCIREWRRLPQ--IVSHVHVPLLQAAQQIMELQEAAQIHQGLLPTGSNVGRPAPTSVYDMRAIVKTWRNRLAVLTDDLSHWSDIFTWRQHHYQAIVSHFDNAPASLVAEVPGNQHQSMLGVHASAQSIIHYGKIARKHGLVNVCLDSLSRIHTIPSVPIVDCFQKIRQQVKCYLQLSHITGKNELQEGLDVIESTNLKYF--ARDMTAEFYALKGLFLTQMGRSEEANKALSASVQLHDTLVNGWALWGDYFEGLFGRDRWDSRQLP------LAVSALTCYLHACR--------HQSEPKGRKYMAKVLWLLTYDNEQNVLAETVDKYNSGVPPLQWLPWVPQLLTCLVRPEGRQLLNLLVQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSSEEARAPPSTPASSTLSQPQQPTEAASPQAGDSAQADTSGPIRATPSMWRCSKIMHLQRDLHPTVLSSLEGIVDQMVWFRENWYEEVLRQLRQGLAK----CYAVAFENRGGVADAT------VTPHTLNFLKKLVSTFGVGIENVSSVTTT-------FSSAASESLARRAQATAQDPVFQKMKGQFTTDFDFGAPGAMKLHNLINKLKK-WIKILEAKTKLLPKSLLIEEKCRFLSNFSQQTADVALPGEFLMPKHSHYYVRVARFMPRVEIVQKYNTAARRLYLRGQNGKIYPYLV--------------VNDAC-LSDARREERVLQLLRMLNNLLDKQKETARRFLHLAVPRVVAVSP----------------QMRLVEDNPASVSLLHIYKQRCGQRGVEHDAPVGRYYERLAAVQARGSQASHQVLRDILRDVQGSMVPRTLL------------------------------RDWALATFQ-----APTHYWTFRKQFTLQLALAGFAEFVMHLTRLNPDMMYLHQDSGFMNFSYFKFDVDDISGDLDANRPVPFRLTPNLSEFMTSIGVAGS--------MTAGMIATARCVAQPNFKLQALLRAILRDEFIAWHKKKQDDSLTPGSAPQDMDGELLISMVSKAVSAVMSRLQTLATFDGADSKVSTLVAAANSHDNLCRMDPAWHPWL 3784          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Cavefish
Match: trrap (transformation/transcription domain-associated protein [Source:ZFIN;Acc:ZDB-GENE-050809-47])

HSP 1 Score: 621.313 bits (1601), Expect = 5.625e-178
Identity = 443/1398 (31.69%), Postives = 733/1398 (52.43%), Query Frame = 3
Query:  306 NSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLPK---------------------------IDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLE-LLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + + K  ++V+ + +E E+EEN +IC+++++++HK  RP  S E+ +FL FV+ +YK+L     + F +      +++       +++   T   + T  +  +       I+P+   SLKV+ E+P+++VLMYQ +K  I N ++ F+PLIM  + L  S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ ++  L+ KY+  +V+GM +++ N P    ++RKE  IAA+HIL T +++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L  ++ A  ++ KN+ D++L  SIQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C  ++                      D   LP +P                             D    K +      T  + D + L K L+ G+KTIT  ITS      +             I N  +QP          + +IY KL++Y ++ +D+Y +    +GQ Y R  +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   + + SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A SAK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  +E ++  A++VLGK G  NR  L ESQ++Q+   + Q GP I   FT+     I LP+++ + TA+  LK    E   +       +AW  +K F+V +     +++     ++ +    P  +         +WI    +    H+YK  D   A +T E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C           S   +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E    A  +P+F+   +R+    ++ AWYA+ GG   +  L+  L   W+  + L FLK L + + DL  ++  GA+ MAKT LE LL+  +     +    +  S +D+   +          V   ++  + + N  VR++A   LQ L+++TG+++  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D+ V  H+ F  E+ N+ E 
Sbjct:   45 SPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPTQQLRKLVLEIIHRIPTNEHLRPHIKNILSVMFRFLEIESEENVLICLRIIIELHKQFRPPISQEIHHFLDFVKQIYKDLPKVVTRYFENPQVIAENTVP----SPEMVGMITSVMVKTAPEREDSETRTHTIIPRGSLSLKVLAELPIIVVLMYQLYKLNIHNVVSEFVPLIMNTIMLQVSPQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQD-LVGKYSQQMVKGMLQLLSNCPPETAHLRKELLIAAKHIL-TTDLRSQFIPCMDKLFDESILIGSGYTARETLRPLAYSTLADLVHHVRQNLPLTDLSLAVQLFAKNIDDESLPSSIQTMSCKLLLNLVDCIRSK---SEQENGNGRDILMRMLEVFVLKFHTIARYQLVSIFKKCKPQSE-----------------MGVVDSGALPGVPATPTATTPSLPPPAPPTPVPPAPPPATPFDRAGEKEDKQ----TFQVSDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQIAGNGQTYIR-VANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANLSTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQSAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPAESISHVAYRVLGKFGGSNRKMLKESQRLQYVVTEVQ-GPSIKSEFTDCKAS-IQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVAM-----TSLEDNKHALYQLLAHPNFTE--------KWIP---NVIISHRYKAQDTP-ARRTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQLGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKER---ACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLIWVLQNQLTFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLVRCATPLKEEEKTEELLSAQDKSFHM----------VTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTIIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGNT-FCTTLQ-PRLFTMDLSVVEHKVFYTELLNLCEA 1324          

HSP 2 Score: 602.053 bits (1551), Expect = 4.345e-172
Identity = 611/2661 (22.96%), Postives = 1175/2661 (44.16%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLLVTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTS-FNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDIR----TKEEALTGLSAIGQD------------------------------------------------KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELM-DLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEII--KTNSQSEEV-----EQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILY-QHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKF--LNGENVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIHNNNV-----FSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAA-----TDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL--------RDKLIRELSYSDPSDSNNQSEEIK------------LYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLS---SASEQIYNRISTVGRMDDDSITRDKI---QNSLDPLNQALMKPSHQIWI 12191
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++   ++  ++++     K G     ++ K    I  + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+AKP+RD L + P   + L+       P   +       P+ ST+  ++   AVKII  + K++  W      L   L + W S  FQ R  R D +  ++W + + +   L  +        E LF + R+F  R L ++  L++++ +   K   +  +    +   + ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +   D    LR+   QF  L++E+AP++IH+ +NK +  K R ++TFAWP +  +    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ IS +    F P    EQR+  +D+ E++I+W+++     + E+ T  SA G+                                                 K +  Q  +++ N ++R+  Q+ D +    +  +   RR + L++TA  P +W    L ++   +          TV  P     F+N+   L+ L+  L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS K      V     L   V   +  + +       SP+ +     L +L   + A     +++DR +   +    K+V E +  +TN  + E      E ++ +++++K+R +V+  +MR+  +  I    I    DAK+L+ V+  ++ W+K   P       P +REKS LLVK+       + D+ ++  + L ++  V+ +E L   D  +  + AF +G+      +R K+ E +   ++R  + ER L++  +  W++       WI   +E+LL          +  K  +   +C+   L    +V S  + S   A FA  +    E       E K  + V+   + +  D  +   +K    + + N  ++L  +H++  + +++V  G +L++++ + + S  L+   +  +FP+LW +L ++       +  EM  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLW    +++E   +     EK +   +    + +  E   I       L SL  LY LL+EED   GLW ++C     E   ++A+ Q G        Y+KA++ + +   ++  S   + +    Q + D   R  K+++QW+ L ++    G +  YL+  E  WR   W  + +     + S  +   W+  +   Y  I +     P  + ++   +L       +   +++W+ LP+  I++  H  +LQA    +E  +  Q+ +G+   N+       ++K+++K+W+NR P  SD  S  S I +WR+  +  ++    N       T+++ +  +     +++  +  RKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LEN+F       + R  H  G+ AIT  + A             H  + K    LAK LWL++ DD   L +  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L        R++   +     PS    QS                    ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++ +   ++    S   S  +  P       H L  +    +   + ++N    SN++ ++    S   ++ +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++ + ++++ ++ L      I      L +S  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++A+LRD  I WHK    +       + + EN   ++ +S    A   I  R+  + + +      + +    NSLD  N   M P+   W+
Sbjct: 1357 YLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMM-QHLRKWMEVVVLT-HKGGQRSDGSEMKICSAI--INLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDAKPLRDVLASNPSRFVPLLV------PAGTAATVRPGSPSTSTARLDLQFQAVKIISIIVKNDEGWLAGQHSLVSQLRRVWVSEAFQER-HRKDNMAATNWKEPKLLAYCLLSYCKRNFSEIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAHKRALFFRFVEFNDPHFNDELKAKVLQHILHPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQADLLDSLRINLLQFSTLLVEHAPHHIHD-NNKSRNSKLRRLMTFAWPCLLPK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHTMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFRVYYPVRHH---LVQHMISAMQRLGFTPSVTIEQRKLAVDLAEVVIKWELQRIKDQQPESETDPSAGGEGTSSGSAGVKRGMSVDSAQDVKRFRSATGAVGTVFGRSQSMPGSEALLTKPVEKQHTDTVVNFLIRIACQVNDSASVAGSPGELLSRRCVNLMKTALRPDMWPRAELKLQWFDKLLM-------TVEQPA-QANFSNICTGLEILSFLLTVLQSPAILAHFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSKKSSTIGEVSPTPPLLPPVGHHVTPSLTLS----LSPSRSLFSGTLMIL---KSACSYNSSYIDRLISVFMRSLQKMVREHLSPQTNPSAPETSAVTSELVMLSLDLVKTRLSVMNMEMRKNFIQVILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQM-PNLREKSILLVKMMTYIEKRFPDDLELNAQFLDLVNYVYRDESLSGSDITSKLEPAFLSGLRCAQPLIRAKFFEVFDTSMKR-RVYERLLYICCSQNWEAMGSHF--WIKQCIELLL---------AVCEKGTIIGTSCQGSMLPSITNVISLAD-SHDRAAFAMATHIKQEPRERENSETKEED-VEIDIELAPGDQTSLPKTKEQAERDAGNQLHMLTNRHDKFLDSLREVKTGALLNALVQLCHISTPLAEKTWVQLFPRLWKILSDRQQHA---LSGEMGPFLCS-GSHQAQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWLRSTLMLEQQAF-----EKGLSLHIKPKQSTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--PETSTAIAYEQHGFFEQAQESYEKAMEKARKEHERTNTSPAIFPEY---QLWEDHWIRCSKELNQWEPLTEYGQSKGHSNPYLV-LECAWRVSNWAAMKEALVQVELSCPKEMAWKVNMHRGYLAICH-----PEEQQLNFIERL---VEMASSLAIREWRRLPH--IVSHVHTPLLQAAQQIIELQEAAQINAGLQPANLGRNTSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQAIVSAYENNTQHDPNTNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KDRQLH-LGVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDKNTL-ADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKPLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQQQPSSVGAQSHSASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAKCHSVAFE---KSGAVSDAKITP-------HTLNFVKKLVSTFGVGLEN---VSNVSTMF----SSAASESLARRAQATAQDPVFQKMKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQGNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGLAEFMLHLNRLNPEMLQIAQDTGKLNVSYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKAVLRDEIIAWHKKTQEDTSMPLSPAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVAAANSLD--NLCRMDPAWHPWL 3824          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008316.1 (pep scaffold:Pmarinus_7.0:GL478517:5252:44987:1 gene:ENSPMAG00000007481.1 transcript:ENSPMAT00000008316.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 565.459 bits (1456), Expect = 7.560e-164
Identity = 412/1300 (31.69%), Postives = 675/1300 (51.92%), Query Frame = 3
Query:  249 DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEK---------GCLVETNEKQ---------------------PIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYK-DGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXP-HTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPE--DFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGS-FSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALA----EHCKYSCTESTDFNDSEKVSYFSV------TRLLV-------DSITETMAYEDKDCIRIGTICLERITAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLD 3986
            + +LKA QE S+ FE    +  YP  L+ +  R   FL   E Q LQE PLQQLRK  LE+  ++P NEH + ++K  ++++ + +E ENEEN +IC+++++++HK  RP  + E+ +FL FV+ +YK+L    N+ F +         D  P+  +++   T  ++    +  +       ++PK   SLKV+ E+P+++VLMYQ +K  I N +A FIPLIM  + L  S   K+++ FN+ LY DF+AAQ+KTLSFLAY+++ +++ L+ KY+  +V+GM +++   P    ++RKE  IAA+HIL T +++ +F+  +  L +E ILIG+GYTV + LRPLAYSTLADL+H V+  L L+++A A  ++ +N+ D+TL  SIQ +S KLLLN +E I++R   + QE   GRE+L+++L   V +  TISK+ LP + K         G +  ++E                       P T               +R+      + D++P             + D + L K L+ G+KTIT  I S                   T  +   QP          + +I+ KL++Y ++ +D+Y +    +GQ Y R  + +   +  +EK +LE    +F  ++P  FKE+FQT + Y+++R   N  +      I+++S   +P+ SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL RIV   M+ A +AK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L    ++L+S  H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  ++ ++  A++VLGK G  NR  L ESQ++ +   + Q GP + +   EFP+    I LP+++ + TA+  LK    E   +       +AW  ++ F+V ++    S V +    +   F   P+ S I                   H++K  D   A +T E                       AL G F+  +   +R + + FV  L++  T+ A+A    E     C           + + +       +R+++        S  E     +   I +  I L      + S  +    AS +P+F+   +R+    ++ AWYA+ GGC  +  L+  L   W+  H   FLK L + + DL      G ++++  C E+ +   L  +  L   D
Sbjct:   37 EAKLKAMQEVSENFENVTTSPQYPFFLEHVIPRFLTFLQDGEVQHLQERPLQQLRKLVLEIVHRIPTNEHLRIHAKNILSLMFRFLEVENEENVLICLRVIIELHKQFRPQITQEIHHFLDFVKQIYKDLPKVVNRYFENPQPIP----DNAPLSQEMVGMVTAVQVKVNPEREDSETRTHTLIPKGTLSLKVLAELPIIVVLMYQLYKQSIHNVVAEFIPLIMSTITLQVSPQAKQNKLFNKELYADFIAAQIKTLSFLAYIIRVYQE-LVSKYSQQMVKGMLQLLAGCPPETAHLRKELLIAAKHIL-TTDLRNQFIPQMDKLFDESILIGSGYTVRETLRPLAYSTLADLVHHVRQHLPLSELALAVRLFSRNIDDETLPSSIQTVSCKLLLNLVECIRSR---SEQEGGNGREVLLRMLEVFVLKFHTISKYQLPAIFKKCKPQAELIGVMPGSSEMMAPATPGPGPSPSPCPTPTSVAPSTSSQGPSTPGTPGAVGERVAQGATEQADKQP-----------FCVGDCRGLVKTLVCGVKTITWGIGSCK------------TPGDATAVHKQFQPK---------ETQIFIKLVKYAMQALDIYQVQVGVNGQTYIRA-ANSQTVRIKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVDRIAKNYALQ-----IVANSFLANPSTSALFATILVEYLLERLPEMGSNLERSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHRIVTSAMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQVGLNMLQSGLHKQYMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADNISHVAYRVLGKFGGSNRKMLKESQKLSWQGTETQ-GPSVTV---EFPDCKASIQLPMEKAIETALDCLKSASTEPYYRR------QAWEVIRCFLVAMMCLDDSKVPLHQLLAHPSFTDKPVPSVI-----------------ISHRFKAQDTP-ARRTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQLAGEGAVCVCVTGAWIRPVSFIRHAATPPPERPSRVVLIRNWPACHSNVEWAGLPNSTSIGLHLI-LPLTGRHVFSTPQ----ASQLPLFSYVVERLCACCYEQAWYAKQGGCVAIKFLMERLPLAWVLQHQYTFLKALLFVMMDLT-----GEVSVSVFCCEVAVRRYLMRVAWLWRAD 1229          

HSP 2 Score: 256.529 bits (654), Expect = 4.712e-68
Identity = 224/922 (24.30%), Postives = 425/922 (46.10%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKNGFIDTENDE----------------KFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTSFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNY--VWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNED-ADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDIRTKEEALT--------------------GLSA--------------------IGQD-----------KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPLCDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSS 7115
            YL   ++K   ALFKA+ S + E+ +    C+++FL  T + ++  +  ++PLL    +  +L+ N  R+     RLF +S +++ C+ ++  + K   V+ I ++   +N      +                  +  +    + LFH++ A+S    +    L           + S  R+PLI +L++ P +TV+LF+      +D   +  F+  L  K+A+ +RD +   P   + L+   +                  S+  ++   A+KII  L K +  W      L   L + W S  FQ R  R + +  SHW +   +L+   C ++Y  + Y   E LF + R+F    L ++  L++++ +  + R+Y  V K+ LF  ++   H+  +  ++      +I++PAF  + E       + E   GPP P  D  + I ++F+NK+++ +  G+    LR+A  QF  L++E+A ++IH+ +NK +  K R ++TFAWP + N+    D + KY G   +A++I+KF I++KI+++VF  L K + +E + V+  AL +L PA   R ++ N L+ H T+K+ +++  +  QL HI +L+V+H  +YY  +     L+Q+ +S +    F P    EQR+  +D+ E++++W+++  ++A                      GL A                    IG+            K I  Q  +++ N ++R+  Q+ + + T  +  +   RR + LL+TA  P +W    L ++   +            +  Q      N+   L+ L   L ++    +L + K   + L   ++      ++ ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE+  SS
Sbjct: 1384 YLAEVREKIIAALFKALNSSNDELQKAGESCMEKFLEGTTIGMDQIHNLMRPLLMLLGDYRSLSLNVVRRFTSVTRLFPSSLNDKFCDQIMQHLRKWMEVVVIAHKGGQRNDGSRASSQPGRCFPAHPFSPILLFNEMKMCAAIINLFHLIPASSISNPRSCVSLPCPPSPFPLLQAGSPFREPLIKFLTRYPAQTVELFMMEA-TLNDPQWSRMFMSFLKHKDARHLRDVISASPVRFVGLLAPAAA-----PPARPGSPTTAPSSRLDLQFNAIKIISILVKHDEKWLPGQPGLVSHLRRVWVSDAFQER-HRKENMVTSHWKE-PKLLSF--CLLNYCRNHYGEMELLFQLLRAFTSPLLCNVSFLKEYMEE-ELPRSYGVVHKRALFFKFVEIFHDATFPEELKAKALQHILIPAFQSSFEKA-----EGEALLGPPNPEGDNLESISSVFINKVLEPEKHGEMLDSLRIAVLQFAALLVEHASHHIHD-NNKSRNTKLRRLMTFAWPCLLNK-TCVDPVCKYHGHLVLAHIIAKFAIHKKIVLQVFISLLKAHALEARLVVRQALAILTPAVPARMEEGNQLLAHWTRKLMVEEGHTVPQLVHILHLLVQHCRVYYPVRHS---LVQHMVSAMQRLAFTPSATLEQRKLAVDLAEVVVKWEMQRIKDAQPEEEDTEHPSCSDAAAAALKRGLPAESTQDVKRFRVATAASLQQPIGRSQVVPVAEQLAAKPIDKQHTDTVVNFLIRIACQVNETTGTVGSPGELLSRRCVMLLKTALRPDMWPNAELKLQWFDKLL--------MTVEQQAQANLANICTGLEVLAFLLTVLPPPTVLASFKPLQRALAACMS---CPNTKVLRAVQGLLSRLMSSFPTEPSTSTVASKYEELESLYAAVGKVIYEGLTSYEKSASS 2273          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003102.1 (pep scaffold:Pmarinus_7.0:GL478395:5049:47859:-1 gene:ENSPMAG00000002837.1 transcript:ENSPMAT00000003102.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 1.507e-8
Identity = 42/158 (26.58%), Postives = 78/158 (49.37%), Query Frame = 3
Query: 9732 KGDEATRHFGYALQI-DAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL 10202
            + +EA + F  A+Q+ D   N   +++ D+LE VF       ++R  H  G++AI   + A             H  + K    LAK LWL++ DD +  ++  +++    +P    + W   ++TCL+  EGK +++++  +   +P+AVY   R L
Sbjct:    1 RSEEANKAFSAAVQMHDVLVNP--TMWGDYLEAVFV------KERQLHL-GVYAIACYLHAC-----------RHQNEHKSRKYLAKVLWLLSFDDEKNTLAEAVDKYCVGVPPIQWVAWIPQLLTCLVCSEGKLLLNLISTVGRVYPQAVYFPIRTL 138          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Yeast
Match: TRA1 (Subunit of SAGA and NuA4 histone acetyltransferase complexes; interacts with acidic activators (e.g., Gal4p) which leads to transcription activation; similar to human TRRAP, which is a cofactor for c-Myc mediated oncogenic transformation [Source:SGD;Acc:S000001141])

HSP 1 Score: 216.468 bits (550), Expect = 5.661e-56
Identity = 147/487 (30.18%), Postives = 247/487 (50.72%), Query Frame = 3
Query:  225 FFDDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMN----------DNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNL-------IPSEAQKKDEHF--------NETLYLDFLAAQVKTLSFLAYV-VKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETNEKQ 1607
            F DD   +  R     E  D  E      DY   L+ +       L +    +   +P Q+LR   L++F +   N+  + Y+   +  L+ ++  ENEEN ++C+K+L  + KS +    +++ +F++ +  +YK   N  N+ F  +   E   +D  P E +  E       + ++KD            +N    N L  S +S K++ E P+ +V +Y  +K   +  +  F PLIM  LN+          +A+ + EHF        N   Y DF+ AQ+K  SFLAYV ++ +    ++ Y + +   + R++ + PS +++ RKE   A RHIL T   K  F+  L  L +E ILIGNG+T+++ LRPLAYST+AD IH ++SEL L++I K   +Y   + D++L  ++Q MS KLLLN +E I      NPQE    ++LL+ I+ + + R  T+++ Y   ++     ET++K+
Sbjct:   14 FRDDDATLQSRYSTLSELYDIMELLNSPEDYHFFLQAVIPLLLNQLKEVPISYDAHSPEQKLRNSMLDIFNRCLMNQTFQPYAMEVLEFLLSVLPKENEENGILCMKVLTTLFKSFKSILQDKLDSFIRIIIQIYKNTPNLINQTFYEAGKAEQGDLDS-PKEPQADELLDEFSKNDEEKDFPSKQSSTEPRFENSTSSNGLRSSMFSFKILSECPITMVTLYSSYKQLTSTSLPEFTPLIMNLLNIQIKQQQEAREQAESRGEHFTSISTEIINRPAYCDFILAQIKATSFLAYVFIRGYAPEFLQDYVNFVPDLIIRLLQDCPSELSSARKELLHATRHILSTN-YKKLFLPKLDYLFDERILIGNGFTMHETLRPLAYSTVADFIHNIRSELQLSEIEKTIKIYTGYLLDESLALTVQIMSAKLLLNLVERILKLGKENPQEAPRAKKLLMIIIDSYMNRFKTLNRQYDTIMKYYGRYETHKKE 498          

HSP 2 Score: 128.257 bits (321), Expect = 2.103e-29
Identity = 182/764 (23.82%), Postives = 340/764 (44.50%), Query Frame = 3
Query: 2028 PSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEAS-LHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVLS--CNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDI---MFAMLQSFRCKSEQVNRTAFKVLGKMGRYNR------CDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKS-----FIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCKYSCTESTDFN-DSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI--TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELH--PCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPA-VFKAYPMSKQIA 4250
            PS  ++A   D + +++ +  +F+ +  A F E+ + ++ ++ ER   +S ++ + Q  L+S        S   A ++L +L   ++ +G      S +  RLFK  F SV+      E VL  HL  ++L  +KY+ +A++P  +  L+R LFRSIGGG  E LYR   P+L ++L  L+ ++ +      R+L  ELC+ VPVRLS L P+L  LM+PLV  L    + +SQGLRTLELC+DN++ EY    + PV  D+   +F +LQ  +  +  ++    ++LGK+G  NR       DL E  ++  D+         + +    PED + L V   + +A+  L+  K +   ++ + + +     L +     F     + L + VN       K  ++ +    ++EP           + N+  Y   +N F       + L++S + + + +KE                   ++ + +D +  L+    +  +          +  FN D +  ++   + L++D+I   ++Y   +   +G +  +RI   + ++   E  ++ S +P     A++ I L +   +Y + GG   + +LI  +     +L  +  +   GL + + D      +    +  +  +LLI+        L  +     ++E +    +   L   VC+     L N N  VR      L  +S +TG  +  L+    H    +L P  A   +A P + QI 
Sbjct:  669 PSLPVSAT-KDARELMDYLAFMFMQMDNATFNEIIEQELPFVYERMLEDSGLLHVAQSFLTSE-----ITSPNFAGILLRFLKGKLKDLGNVDFNTSNVLIRLFKLSFMSVNLFPNINEVVLLPHLNDLILNSLKYSTTAEEPLVYFYLIRTLFRSIGGGRFENLYRSIKPILQVLLQSLNQMILTARLPHERELYVELCITVPVRLSVLAPYLPFLMKPLVFALQQYPDLVSQGLRTLELCIDNLTAEYFDPIIEPVIDDVSKALFNLLQP-QPFNHAISHNVVRILGKLGGRNRQFLKPPTDLTEKTELDIDAIA-------DFKINGMPED-VPLSVTPGIQSALNILQSYKSDIHYRKSAYKYLTCVLLLMTKSSAEFPTNYTELLKTAVN-----SIKLERIGIEKNFDLEP-----------TVNKRDYSNQENLF-------LRLLES-VFYATSIKE-------------------LKDDAMDLLNNLLDHFCLLQVNTTLLNKRNYNGTFNIDLKNPNFMLDSSLILDAIPFALSYYIPEVREVGVLAYKRIYEKSCLIYGEELALSHSFIP---ELAKQFIHLCYDETYYNKRGGVLGIKVLIDNVKSSSVFLKKYQYNLANGLLFVLKDTQ---SEAPSAITDSAEKLLID--------LLSITFADVKEEDLGNKVLENTLTDIVCE-----LSNANPKVRNACQKSLHTISNLTGIPIVKLMD---HSKQFLLSPIFAKPLRALPFTMQIG 1352          

HSP 3 Score: 125.176 bits (313), Expect = 2.072e-28
Identity = 156/730 (21.37%), Postives = 308/730 (42.19%), Query Frame = 3
Query: 8106 VNIQNILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAKLPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQGQYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNY-RYLKKISQWDSLDKFLNGENVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIHNNNV------FSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFD-------KLIHITANAATDS---SRVYR--NEIYLLLLELVRNGRKQHL-----SSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEGWRH-----SYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRD 10208
            + + N +  H  +   + ++   D + S++ + Y   +     +  +FPQ++  +     + +  V+  ++  LS P H + I   T N +   L++++K+ +     H     +LA S+N W+  I ++E      S            + N   IE+N      D  L L   Y  L+EED  +GLW  +     TE    +++ Q G +DKA ++   +  ++ + ++ Y         ++ N+ +  +K+  WD L +    E    L+  E  WR   W       + +  SV ++   R Q+   +  + N   S    ++V    +L +E  +++   L +W SLP     TP H  +L      +E  +  Q+++ +H   V        E+K ++++W++R P+  D  +  +D+V WR+  F         LI     + ++S   +  YR  +EI  ++       RK ++     S   ++Y       LP        +  QE  +K+ E+   H          L+++ N +   F   +  A+F+  K M  S     +EA + F  A+QID    K W+ +  F +   S  P      ++      AI+  ++AA   K           + K+   L + LWL+++DD+  +++   +    ++P    + +   ++T L   E   V  +LIR+A  +P+A++   R  ++
Sbjct: 2517 LELSNFVKGHIASMQGLCRIISSDFIDSLIEIFYQDPKAIHRAWVTLFPQVYKSIPKN--EKYGFVRS-IITLLSKPYHTRQISSRT-NVINMLLDSISKIESLELPPH--LVKYLAISYNAWYQSINILESIQSNTS------------IDNTKIIEANE-----DALLEL---YVNLQEEDMFYGLWRRRAKY--TETNIGLSYEQIGLWDKAQQLYEVAQVKARSGALPYSQ--SEYALWEDNWIQCAEKLQHWDVLTELAKHEGFTDLL-LECGWRVADWNSDRDALEQSVKSVMDVPTPRRQMFKTFLALQNFAESRKGDQEVR---KLCDEGIQLS---LIKWVSLP--IRYTPAHKWLLHGFQQYMEFLEATQIYANLHTTTVQNLDSKAQEIKRILQAWRDRLPNTWDDVNMWNDLVTWRQHAFQVINNAYLPLIPALQQSNSNSNINTHAYRGYHEIAWVINRFAHVARKHNMPDVCISQLARIYT------LP-------NIEIQEAFLKLREQAKCHYQNMNELTTGLDVISNTNLVYFGTVQK-AEFFTLKGMFLSKLRAYEEANQAFATAVQIDLNLAKAWAQWGFFNDRRLSEEPNNISFASN------AISCYLQAAGLYK-----------NSKIRELLCRILWLISIDDASGMLTNAFDSFRGEIPVWYWITFIPQLLTSLSHKEANMVRHILIRIAKSYPQALHFQLRTTKE 3176          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Nematostella
Match: EDO30017 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T200])

HSP 1 Score: 84.7297 bits (208), Expect = 9.811e-17
Identity = 73/301 (24.25%), Postives = 126/301 (41.86%), Query Frame = 3
Query: 2718 QGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCKYSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKD 3620
            +GLRTLELCVDN+ P++LY ++ PVR ++  A+ ++ R  +E + R AF+VLGK G  NR  L E Q+     WQ+   P+I  +   F            +S A+  + L+KV+               F+ +        +    N  S +   FR + +   I + PG                Y+F +    F       L  + +   +++      + AL G  +     ++R + + F+  L++ LT+ A+ +      T         +        +L D+I   MA EDK+
Sbjct:   12 EGLRTLELCVDNLQPDFLYDHIQPVRAELFQALWKTLRNPNENIARIAFRVLGKFGGGNRRMLKEPQKNFLLRWQS---PQIESKAGPF------------ISPALFEMSLDKVK--------------IFMNNIHPNRRKLIAPRSNPSSLA---FRLLILSGDIPLNPGP--------------TYRFKEGNVPF-------LGKTTVQHCNDVLSKKSLEQALTGALLSASIKELRSDAVPFMCNLIRHLTLIAVVQQ-----TGPCPIKPQNRTQKGMDVHVLCDAIAAVMAMEDKE 254          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Nematostella
Match: EDO27431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T996])

HSP 1 Score: 65.855 bits (159), Expect = 9.146e-11
Identity = 36/101 (35.64%), Postives = 61/101 (60.40%), Query Frame = 3
Query: 2202 ILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGG 2504
            I+ +S   +P  SA  A +++ +LL+ ++ +G     ++L+ +LFK +F SV       E +L+ HL  IV   ++ A ++K+P ++  LLR LFRSIGGG
Sbjct:    1 IIPNSFLANPNTSATFATILVKFLLERLDQMGSNMERSNLYLKLFKLVFGSVSLFASENEQMLKPHLHEIVNRSIELACTSKEPYNYFLLLRALFRSIGGG 101          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Nematostella
Match: EDO27528 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T905])

HSP 1 Score: 52.373 bits (124), Expect = 2.333e-7
Identity = 24/87 (27.59%), Postives = 49/87 (56.32%), Query Frame = 3
Query: 9942 SSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCL 10202
            +  H  + K    LA+ +WL+T DD +  ++  +++    +P    LPW   +++CL+R EG+ ++++L  +   +P+A+Y   R L
Sbjct:   43 ACRHQNESKCRKYLARVIWLMTYDDEKGSIADAVDKYCVGVPPLHWLPWIPQLLSCLVRREGQKILNLLCNIGRVYPQAMYFPIRTL 129          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Nematostella
Match: EDO41347 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4L8])

HSP 1 Score: 48.1358 bits (113), Expect = 3.928e-6
Identity = 30/95 (31.58%), Postives = 44/95 (46.32%), Query Frame = 3
Query: 5388 LAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFLTDLFVK 5672
            L K N  W      +   L + W S  FQ RL + D I    W + + ++  L  +I + PD  E LF + R F +R +   H LR+FL +   K
Sbjct:   12 LVKFNDNWLPEHPVVIGHLRRIWASKSFQDRLNK-DGIPVHRWREPKLLVKCLLNYIKHRPDEVEPLFHLLRVFTLRHVPDFHFLRKFLDETVAK 105          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Medaka
Match: trrap (transformation/transcription domain associated protein [Source:NCBI gene;Acc:100304461])

HSP 1 Score: 621.313 bits (1601), Expect = 5.942e-178
Identity = 620/2609 (23.76%), Postives = 1163/2609 (44.58%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTS-FNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNY--VWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDIR--------TKEEALTG----------------LSAIGQD-----------------------------KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIK--------TNSQSEEVEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDS--RYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSF--------KNDETAHHPL---LELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKF--LNGENVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAATDSSRVYRNEIYL-------LLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLIRELSYSDPSDSNNQSEEIKLY----------------------ENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHK 11975
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I +    K G     ++ K    I  + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+AKP+RD L   P   + L+       P   +       P+ +T+  ++   A+KII  + K++  W      L   L + W S  FQ R  R D +  ++W + +    L  C + Y    Y   E LF + R+F  R L ++  L++++ +  + RNY    K+ LF +   + ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +  G+    LR+   QF  L++E+AP++IH+ +NK +  K R ++TFAWP +  +    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ IS +    F P    EQR+  +D+ E++I+W+++        ++ EA+ G                 +A GQD                             K +  Q  +++ N ++R+  Q+ D +    +  +   RR + L++TA  P +W    L ++   +          TV  P      +N+   L+ L+  L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE+  S+ N  ++   L +L   + A     +++DR +   +    K+V E +         T + +   E ++ +++++K+R +V+  +MR+  +  I    I    D K+L+ V+  ++ W+K   P       P +REKS LLVK+       + D  ++  + L ++  V+ +E L   D  +  + AF +G+      +R K+ E +   ++R  + ER L++  +  W++   +F    WI   +E+LL          +  ++ +   +C+   L     +T+  NL  S   A FA  +         +N ET    +   +EL  G+        +      +Q  ++  ++L +    +  +H++  + ++ V  G +L++++ + + S  L+   +  +FP+LW +L ++       +  EM  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLW    +++E   +     EK +        + +  E   I       L SL  LY LL+EED   GLW ++C     E   ++A+ Q G        Y+KA++ + +   +S  S   + +    Q + D   R  K+++QW+ L ++    G +  YL+  E  WR   W  + +     + S  +   W+  +   Y  I N     P  + ++   +L       +   +++W+ LP+  I++  H  +LQA    +E  +  Q+ +G+       N    ++K+++K+W+NR P  SD  S  S I +WR+  +  +  +TA           N   L        +++  + GRKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LEN+F       + R SH  G+ AIT  + A             H  + K    LAK LWL++ DD   L +  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L   L  E      SD++ Q +   +                         ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K+        H L  +    +   + ++N    SN++ ++S   S    + +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++ + ++++ ++ L      I      L +S  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++A+LRD  I WHK
Sbjct: 1279 YLPQSREKIIAALFKALNSTNNELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITH----KGGQRSDGSEMKICSAI--INLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDAKPLRDVLAANPNRFVPLLV------PAGTAATVRPGSPSTTTARLDLQFQAIKIISIIVKNDEGWLAGQHSLVSQLRRVWVSEAFQER-HRKDNMSATNWKEPKL---LAYCLLSYCKRNYSEIELLFQLLRAFTGRFLCNMTFLKEYMEE-EIPRNYSIAQKRALF-FRFVEFNDPHFNDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQGELLDSLRICLLQFSTLLVEHAPHHIHD-NNKSRNSKLRRLMTFAWPCLLPK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHTMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFRVYYPVRHH---LVQHMISAMQRLGFTPSVTIEQRKLAVDLAEVVIKWELQRIKDQQPESEGEAVAGEGTSGGAVKRGLSLDAAAAAGQDVKRFRTAAGAASTAFGRSQSLPGAENLLNKPVEKQHTDTVVNFLIRIACQVNDSTNVAGSPGELLSRRCVNLMKTALRPDMWPRAELKLQWFDKLLM-------TVEQPA-QANISNICTGLEILSFLLTVLQSPAILAHFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSTSNVASKYEELECLYAAVGKVIYEGLTNYEKATSNTNPTQLFGTLMIL---KSACSYNASYIDRLISVFMRSLQKMVREHLSPQQANPGVTETSTVTSELIMLSLDLVKTRLSVMSMEMRKNFIQVILTSLIEKSADPKILRAVVKIVEEWVKNNSPMAANQM-PNLREKSILLVKMMTYIEKRFPDELELNAQFLDLVNYVYRDESLSGSDITSKLEPAFLSGLRCTQPLIRAKFFEVFDASMKR-RVYERLLYICCSQNWEAMGNHF----WIKQCIELLL---------GVCERNTIIGTSCQGSILP---SITNVINLADSHDRAAFAMATHVKQELRERENSETKEEDVEIDIELAPGD-------QTAIPKTKEQAERDTGNQLHM----LTNRHDKFLDSLRDVKTGALLNALVQLCHISTPLAERTWVQLFPRLWKILSDRQQHA---LSGEMSPFLCS-GSHQAQRDCQPSALNCFVEAMSQCVPPIP--IRPCVLKYLGKTHNLWLRSTLMLEQQAF-----EKGLSLHSKPKPSTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--PETATAIAYEQHGFFEQAQESYEKAMEKARKEHEKSNISPAIFTEY---QLWEDHWIRCSKELNQWEPLTEYGQSKGHSNPYLV-LECAWRVSNWGAMKEALVQVELSCPKEMAWKVNMHRGYLAICN-----PEEQQLNFIERL---VEMASSLAIREWRRLPH--IVSHVHTPLLQAAQQIIELQEAAQINAGLQPANLGRNTSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQAI--VTAYETNTQHDPNNNNAMLGVHASASAIIQYGKIGRKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KDRQSH-LGVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDKNTL-ADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKPLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDASGQQQPSSVGAQPHSGASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAKITP------HTLNFVKKLVSTFGVGLEN---VSNVSTMFSSAAS----ESLARRAQATAQDPVFQKMKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQGNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGLAEFMLHLNRLNPEMLQIAQDTGKLNVSYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKAVLRDEIIAWHK 3677          

HSP 2 Score: 570.852 bits (1470), Expect = 1.371e-162
Identity = 429/1389 (30.89%), Postives = 708/1389 (50.97%), Query Frame = 3
Query:  249 DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEHNLVLP-TLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  + V+ + +E ENEEN +IC+++++++HK  RP  S E+ +FL FV+ +YK+L     + F +      +++       +++   T   + T  +  +       I+P+   SLKV+ E+P+++VLMYQ +K  I N ++ F+PLIM  + L  S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ ++  L+ KY+  +V+GM +++ N P    ++RKE  IAA+HIL T +++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L  ++ A  ++ KN+ D++L  +IQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C                                  P+ +   + P     LP T  + D + L K L+ G+KTIT  ITS      +             I N  +QP          + +IY KL++Y ++ +D+Y +   + Q      +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   + + SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A SAK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  +E ++  A++VLGK G  NR  L ESQ++ +   + Q GP I   FT+     I LP+++                         V+ W  +K F+V +     ++++    ++ +    P  +         +WI     S   H+YK  D   A +T E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C           S   +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E     S++  F   +  ++   H    YA                P       +DF             Q+  GA+ MAKT LE L+      +           E++  ++    EK    V   ++  + + N  VR++A   LQ L+++TG+ +  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:   36 ETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPTQQLRKLVLEIIHRIPTNEHLRPHAKNILTVMFRFLEIENEENVLICLRIIIELHKQFRPPISQEIHHFLDFVKQIYKDLPKVVARYFENPQVIAENTVP----SPEMVGMITSVLVKTAPEREDSETRTHTIIPRGSLSLKVLAELPIIVVLMYQLYKLSIHNVVSEFVPLIMNTIMLQVSPQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQD-LVAKYSQQMVKGMLQLLSNCPPETAHLRKELLIAAKHIL-TTDLRSQFIPCMDKLFDEAILIGSGYTARETLRPLAYSTLADLVHHVRQNLPLTDLSLAVQLFAKNIDDESLPSNIQTMSCKLLLNLVDCIRSK---SEQENGNGRDILMRMLEVFVLKFHTIARYQLVSIFKKC---------------------------------KPQSEMGAVDPG---ALPGTFQVSDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQVANNQQTYIRVANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANLSTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQSAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPAESISHVAYRVLGKFGGSNRKMLKESQRLHYVVTEVQ-GPSIKAEFTDCKAS-IQLPMEK-------------------------VRTWEVIKCFLVAM-----TSLDDNKHALYQLLSHPNFTE--------KWIPSVIIS---HRYKAQDTP-ARRTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQLGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKERVNHQSSLAFFTKISFLLLCCFHFI--YA----------------PS---SFFIDFFPP----------QVSNGAVAMAKTTLEQLLVRCATPLKD---------EEKTEELLAAQEKSFHMVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKTVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVMEHKVFYTELLNLCEA 1246          
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Medaka
Match: trrap (transformation/transcription domain associated protein [Source:NCBI gene;Acc:100304461])

HSP 1 Score: 619.772 bits (1597), Expect = 1.741e-177
Identity = 620/2611 (23.75%), Postives = 1163/2611 (44.54%), Query Frame = 3
Query: 4605 YLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATN--RQLYFCARLFHASFSERMCESLL--VTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTS-FNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAY---EFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNY--VWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGD--GGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLH-TKKVSMDDVTSQSQL-HIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQP----EQRRCLLDMIELIIRWDIR----------TKEEALTG----------------LSAIGQD-----------------------------KSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPL--CDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIK--------TNSQSEEVEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMK--LPKQEEHFAPGIREKSELLVKLWGKYHT-WSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDS--RYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNL--SIFNAIFANMSF--------KNDETAHHPL---LELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAK-LPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFL-SLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQG-------QYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKF--LNGENVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIH-----NNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAATDSSRVYRNEIYL-------LLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEG--WRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLIRELSYSDPSDSNNQSEEIKLY----------------------ENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNS--KALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNK-IEHLQ--SKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSE-DAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHK 11975
            YL   ++K   ALFKA+ S + E+ E    C+++FL    + ++  + +++PLL    +  +L  N   +L    RLF  SF+++ C+ ++  + K   V+ I +    K G     ++ K    I  + LFH++ AA    V+PL E+V+K E+ +   + S  R+PLI +L++ P++TV+LF+      +D   +  F+  L  K+AKP+RD L   P   + L+       P   +       P+ +T+  ++   A+KII  + K++  W      L   L + W S  FQ R  R D +  ++W + +    L  C + Y    Y   E LF + R+F  R L ++  L++++ +  + RNY    K+ LF +   + ++  +  ++   +  +I+ PAF  + E      E  +L G P    ++ + I ++F+ K++D +  G+    LR+   QF  L++E+AP++IH+ +NK +  K R ++TFAWP +  +    D   KY G   +A++I+KF I++KI+++VF  L K + +E + ++  A+ +L PA   R +D + ++ H T+K+ +++  +  QL HI +LIV+H  +YY  + H   L+Q+ IS +    F P    EQR+  +D+ E++I+W+++          ++ EA+ G                 +A GQD                             K +  Q  +++ N ++R+  Q+ D +    +  +   RR + L++TA  P +W    L ++   +          TV  P      +N+   L+ L+  L ++ S  IL + K   + +  C    N KV     ++    +L  ++  FP EPS     ++  EL  LY+ V K I E  + YE+  S+ N  ++   L +L   + A     +++DR +   +    K+V E +         T + +   E ++ +++++K+R +V+  +MR+  +  I    I    D K+L+ V+  ++ W+K   P       P +REKS LLVK+       + D  ++  + L ++  V+ +E L   D  +  + AF +G+      +R K+ E +   ++R  + ER L++  +  W++   +F    WI   +E+LL          +  ++ +   +C+   L     +T+  NL  S   A FA  +         +N ET    +   +EL  G+        +      +Q  ++  ++L +    +  +H++  + ++ V  G +L++++ + + S  L+   +  +FP+LW +L ++       +  EM  FL + G +Q      P+ + CF+EA+++ +P            +L  +HNLW    +++E   +     EK +        + +  E   I       L SL  LY LL+EED   GLW ++C     E   ++A+ Q G        Y+KA++ + +   +S  S   + +    Q + D   R  K+++QW+ L ++    G +  YL+  E  WR   W  + +     + S  +   W+  +   Y  I N     P  + ++   +L       +   +++W+ LP+  I++  H  +LQA    +E  +  Q+ +G+       N    ++K+++K+W+NR P  SD  S  S I +WR+  +  +  +TA           N   L        +++  + GRKQ L +       ++       + + F   +Q+ K  +   G   ++  ++ LE++E+ + + F  K   A+FY  K M  +  NK +EA + F  A+Q+     K W+++ D+LEN+F       + R SH  G+ AIT  + A             H  + K    LAK LWL++ DD   L +  +++    +P    L W   ++TCL+  EGK +++++ ++   +P+AVY   R L   L  E      SD++ Q +   +                         ++   ++ + + L  ++    Q+ W   +W E++L Q+    ++     Y V    S    D K      +  H L  +    +   + ++N    SN++ ++S   S    + +  R  +       Q ++ +F+ DF  S   ++ L   ++KLKK WI +L        K   ++E+ R L+  +  + ++ +PG+  + K   +++ IA   P VE V  +    RR+ IR  NG  + Y +               ND C + +   +E++ Q+ R+LN  L K +E+ +R L    PR++ ++                 Q  +  +N   +SL +I+   C  K IEH    S+     +       +   Q+L D+               +E   N +P S              K+ A+  F         DYW  RK  T   A++ + ++++ ++ L      I      L +S  +  +++    L+    +PFRL+PNI  FL   G         S PLTASMIA           +  +++A+LRD  I WHK
Sbjct: 1341 YLPQSREKIIAALFKALNSTNNELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITH----KGGQRSDGSEMKICSAI--INLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEA-TLNDPQWSRMFMSFLKHKDAKPLRDVLAANPNRFVPLLV------PAGTAATVRPGSPSTTTARLDLQFQAIKIISIIVKNDEGWLAGQHSLVSQLRRVWVSEAFQER-HRKDNMSATNWKEPKL---LAYCLLSYCKRNYSEIELLFQLLRAFTGRFLCNMTFLKEYMEE-EIPRNYSIAQKRALF-FRFVEFNDPHFNDELKAKVLQHILNPAFLYSFEK----GEGEQLLGPPNPEGDNPESITSVFITKVLDPEKQGELLDSLRICLLQFSTLLVEHAPHHIHD-NNKSRNSKLRRLMTFAWPCLLPK-ACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHTMEARAIVRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFRVYYPVRHH---LVQHMISAMQRLGFTPSVTIEQRKLAVDLAEVVIKWELQRIKDQQVKPESEGEAVAGEGTSGGAVKRGLSLDAAAAAGQDVKRFRTAAGAASTAFGRSQSLPGAENLLNKPVEKQHTDTVVNFLIRIACQVNDSTNVAGSPGELLSRRCVNLMKTALRPDMWPRAELKLQWFDKLLM-------TVEQPA-QANISNICTGLEILSFLLTVLQSPAILAHFKPLQRGIAACMTCGNTKV-----LRAVHSLLSRLMSIFPTEPSTSNVASKYEELECLYAAVGKVIYEGLTNYEKATSNTNPTQLFGTLMIL---KSACSYNASYIDRLISVFMRSLQKMVREHLSPQQANPGVTETSTVTSELIMLSLDLVKTRLSVMSMEMRKNFIQVILTSLIEKSADPKILRAVVKIVEEWVKNNSPMAANQM-PNLREKSILLVKMMTYIEKRFPDELELNAQFLDLVNYVYRDESLSGSDITSKLEPAFLSGLRCTQPLIRAKFFEVFDASMKR-RVYERLLYICCSQNWEAMGNHF----WIKQCIELLL---------GVCERNTIIGTSCQGSILP---SITNVINLADSHDRAAFAMATHVKQELRERENSETKEEDVEIDIELAPGD-------QTAIPKTKEQAERDTGNQLHM----LTNRHDKFLDSLRDVKTGALLNALVQLCHISTPLAERTWVQLFPRLWKILSDRQQHA---LSGEMSPFLCS-GSHQAQRDCQPSALNCFVEAMSQCVPPI--PIRPCVLKYLGKTHNLWLRSTLMLEQQAF-----EKGLSLHSKPKPSTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKF--PETATAIAYEQHGFFEQAQESYEKAMEKARKEHEKSNISPAIFTEY---QLWEDHWIRCSKELNQWEPLTEYGQSKGHSNPYLV-LECAWRVSNWGAMKEALVQVELSCPKEMAWKVNMHRGYLAICN-----PEEQQLNFIERL---VEMASSLAIREWRRLPH--IVSHVHTPLLQAAQQIIELQEAAQINAGLQPANLGRNTSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQAI--VTAYETNTQHDPNNNNAMLGVHASASAIIQYGKIGRKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYF-TKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFV------KDRQSH-LGVSAITCYLHAC-----------RHQNESKSRKYLAKVLWLLSFDDKNTL-ADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKPLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDASGQQQPSSVGAQPHSGASDPGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAK----CYSVAFEKSGAVSDAK------ITPHTLNFVKKLVSTFGVGLEN---VSNVSTMFSSAAS----ESLARRAQATAQDPVFQKMKGQFTTDFDFSVPGSMKLHNLISKLKK-WIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVM--------------NDAC-LTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSP----------------QMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDIL--------------KEVQGNMVPRS------------MLKEWALHTFPNA-----TDYWTFRKMFTIQLALIGLAEFMLHLNRLNPEMLQIAQDTGKLNVSYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIG--------VSGPLTASMIAVARCFAQPNFKVDGILKAVLRDEIIAWHK 3741          

HSP 2 Score: 577.4 bits (1487), Expect = 1.256e-164
Identity = 433/1396 (31.02%), Postives = 720/1396 (51.58%), Query Frame = 3
Query:  249 DLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETN----EKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPI----KPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVL--SCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCK---------YSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERI---TAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILET 4370
            + +LK  QE S+ FE    +  Y   L+ +  R   FL   E QFLQE P QQLRK  LE+  ++P NEH + ++K  + V+ + +E ENEEN +IC+++++++HK  RP  S E+ +FL FV+ +YK+L     + F +      +++       +++   T   + T  +  +       I+P+   SLKV+ E+P+++VLMYQ +K  I N ++ F+PLIM  + L  S   ++ + +N+ LY DF+AAQ+KTLSFLAY+++ ++  L+ KY+  +V+GM +++ N P    ++RKE  IAA+HIL T +++ +F+  +  L +E ILIG+GYT  + LRPLAYSTLADL+H V+  L L  ++ A  ++ KN+ D++L  +IQ MS KLLLN ++ I+++   + QE   GR++L+++L   V +  TI+++ L  + K C  ++     +   +                       +P    +P     +P       T  + D + L K L+ G+KTIT  ITS      +             I N  +QP          + +IY KL++Y ++ +D+Y +   + Q      +     +  +EK +LE    +F  ++P  FKE+FQT + Y++ER + N  +      I+++S   + + SA+ A +++ YLL+ +  +G     ++L+ +LFK +F SV       E +L+ HL +IV   M+ A SAK+P ++  LLR LFRSIGGG+H+ LY+EFLPLLP +L GL+ L    H   ++DL  ELC+ VPVRLS+LLP+L +LM+PLV  L  S   +SQGLRTLELCVDN+ P++LY ++ PVR ++M A+ ++ R  +E ++  A++VLGK G  NR  L ESQ++ +   + Q GP I   FT+     I LP+++ + TA+  LK    E   +       +AW  +K F+V +     ++++    ++ +    P  +         +WI     S   H+YK  D   A +T E                       AL G F+  +   +R + + FV  L++  T+ A+A+ C           S   +  F+  E  S      +L+D+I   MAYE+K+  +IG + L  I    +IIL + E     S++  F   +  ++   H    YA                P   +   +DF             Q+  GA+ MAKT LE L+      +           E++  ++    EK    V   ++  + + N  VR++A   LQ L+++TG+ +  +++PH  V+ D++PP   + +  P + QI ++E N  F   +        D++V  H+ F  E+ N+ E 
Sbjct:   36 ETKLKMMQEVSENFENVTSSPQYSTFLEHIIPRFLTFLQDGEVQFLQEKPTQQLRKLVLEIIHRIPTNEHLRPHAKNILTVMFRFLEIENEENVLICLRIIIELHKQFRPPISQEIHHFLDFVKQIYKDLPKVVARYFENPQVIAENTVP----SPEMVGMITSVLVKTAPEREDSETRTHTIIPRGSLSLKVLAELPIIVVLMYQLYKLSIHNVVSEFVPLIMNTIMLQVSPQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQD-LVAKYSQQMVKGMLQLLSNCPPETAHLRKELLIAAKHIL-TTDLRSQFIPCMDKLFDEAILIGSGYTARETLRPLAYSTLADLVHHVRQNLPLTDLSLAVQLFAKNIDDESLPSNIQTMSCKLLLNLVDCIRSK---SEQENGNGRDILMRMLEVFVLKFHTIARYQLVSIFKKCKPQSEMGAVDPGALPGVPATPTPPANPAIPPPAPPTPVPAAPTQPGTAFDRPGEKEDKQTFQVSDCRSLVKTLVCGVKTITWGITSCKAPGEAQF-----------IPNKQLQPK---------ETQIYIKLVKYAMQALDIYQVQVANNQQTYIRVANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVERISKNYALQ-----IVANSFLANLSTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQSAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPAESISHVAYRVLGKFGGSNRKMLKESQRLHYVVTEVQ-GPSIKAEFTDCKAS-IQLPMEKAIETALDCLKSANTEPYYRR------QAWEVIKCFLVAM-----TSLDDNKHALYQLLSHPNFTE--------KWIPSVIIS---HRYKAQDTP-ARRTFE----------------------QALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQLGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKERVNHQSSLAFFTKISFLLLCCFHFI--YA----------------PSSFF---IDFFPP----------QVSNGAVAMAKTTLEQLLVRCATPLKD---------EEKTEELLAAQEKSFHMVTHDLVREVTSPNSTVRKQAMHSLQVLAQVTGKTVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGN-TFCTTLQ-PRLFTMDLNVMEHKVFYTELLNLCEA 1308          
BLAST of Transformation/transcription domain-associated protein vs. Planmine SMEST
Match: SMESG000006811.1 (SMESG000006811.1)

HSP 1 Score: 8078.78 bits (20961), Expect = 0.000e+0
Identity = 4000/4008 (99.80%), Postives = 4003/4008 (99.88%), Query Frame = 3
Query:  168 MSEVIGSHHQISLKEKLIIFFDDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETNEKQPIXXXXXXXXXXXXXXXXDRLKLPTLPKIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLXXXXXXXXXXXXXXGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHEXXXXXXXXXXXXXXXXXXXXXXXPHTNQVRDLLGELCVIVPVRXXXXXXXXXXXXXXXVHVLSCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCKYSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERITAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTXXXXXXXXXXXXSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATNRQLYFCARLFHASFSERMCESLLVTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVXXXXXXXXXXXXIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTSFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGDGGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLHTKKVSMDDVTSQSQLHIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQPEQRRCLLDMIELIIRWDIRTKEEALTGLSAIGQDKSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPLCDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEEVEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLPKQEEHFAPGIREKSELLVKLWGKYHTWSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQNILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAKLPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQGQYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGENVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIHNNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHITANAATDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLIRELSYSDPSDSNNQSEEIKLYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNSKALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNKIEHLQSKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSEDAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLSSASEQIYNRISTVGRMDDDSITRDKIQNSLDPLNQALMKPSHQIWI 12191
            MSEVIGSHHQISLKEKLIIFFDDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETNEKQPITEESEVKVKTEETTEEDRLKLPTLPKIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLVASTSSVSRQESVSGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHERLYREFLPLLPLMLTGLSSLLRSPHTNQVRDLLGELCVIVPVRLSTLLPHLSLLMEPLVHVLSCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNE QYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCKYSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERITAIILSASENKMAASN+PIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLW HLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILL+ENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTAVALKVAACKLLSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATNRQLYFCARLFHASFSERMCESLLVTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVNFFDDFYANNFFIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTSFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGDGGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLHTKKVSMDDVTSQSQLHIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQPEQRRCLLDMIELIIRWDIRTKEEALTGLSAIGQDKSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFL TFLKLMDSNNILQNMKSFSKPLCDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEEVEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLPKQEEHFAPGIREKSELLVKLWGKYHTWSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNN SKLSVNIQNILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAKLPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQGQYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGENVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIHNNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIH+TANAATDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLIRELSYS PSDSNNQSEEIKLYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNSKALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNKIEHLQSKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSEDAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLSSASEQIYNRISTVGRMDDDSITRDKIQNSLDPLNQALMKPSHQIWI
Sbjct:    1 MSEVIGSHHQISLKEKLIIFFDDAKEIDLRLKAAQEFSDAFEYSAQNSDYPEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQYSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFVRNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKDMNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLIMEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLMEKYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLSDLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMYIKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKILYALVKRLGTISKHYLPKLEKGCLVETNEKQPITEESEVKVKTEETTEEDRLKLPTLPKIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITSSNKLVASTSSVSRQESVSGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYCLRMMDLYLIYYKDGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPANFKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILSYLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVLGCMKYALSAKDPSSFMCLLRYLFRSIGGGAHERLYREFLPLLPLMLTGLSSLLRSPHTNQVRDLLGELCVIVPVRLSTLLPHLSLLMEPLVHVLSCNTISQGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFKVLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKEIVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVGSFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNERQYKFTDNAFAFKTHEPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLVQQLTICALAEHCKYSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDKDCIRIGTICLERITAIILSASENKMAASNLPIFNLFAQRIIQLLHKTAWYARWGGCAILTILIRELHPCWLWGHLLDFLKGLFYTITDLNLQICQGALTMAKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVIHILLSENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAVFKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILETSTGTDEEINAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQCTVRQACAYTDMSTAVALKVAACKLLSTLWYLDTEKDKNFQALFKAMCSKDVEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATNRQLYFCARLFHASFSERMCESLLVTKVKPVLDILYEKFDKNGFIDTENDEKFLLLIKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSKCPTETVKLFLQTVNFFDDFYANNFFIECLDLKEAKPIRDYLQNQPELLIDLINKKSNDDPPVNSREYFDDIPNNSTSFNVHHFAVKIIHKLAKSNPTWWLNSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYYPDAYEFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYITQAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNEDADDIVAIFLNKLIDNQDCGDGGLRVAYCQFCILILEYAPNYIHEISNKKQGHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVRVFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLHTKKVSMDDVTSQSQLHIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQPEQRRCLLDMIELIIRWDIRTKEEALTGLSAIGQDKSISDQQKESLANLIVRLMVQILDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELNVTNTVLNPQINTQFNNMVMCLDFLATFLKLMDSNNILQNMKSFSKPLCDILNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVLKFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHLVNMAHKLVSEIIKTNSQSEEVEQLIGAIEIIKSRFNVLGADMRRTKVIRIFVDAIIVVKDAKLLKVVMMALKNWMKLPKQEEHFAPGIREKSELLVKLWGKYHTWSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWTDVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVLLLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNLSIFNAIFANMSFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNASKLSVNIQNILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNLLLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAKLPNFFKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNFDGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSMAFAQQGQYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKISQWDSLDKFLNGENVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWRSQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNNCIITPRHVTMLQACNLAVEGWDGMQLFSGIHNNNVFSEVKSMIKSWKNRFPHHSDSFSFCSDIVLWRKAVFDKLIHMTANAATDSSRVYRNEIYLLLLELVRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEGWRHSYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYALQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAASALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLPASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLIRELSYSGPSDSNNQSEEIKLYENVLAQMKKSNGSKLYLVDEFCKQLEWLCPSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLGMLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRYCQDIRVKFSNDFGNSKALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDERTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFCRRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQIFRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKDVDSENCRIVSLEDIWHWYCNNKIEHLQSKVKKNRSIPSQMKEKDDDQILLDLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKFAQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKATLQISSPQLHLSEDAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQPLTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSAELENCILEKWLSSASEQIYNRISTVGRMDDDSITRDKIQNSLDPLNQALMKPSHQIWI 4008          
The following BLAST results are available for this feature:
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRRAP6.889e-9423.87transformation/transcription domain associated pro... [more]
TRRAP6.519e-9423.67transformation/transcription domain associated pro... [more]
TRRAP6.519e-9423.67transformation/transcription domain associated pro... [more]
TRRAP2.529e-18023.51transformation/transcription domain associated pro... [more]
TRRAP5.756e-17923.67transformation/transcription domain associated pro... [more]
back to top
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
trr-17.532e-7828.41Transcription-associated protein 1 [Source:UniPro... [more]
trr-11.995e-7728.33Transcription-associated protein 1 [Source:UniPro... [more]
trr-12.170e-7728.33Transcription-associated protein 1 [Source:UniPro... [more]
back to top
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Nipped-A0.000e+025.58gene:FBgn0053554 transcript:FBtr0303293[more]
Nipped-A0.000e+025.71gene:FBgn0053554 transcript:FBtr0347556[more]
back to top
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
trrap2.939e-17632.16transformation/transcription domain-associated pro... [more]
trrap2.939e-17632.16transformation/transcription domain-associated pro... [more]
trrap9.529e-17832.16transformation/transcription domain-associated pro... [more]
BX005075.21.595e-1223.06pep chromosome:GRCz11:CHR_ALT_CTG12_1_7:18093333:1... [more]
back to top
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRRAP0.000e+026.06transformation/transcription domain-associated pro... [more]
TRRAP0.000e+026.08transformation/transcription domain-associated pro... [more]
TRRAP0.000e+026.09transformation/transcription domain-associated pro... [more]
TRRAP0.000e+026.03transformation/transcription domain-associated pro... [more]
TRRAP0.000e+026.04transformation/transcription domain-associated pro... [more]
back to top
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trrap3.111e-9323.78transformation/transcription domain-associated pro... [more]
Trrap3.667e-9323.94transformation/transcription domain-associated pro... [more]
Trrap9.079e-18023.58transformation/transcription domain-associated pro... [more]
Trrap1.857e-17823.62transformation/transcription domain-associated pro... [more]
Trrap2.023e-17823.62transformation/transcription domain-associated pro... [more]
back to top
BLAST of Transformation/transcription domain-associated protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8I8U7|TRA1_DROME0.000e+025.65Transcription-associated protein 1 OS=Drosophila m... [more]
sp|Q80YV3|TRRAP_MOUSE8.420e-18023.64Transformation/transcription domain-associated pro... [more]
sp|Q9Y4A5|TRRAP_HUMAN2.764e-17823.67Transformation/transcription domain-associated pro... [more]
sp|G5EEV2|TRR1_CAEEL2.761e-7628.33Transcription-associated protein 1 OS=Caenorhabdit... [more]
sp|P38811|TRA1_YEAST3.931e-5430.18Transcription-associated protein 1 OS=Saccharomyce... [more]
back to top
BLAST of Transformation/transcription domain-associated protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E0VJQ20.000e+026.58Transformation/transcription domain-associated pro... [more]
A0A232F8W50.000e+026.18Uncharacterized protein OS=Trichomalopsis sarcopha... [more]
E9FRG70.000e+026.25Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
E2BLG50.000e+026.23Transformation/transcription domain-associated pro... [more]
A0A224YZY60.000e+025.52Histone acetyltransferase saga trrap/tra1 componen... [more]
back to top
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trrap5.625e-17831.69transformation/transcription domain-associated pro... [more]
back to top
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000008316.17.560e-16431.69pep scaffold:Pmarinus_7.0:GL478517:5252:44987:1 ge... [more]
ENSPMAT00000003102.11.507e-826.58pep scaffold:Pmarinus_7.0:GL478395:5049:47859:-1 g... [more]
back to top
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TRA15.661e-5630.18Subunit of SAGA and NuA4 histone acetyltransferase... [more]
back to top
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO300179.811e-1724.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274319.146e-1135.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275282.333e-727.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413473.928e-631.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transformation/transcription domain-associated protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trrap5.942e-17823.76transformation/transcription domain associated pro... [more]
trrap1.741e-17723.75transformation/transcription domain associated pro... [more]
back to top
BLAST of Transformation/transcription domain-associated protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000006811.10.000e+099.80SMESG000006811.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030865 ID=SMED30030865|Name=Transformation/transcription domain-associated protein|organism=Schmidtea mediterranea sexual|type=transcript|length=12211bp
TTCAGACATTAAATTTTAACTATTTAATAAACACCCATTAAAACACTCTA
TTCTCAGTAGCTTTATTAAAATTGATTTAGAATTACAACCAATTTTAAAA
ATTCTCCAAAGATTTGCTTGAAAGTTGTTTTAATATATGAACAAAAATTT
AACAATATTTAAATTTAATGTCTGAAGTTATTGGCTCGCATCATCAAATA
TCACTTAAAGAAAAGCTTATAATATTTTTTGATGATGCAAAAGAAATCGA
CTTGAGGTTAAAAGCAGCTCAAGAGTTTTCTGATGCGTTTGAATATTCAG
CCCAAAATAGTGATTATCCAGAAGTTCTTAAAGAACTTTATGAACGTTCT
CAAAAATTTTTAATGCAAACAGAACCTCAGTTTTTGCAAGAGAATCCATT
ACAACAATTAAGAAAACAATGTCTCGAATTATTTCAAAAAGTTCCACATA
ATGAGCACAACAAACAATATTCGAAATTGTTTATGAATGTTCTTATGAAA
CTAGTTGAATATGAAAATGAAGAAAATACAATGATTTGTGTAAAACTTTT
AGTCGATATTCACAAATCTCAACGACCAAATTTTTCAAATGAAGTCATAA
ACTTTCTGAAATTTGTTAGAAACGTTTATAAAGAATTACAAAATCACACA
AATAAAATTTTCACTCATTCACCATTTTACGAAATCGATTCTATTGATGA
ATTCCCAATAGAAACGAAAGTTTTAGAAACATTTACTGTTACTAAAATAC
ACACTAAACAAAAGGATATGAATGATAATAAAATTGATTTCAATATATTG
CCAAAATCTTGTTACTCATTGAAAGTAATGCAAGAAATTCCCGTACTTCT
AGTGCTCATGTATCAGTTTCACAAATCGTACATCACCAATGAAATCGCAT
CCTTTATCCCGTTAATTATGGAATTTCTGAATTTGATTCCAAGTGAAGCT
CAAAAAAAAGACGAACACTTCAACGAGACGCTATATTTGGATTTCCTTGC
CGCACAAGTCAAAACGTTGTCATTTCTTGCGTATGTCGTCAAATTCTTTA
AGAAACCATTAATGGAAAAATACGCCGACAGTCTTGTGCAGGGCATGTAT
CGGATGATTGTTAATATTCCGTCGAACGTTACGAATATGCGAAAGGAGTA
TTTCATTGCCGCTAGACACATTCTCGGCACACAGGAAATAAAACCAAGAT
TTGTTAAAGTGCTGTCGGATTTGATGAACGAGGATATTTTGATTGGTAAC
GGGTATACTGTCAATCAATTATTGCGACCTCTAGCATACAGCACTCTCGC
TGATTTAATACATTTTGTGAAATCGGAGTTAAATCTCGCAAAAATTGCTA
AAGCAACAAATATGTACATTAAAAACATGCACGATGATACGTTAGTGTTC
AGTATCCAACAAATGAGCATGAAGTTATTACTTAATTTTATCGAGCCTAT
TAAAAACCGAATTACTCACAACCCCCAAGAATTAAATGAAGGTCGTGAAC
TGTTGATAAAAATTCTTTATGCGCTTGTGAAACGATTAGGAACTATCAGC
AAGCATTATTTACCAAAATTAGAAAAAGGATGTCTTGTGGAAACTAATGA
AAAGCAACCGATCACTGAAGAAAGTGAAGTAAAAGTAAAAACAGAAGAAA
CGACAGAAGAAGACAGGTTAAAGTTACCTACTCTGCCGAAAATTGATGAG
AAACCAATAAAACCTGAACATAATCTTGTACTACCAACTTTAACATTACA
AGATTTTAAGATCTTAACAAAGCATTTAATACACGGCATTAAAACTATAA
CATTGACTATAACTAGCTCCAATAAACTTGTAGCGTCAACATCATCGGTA
AGTCGCCAGGAATCGGTCTCTGGGACCATTTCAAATTTTGATATCCAACC
TTCTCATAAGGATAAATTTCTTGATGGATTCGATGTAAAGATTTACTGCA
AGCTCATTCGTTATTGTTTACGAATGATGGATTTATATCTCATCTATTAC
AAAGACGGACAATTGTATCAACGACCACCGAGTACTGCACTCAATGCTAA
ATTTATTGATGAAAAGTCAATTTTGGAAATTATTGGAGTCATTTTTCTAA
ATTTAAGTCCAGCTAATTTCAAAGAAGTCTTTCAAACACAGATTAAGTAT
ATCATCGAGAGGGCCAATGTCAACAGTTGTATTGTGCAGTTATTTCAAAT
AATTCTCAGTAGTTCTCAAGAAGAACATCCTACCAATTCTGCAATACTTG
CCAATTTGATTCTATCCTATCTATTGGATAACATGGAAATAATTGGTGAA
GGTACCCCAGAAGCAAGTTTACACACACGCTTGTTCAAACAAATATTCAA
TTCCGTTCACACTAATTTGGTTTGTTTCGAAAATGTCCTAGAGGTTCACC
TGAAAAGAATAGTATTAGGATGTATGAAATACGCTTTATCAGCTAAAGAC
CCAAGTAGTTTTATGTGCCTACTTCGATATTTGTTTCGTTCAATCGGCGG
AGGAGCTCATGAAAGACTTTATAGAGAATTTCTACCTCTTTTACCTTTGA
TGTTAACAGGCCTTAGTAGTTTATTGCGATCGCCTCACACAAACCAAGTA
CGAGACCTGTTAGGAGAATTATGTGTAATCGTTCCGGTTCGGTTAAGTAC
ACTTCTTCCGCATTTATCTCTTTTGATGGAGCCTTTGGTGCATGTTTTAT
CATGTAATACAATTAGCCAAGGCTTAAGAACACTGGAACTCTGCGTTGAT
AATATGTCGCCGGAATATTTATATCAAAATATGTATCCTGTACGGGGCGA
TATCATGTTTGCAATGCTGCAAAGTTTTCGCTGTAAAAGTGAACAAGTTA
ATCGCACTGCATTCAAAGTTTTAGGTAAAATGGGACGGTACAATAGATGT
GACTTATTAGAATCCCAGCAAATTCAATTTGATTCATGGCAAAATCAAAC
TGGCCCAGAAATTAATATACGGTTTACTGAATTTCCTGAGGACTTCATTA
ATTTACCCGTGAAAGAAATCGTGTCTACTGCAGTACAATTTCTAAAATTA
GAAAAAGTTGAAGCTCAATCTAAAGAGAAATCTGAGCGTGTAGTTAAGGC
CTGGGCATTTTTAAAGTCATTTATTGTGAAAGTCGTTGATGAGCTTGGAT
CAAACGTCAATGTTGGATCTTTTAGTGTAACTAAATTCCGAAAAGTACCG
ATGAGATCTCGTATAGAAGTTGAACCAGGCGAATATCAATGGATCGGTGT
AAATTACGATAGTACTAATGAGCATCAGTACAAATTCACCGATAATGCAT
TTGCGTTTAAAACCCATGAACCCGTAAATTTAATAGATTCTGAATTGATC
TTCATCTCAGAAATGAAAGAATATGATATTGCAAAATCCGCCTTGGTTGG
TTTATTTATCGGATGTCTACACGACCAGATAAGGAAAAACAACATAGATT
TCGTAATTTATCTAGTTCAACAGTTAACAATTTGTGCACTCGCTGAGCAT
TGCAAATATTCTTGTACCGAATCTACAGATTTTAATGATTCAGAGAAAGT
CTCATACTTTTCTGTTACTCGCCTGCTTGTCGATTCAATTACCGAAACAA
TGGCATATGAAGATAAAGATTGTATAAGGATTGGAACCATTTGTCTTGAA
AGAATAACTGCCATTATATTATCTGCTTCTGAAAACAAAATGGCCGCCTC
TAACATGCCGATATTTAATTTATTTGCCCAGCGAATAATTCAATTATTAC
ACAAAACAGCCTGGTATGCCAGGTGGGGAGGATGTGCGATTTTGACGATT
TTAATCCGTGAACTGCATCCCTGTTGGTTATGGGATCACCTTTTAGATTT
CCTCAAGGGATTATTCTATACAATTACCGATCTCAACCTGCAAATCTGTC
AAGGCGCATTAACTATGGCCAAAACCTGTTTGGAATTACTGATAGAATAT
TCTCTGAATGAAATAGGCAAATTAGCAGTACTCGATTCTGGTTCATGCGA
AGATGAACGCATACAAATCAATACTATCTACGAGAAATTAATAGCATCGG
TATGCCAATATGTGATCCATATTCTGTTGAACGAGAACGATTGTGTGAGA
GAGAAAGCCGGTGCAGTGCTGCAACAGTTGTCGAGAATCACCGGTAGAAA
CCTCAACACCCTGTTACAGCCGCATTTGCATGTAGTTTCTGACATATTAC
CACCGACACCAGCGGTTTTCAAGGCCTATCCAATGTCGAAACAAATTGCA
ATTTTAGAAACGAATTACCTATTTGGGAACCATGTGAACTGTGGGAATTG
TGTGCACTACGATATCGATGTAGATAACCATGAGAAATTTATAAACGAGA
TAAGAAATATTCTCGAAACGAGCACGGGCACAGACGAGGAAATAAATGCA
CCGATTATTGGAGGAGCTCCAATGACAAGCGGTGCTCAAACTGTGCCTGG
ATCGATGTCGAATTCCAATATAAATCGAACTACTCATTCTTGTAATAATA
CCAATCAACAGCAGTGCACAGTACGTCAGGCTTGTGCATATACCGATATG
AGCACTGCTGTCGCTCTTAAAGTCGCTGCTTGTAAGCTTTTGTCAACTTT
ATGGTATTTAGATACGGAAAAAGATAAAAACTTTCAAGCGCTATTTAAAG
CTATGTGCTCTAAAGATGTCGAAGTCCATGAAACAGCTTTCAAATGCTTA
CAAGAATTCTTAAGCCACACCAATGTCAGTCTTGAATTACGAAATGCAAA
TCTCAAACCACTATTGACGACATTCCGTGAAAATTATACTCTGGCAACAA
ATCGGCAATTATACTTTTGTGCCAGATTGTTTCATGCTAGTTTCAGTGAA
CGCATGTGTGAAAGTCTTCTTGTTACAAAAGTAAAACCAGTGTTAGATAT
TCTTTACGAAAAGTTTGACAAAAATGGATTTATCGATACAGAAAATGATG
AAAAATTTTTATTGTTGATCAAAACTGTTGAATTATTTCATGTTCTTCAT
GCTGCTTCCAATAAATATGTGCAACCGTTAACGGAATTAGTTTTGAAAGT
AGAACAGAAAATATTCTGTTATTCCACCAGCCAGTTGAGGAAGCCGTTGA
TTTTGTATTTGTCAAAATGTCCCACAGAAACTGTGAAACTATTTCTACAA
ACTGTCAACTTTTTCGATGATTTTTATGCCAACAATTTTTTTATCGAATG
TTTAGATCTGAAAGAAGCTAAACCAATACGGGATTATTTACAGAATCAAC
CCGAGTTACTGATAGATCTGATTAATAAAAAGTCGAACGATGATCCTCCT
GTAAATAGCAGAGAATATTTCGATGATATTCCAAATAATTCTACAAGTTT
TAATGTACACCATTTTGCAGTAAAAATTATCCACAAACTCGCTAAATCGA
ACCCCACTTGGTGGTTGAATTCTAAAAGGCTTTCGGAGGCTTTGAATAAA
TATTGGTGTTCATTGGAATTTCAAAGCCGCTTAATGAGGTTCGATAAAAT
ACATTACAGCCATTGGACAGATATAGAAACAATTTTGAATCTGCTACAGT
GTTTTATTGATTATTACCCAGACGCCTACGAGTTTTTGTTTTCAGTAGCT
AGGTCTTTCAAAATGCGAGCTCTTGGTAGTCTTCATAAATTACGACAATT
TCTTACCGACTTATTTGTCAAAAGAAATTATGTCTGGAAACAAAATCTTT
TTCGATATTATATAACTCAAGCACACAACAGAGCTTATACTCCTGATATT
CTCTATATAATCTTTGCCAATATAATATTACCTGCGTTTTGTGTGGCCTT
GGAAACAGTTACTCAACCATCTGAAAAAATTGAACTATTTGGAGGGCCAC
CTAAACCGAATGAAGATGCTGATGATATTGTTGCTATATTTTTAAACAAA
TTGATTGACAACCAAGATTGTGGTGATGGAGGACTTAGAGTTGCATACTG
TCAGTTTTGCATATTAATTCTCGAATACGCCCCAAATTATATCCATGAAA
TCTCTAATAAGAAACAAGGCCACAAAGCGAGAATTATTCTCACATTTGCT
TGGCCGAGTGTCACAAACCAACCTCAATTTACAGATTTATTAGAGAAATA
TGTCGGATTGCAGACGATTGCTTATCTGATAAGCAAATTTAATATCAATA
GAAAGATTATAGTCCGAGTATTCACTTGTCTCGCGAAAGGAAATTGTGTG
GAACCGAAGAAAGTAATCAATGCTGCACTCGGTGTTTTAGTCCCAGCATG
GTTACAAAGGAAAGATGATTTGAATTTTTTGGTTTTACACACGAAAAAGG
TTTCCATGGATGATGTGACTTCTCAGTCACAATTGCACATTGGAAACCTC
ATTGTACGGCATTCTGATATCTATTACCAAGCCAAAATGCATATCCTTCC
TTTAATGCAATACTTCATTTCCAGGCTTAGTAACCAAAATTTTCAACCCG
AACAAAGGCGTTGTCTACTTGATATGATCGAGTTGATTATAAGATGGGAT
ATTAGAACCAAGGAAGAAGCACTTACTGGACTTTCGGCTATTGGGCAAGA
CAAATCCATTAGTGATCAACAGAAAGAATCATTAGCTAACTTAATAGTTC
GTTTGATGGTTCAAATCTTGGATCAAAGTCAAACAAATTCCGCCAATGTT
GACGCATCTTGTAGAAGGGCACTGTTTCTATTGGAAACAGCTTTTCATCC
TTTAGTTTGGGGCCCCATCAATTTAAACATCGAATCACTTTCTCGTTATT
TCAAAATCGAGTTAAATGTAACAAACACCGTGTTAAATCCACAAATCAAT
ACACAATTCAATAATATGGTGATGTGCTTGGATTTCCTGACTACATTTTT
AAAATTAATGGATAGCAACAATATCTTACAAAATATGAAATCGTTCTCGA
AACCTTTGTGCGATATTTTAAACAACCAAAAAGTTGCGCAAAGTCGATTT
ATAAAATTTTTTGGCATGGTTTTGAAAGCGATTCTGTTACGATTTCCTGC
GGAGCCGTCGAATAAACAAAAAATTACACAAAATGTCGAATTAATGGATT
TATATAGTACGGTGCTGAAATTTATCCAGGAAGCATTTAGTTGCTATGAA
CAAAAACCTTCTTCACCGAATTCCAACCGAGTACAATCGGCTCTCTATTT
GCTCAACATGACTCAACAGGCTAAGCAAAACACATATGCTTTTGTTGATA
GATGCTTGATGCATTTGGTAAATATGGCCCATAAATTGGTATCAGAAATT
ATCAAAACCAACAGTCAAAGCGAAGAAGTGGAACAATTGATTGGAGCTAT
CGAAATTATTAAATCTCGATTCAATGTGCTTGGTGCTGATATGCGTCGAA
CCAAAGTGATTCGCATTTTTGTTGATGCCATAATTGTTGTGAAAGACGCT
AAATTATTGAAAGTAGTAATGATGGCTTTAAAAAATTGGATGAAATTGCC
GAAACAAGAAGAACATTTTGCTCCTGGTATTCGAGAAAAATCCGAACTTC
TTGTGAAGTTATGGGGGAAATATCACACTTGGTCCGATAATGCCGATATT
CAAAGGGAAATTCTCAGTGTTCTGTTATTGGTTTTCGAAAACGAGCAATT
GCAGATTGATGATACTAATAATACATTCCAAACTGCATTCTGCACCGGAA
TGGTCAGTCAGTGGACTGATGTCAGGGAAAAGTATCTGGAATTTTACTTG
GAACCGATACGACGAATAAATCTCCTAGAACGATTTTTATTTTTAATTTC
TGCAAATGAATGGGATTCCAGATATTTTAAACTTGTAAATTGGATTCCCA
CGTTTCTTGAAGTTCTTCTGCTTGACATTAAAATCGATGACGATTTCACA
ATAAATTTCAAGTCATTTATGCCGAAAATCAATTGCAAAGAAGAGGACCT
GGATCAACCAATGGATGTCACATCAAGCACTAATTTATCGATTTTTAATG
CAATTTTTGCAAACATGTCTTTTAAAAATGATGAGACAGCTCATCATCCT
TTACTGGAATTGAAATGTGGAAATCTGGTCGACCGAATGTTCAAGAATTC
AATATATGATTATTTCACTGATCAGTATTCGAAAAACAACCCATCAAAAT
TGTCAGTGAATATTCAGAACATTTTGTATCAGCATAATCAAACATGGAAT
AAAGTTAAAAAAGTTCCTGTTGGTGATGTATTATCAAGTGTATTGTTAAT
GAGCTACAATTCCCATCAGCTATCGAGTTCTGTATTCCAATGTATTTTCC
CTCAATTATGGAATCTTCTCCTCAATAAATATCCGGACATGTGGACAATA
GTTAAACAGGAAATGGTCCATTTCCTATCTAATCCTGGCCATAATCAACA
CATAGGACAGTCCACTCCAAATCCGATGACGTGTTTTTTGGAAGCAGTCG
CGAAACTGCCTAATTTCTTTAAATGGTTTCACGATTCAACATTTGTCTTT
CTTGCATCATCGCACAATTTGTGGTTTTTAGGTATTATGGTAATGGAAGA
TTGCCTTTATCGATTTAGTCAACCGGAAAAGTATATTTATACTGGAGTGC
ACAATGTTGTGAATTTCGATGGAATCGAATCGAATGGAATCATTTATAAA
CCCGATTTCTTTCTCAGTTTGAATTGCCTTTATGAGCTATTAGAAGAGGA
AGATTATCAATTTGGTTTGTGGAGTGAAAAATGCGCACTATTAACTACAG
AAATGCAACAAAGCATGGCATTTGCACAACAGGGTCAATATGATAAAGCT
TTGAAAATCAGTGTTGAATCTGGCAGTCAGTCTCTGAATTCCAGTGTCGA
ATATAAAGATATCGTAATGAGACAAAAATTTTACGATTTTAATTATCGCT
ATTTGAAAAAGATAAGTCAATGGGATTCTCTGGATAAGTTTTTAAACGGT
GAAAATGTAAATTATTTAATTAAAGCCGAATCACTCTGGAGAAAAGGCCA
ATGGAAGGATATTATCCAAAATCACAAATTGAATCAAAATAGTGTTCAAG
AAATAGATAAATGGCGATCTCAGTTGATTTATTGTTACTCGTTGATTATG
AATAAAATGACTTCAATGCCCAGTGGGGAAGATGTTTCGAATACGCCTCA
ATTAGACAATGAATTCAATAAAGTAACAGGATTCGTCTTGCAACAATGGA
AATCTCTCCCAAACAATTGTATTATAACTCCACGCCATGTTACAATGTTG
CAAGCTTGCAACCTGGCTGTTGAAGGCTGGGACGGAATGCAACTTTTCTC
TGGAATACATAACAATAACGTATTCAGTGAAGTTAAATCAATGATTAAGT
CTTGGAAAAACAGATTCCCACACCACAGCGATAGTTTTTCATTTTGTAGT
GATATCGTTTTATGGAGGAAAGCCGTTTTTGATAAATTAATCCACATAAC
TGCCAACGCCGCCACAGATTCCTCTCGAGTTTATCGAAATGAGATCTACT
TGCTGCTATTAGAATTAGTACGAAATGGCCGAAAGCAGCATTTGTCTTCT
TGCACCAAACTATATGCTGATAAATTGAAACAACAATTACCTGAAATGGT
ATCCAACTCATTTACTCTTTATAAACAGGAATGTAAAGTGAAAATGTTTG
AAGAAGGCTGGCGACATAGTTACGTTGAATCGTTGGAAATGTTGGAAAAT
GTTGATGCACAAAGATTTAAAGACAAAAGAGATTTGGCGAAATTTTACTG
TTACAAAGCAATGCTGTTTTCTTACTTTAATAAGGGAGATGAAGCTACAC
GGCATTTTGGATATGCTCTTCAAATTGATGCATACAATAATAAAATCTGG
AGTATTTATGCGGATTTCTTGGAAAACGTTTTTTCAAATTATCCCGGAGA
GCGTAGGCAGAGAGCTAGTCATACGACTGGAATCTTCGCTATTACCGCAC
TTGTTGAAGCTGCGTCTGCATTAAAAGCTCCTGGATCGACTTCAAGTAAT
CATTTAAGAGATGACAAAGTCTGTTCCAATTTAGCCAAATGTCTTTGGCT
AGTCACTCTTGATGATAGTCAACTACTAATGTCAAGGCATCTAGAAGAAA
TGAGTAATAAATTGCCGGCTTCTATTCTACTTCCTTGGGCTCGCAGCATT
GTCACATGCTTACTGAGACCAGAGGGCAAATATGTCGTGTCAATGCTAAT
CAGATTAGCCAATGAATTTCCTGAAGCAGTTTATCAGTCTTTTAGATGCC
TTAGAGATAAATTAATTCGTGAGCTTTCATATTCCGATCCTTCAGACAGT
AATAATCAATCGGAGGAAATAAAATTGTATGAGAATGTGCTAGCTCAAAT
GAAAAAGAGTAACGGATCGAAATTATATTTGGTGGATGAATTCTGTAAAC
AACTGGAATGGTTATGTCCGAGTTGGAGTGAGCAACTGTTGGCTCAAATA
GTGTCGATCACCTCGAGATTAAATGACTACATCTATGATGTGTTGATGTC
TAGCAGCTTTTTCAGTCCCGATGAGAAACTACCTGATTGTTTTCTAGTTG
AGCTTCATAATCTGGGAATGCTTCTGGATTTTTCCACAGATGCCAGCATG
GATATCGACAATGAAGACCCGTGTTCGAATATTAACCGACTTTGGTCGAT
ATGGTTGTCTATGACCAATAATGATGTCGTAACTGCCCGCTATCATTCCT
ACTTGAATTCGCGTTATTGTCAAGATATTCGAGTGAAATTCAGCAACGAT
TTCGGAAATTCTAAAGCCTTATACTTAATGCCAACTCTCAATAAATTGAA
AAAAGTTTGGATTCCTCTACTGAGACGAATCGTTCATTTGCAAGGAAAAA
CTAGCTATTTGGATGAGAGAACTCGACTGCTTACGGAAATTGCTCAGTCA
AGTTGTGATCTCAGCCTTCCTGGAGATCTCAGTGTCATTAAGAGGAAGGA
ACATCATCTTCATATTGCTACTGTGAGTCCATTAGTCGAACGAGTTTGGA
ATAATGGACAATTCTGTCGACGTATTAGAATCCGTGCAAGCAACGGACAT
AATTTTGAATACTTTATTCAATCATCAACAATTGATTTACAGTCGTTAGT
AATCGATTCCAAAAACGATGGATGTGCAATTTACAAATTTTGGATGCAGG
AAAAACTTTTTCAAATTTTCAGAGTTCTTAATGAAAGTCTGAATAAAGAA
AGAGAATCCTGTCGACGTGGATTAAATCTTCATTCACCGAGATTAATGGA
AATAAATTGTCGTGGTACACATTTGCGAGAAGTCGGATGTGGAATGAATC
CTATTTTACAGAAAGATGTTGATTCGGAAAATTGTCGGATAGTTTCTTTG
GAAGATATTTGGCATTGGTATTGTAATAATAAAATCGAGCATTTGCAATC
AAAGGTGAAAAAGAATCGCAGTATTCCAAGCCAAATGAAAGAGAAAGATG
ACGACCAGATTTTACTGGATTTGGAGGTTCTTTTAGATCCGGAAAAGGCA
TTATTAACATTTATGAATGAAGAAAAAACTAGAAATAACCTTCCAATGAG
CAAGAAAATTATAAACTGTTATAATCGCATTTCCCAATGTACAAAAGATG
AAGCCGTTATAAAATTTGCCCAAGTATTCTGTGTAGGTCCAGAAGATTAT
TGGGTATTACGGAAGCAATTAACGAATGATTTCGCGGTTTTGAATATGAT
CCAGTATCTCATGCAAATCTCATCTCTGAAGGCATCCCAATACGTTATTG
ATCTCCGTAAAGCCACACTGCAAATCAGTTCACCACAACTCCATTTATCA
GAAGACGCTCACCTAGAAAACCTTTCAAGCCTTCCGTTCAGATTAAGCCC
AAATATTGTTAGGTTTTTGCAACCGAGTGGGCAGAGTGAAAGTCTATGGA
AAACATCCAGTCAACCGCTTACTGCTAGTATGATAGCTACGGGAAATGTC
CTCTATTGTTGTCGAAATAACATTATGGCTTTGATAAGGGCTCTTTTGCG
CGATTACTTTATTTTGTGGCACAAATATCTCGTTAATAACCACGAGAAAA
AAGACATGTATTCAGCTGAACTGGAAAATTGCATTCTCGAGAAATGGTTG
TCTTCGGCATCAGAACAGATCTACAATAGGATTTCGACTGTAGGTCGAAT
GGATGATGATTCTATAACAAGGGACAAAATCCAGAACTCCCTCGATCCTT
TGAACCAAGCTTTAATGAAACCCAGTCATCAAATATGGATTTAAGTGCGA
GATCGGAAGAG
back to top

protein sequence of SMED30030865-orf-1

>SMED30030865-orf-1 ID=SMED30030865-orf-1|Name=SMED30030865-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=4009bp
MSEVIGSHHQISLKEKLIIFFDDAKEIDLRLKAAQEFSDAFEYSAQNSDY
PEVLKELYERSQKFLMQTEPQFLQENPLQQLRKQCLELFQKVPHNEHNKQ
YSKLFMNVLMKLVEYENEENTMICVKLLVDIHKSQRPNFSNEVINFLKFV
RNVYKELQNHTNKIFTHSPFYEIDSIDEFPIETKVLETFTVTKIHTKQKD
MNDNKIDFNILPKSCYSLKVMQEIPVLLVLMYQFHKSYITNEIASFIPLI
MEFLNLIPSEAQKKDEHFNETLYLDFLAAQVKTLSFLAYVVKFFKKPLME
KYADSLVQGMYRMIVNIPSNVTNMRKEYFIAARHILGTQEIKPRFVKVLS
DLMNEDILIGNGYTVNQLLRPLAYSTLADLIHFVKSELNLAKIAKATNMY
IKNMHDDTLVFSIQQMSMKLLLNFIEPIKNRITHNPQELNEGRELLIKIL
YALVKRLGTISKHYLPKLEKGCLVETNEKQPITEESEVKVKTEETTEEDR
LKLPTLPKIDEKPIKPEHNLVLPTLTLQDFKILTKHLIHGIKTITLTITS
SNKLVASTSSVSRQESVSGTISNFDIQPSHKDKFLDGFDVKIYCKLIRYC
LRMMDLYLIYYKDGQLYQRPPSTALNAKFIDEKSILEIIGVIFLNLSPAN
FKEVFQTQIKYIIERANVNSCIVQLFQIILSSSQEEHPTNSAILANLILS
YLLDNMEIIGEGTPEASLHTRLFKQIFNSVHTNLVCFENVLEVHLKRIVL
GCMKYALSAKDPSSFMCLLRYLFRSIGGGAHERLYREFLPLLPLMLTGLS
SLLRSPHTNQVRDLLGELCVIVPVRLSTLLPHLSLLMEPLVHVLSCNTIS
QGLRTLELCVDNMSPEYLYQNMYPVRGDIMFAMLQSFRCKSEQVNRTAFK
VLGKMGRYNRCDLLESQQIQFDSWQNQTGPEINIRFTEFPEDFINLPVKE
IVSTAVQFLKLEKVEAQSKEKSERVVKAWAFLKSFIVKVVDELGSNVNVG
SFSVTKFRKVPMRSRIEVEPGEYQWIGVNYDSTNEHQYKFTDNAFAFKTH
EPVNLIDSELIFISEMKEYDIAKSALVGLFIGCLHDQIRKNNIDFVIYLV
QQLTICALAEHCKYSCTESTDFNDSEKVSYFSVTRLLVDSITETMAYEDK
DCIRIGTICLERITAIILSASENKMAASNMPIFNLFAQRIIQLLHKTAWY
ARWGGCAILTILIRELHPCWLWDHLLDFLKGLFYTITDLNLQICQGALTM
AKTCLELLIEYSLNEIGKLAVLDSGSCEDERIQINTIYEKLIASVCQYVI
HILLNENDCVREKAGAVLQQLSRITGRNLNTLLQPHLHVVSDILPPTPAV
FKAYPMSKQIAILETNYLFGNHVNCGNCVHYDIDVDNHEKFINEIRNILE
TSTGTDEEINAPIIGGAPMTSGAQTVPGSMSNSNINRTTHSCNNTNQQQC
TVRQACAYTDMSTAVALKVAACKLLSTLWYLDTEKDKNFQALFKAMCSKD
VEVHETAFKCLQEFLSHTNVSLELRNANLKPLLTTFRENYTLATNRQLYF
CARLFHASFSERMCESLLVTKVKPVLDILYEKFDKNGFIDTENDEKFLLL
IKTVELFHVLHAASNKYVQPLTELVLKVEQKIFCYSTSQLRKPLILYLSK
CPTETVKLFLQTVNFFDDFYANNFFIECLDLKEAKPIRDYLQNQPELLID
LINKKSNDDPPVNSREYFDDIPNNSTSFNVHHFAVKIIHKLAKSNPTWWL
NSKRLSEALNKYWCSLEFQSRLMRFDKIHYSHWTDIETILNLLQCFIDYY
PDAYEFLFSVARSFKMRALGSLHKLRQFLTDLFVKRNYVWKQNLFRYYIT
QAHNRAYTPDILYIIFANIILPAFCVALETVTQPSEKIELFGGPPKPNED
ADDIVAIFLNKLIDNQDCGDGGLRVAYCQFCILILEYAPNYIHEISNKKQ
GHKARIILTFAWPSVTNQPQFTDLLEKYVGLQTIAYLISKFNINRKIIVR
VFTCLAKGNCVEPKKVINAALGVLVPAWLQRKDDLNFLVLHTKKVSMDDV
TSQSQLHIGNLIVRHSDIYYQAKMHILPLMQYFISRLSNQNFQPEQRRCL
LDMIELIIRWDIRTKEEALTGLSAIGQDKSISDQQKESLANLIVRLMVQI
LDQSQTNSANVDASCRRALFLLETAFHPLVWGPINLNIESLSRYFKIELN
VTNTVLNPQINTQFNNMVMCLDFLTTFLKLMDSNNILQNMKSFSKPLCDI
LNNQKVAQSRFIKFFGMVLKAILLRFPAEPSNKQKITQNVELMDLYSTVL
KFIQEAFSCYEQKPSSPNSNRVQSALYLLNMTQQAKQNTYAFVDRCLMHL
VNMAHKLVSEIIKTNSQSEEVEQLIGAIEIIKSRFNVLGADMRRTKVIRI
FVDAIIVVKDAKLLKVVMMALKNWMKLPKQEEHFAPGIREKSELLVKLWG
KYHTWSDNADIQREILSVLLLVFENEQLQIDDTNNTFQTAFCTGMVSQWT
DVREKYLEFYLEPIRRINLLERFLFLISANEWDSRYFKLVNWIPTFLEVL
LLDIKIDDDFTINFKSFMPKINCKEEDLDQPMDVTSSTNLSIFNAIFANM
SFKNDETAHHPLLELKCGNLVDRMFKNSIYDYFTDQYSKNNPSKLSVNIQ
NILYQHNQTWNKVKKVPVGDVLSSVLLMSYNSHQLSSSVFQCIFPQLWNL
LLNKYPDMWTIVKQEMVHFLSNPGHNQHIGQSTPNPMTCFLEAVAKLPNF
FKWFHDSTFVFLASSHNLWFLGIMVMEDCLYRFSQPEKYIYTGVHNVVNF
DGIESNGIIYKPDFFLSLNCLYELLEEEDYQFGLWSEKCALLTTEMQQSM
AFAQQGQYDKALKISVESGSQSLNSSVEYKDIVMRQKFYDFNYRYLKKIS
QWDSLDKFLNGENVNYLIKAESLWRKGQWKDIIQNHKLNQNSVQEIDKWR
SQLIYCYSLIMNKMTSMPSGEDVSNTPQLDNEFNKVTGFVLQQWKSLPNN
CIITPRHVTMLQACNLAVEGWDGMQLFSGIHNNNVFSEVKSMIKSWKNRF
PHHSDSFSFCSDIVLWRKAVFDKLIHITANAATDSSRVYRNEIYLLLLEL
VRNGRKQHLSSCTKLYADKLKQQLPEMVSNSFTLYKQECKVKMFEEGWRH
SYVESLEMLENVDAQRFKDKRDLAKFYCYKAMLFSYFNKGDEATRHFGYA
LQIDAYNNKIWSIYADFLENVFSNYPGERRQRASHTTGIFAITALVEAAS
ALKAPGSTSSNHLRDDKVCSNLAKCLWLVTLDDSQLLMSRHLEEMSNKLP
ASILLPWARSIVTCLLRPEGKYVVSMLIRLANEFPEAVYQSFRCLRDKLI
RELSYSDPSDSNNQSEEIKLYENVLAQMKKSNGSKLYLVDEFCKQLEWLC
PSWSEQLLAQIVSITSRLNDYIYDVLMSSSFFSPDEKLPDCFLVELHNLG
MLLDFSTDASMDIDNEDPCSNINRLWSIWLSMTNNDVVTARYHSYLNSRY
CQDIRVKFSNDFGNSKALYLMPTLNKLKKVWIPLLRRIVHLQGKTSYLDE
RTRLLTEIAQSSCDLSLPGDLSVIKRKEHHLHIATVSPLVERVWNNGQFC
RRIRIRASNGHNFEYFIQSSTIDLQSLVIDSKNDGCAIYKFWMQEKLFQI
FRVLNESLNKERESCRRGLNLHSPRLMEINCRGTHLREVGCGMNPILQKD
VDSENCRIVSLEDIWHWYCNNKIEHLQSKVKKNRSIPSQMKEKDDDQILL
DLEVLLDPEKALLTFMNEEKTRNNLPMSKKIINCYNRISQCTKDEAVIKF
AQVFCVGPEDYWVLRKQLTNDFAVLNMIQYLMQISSLKASQYVIDLRKAT
LQISSPQLHLSEDAHLENLSSLPFRLSPNIVRFLQPSGQSESLWKTSSQP
LTASMIATGNVLYCCRNNIMALIRALLRDYFILWHKYLVNNHEKKDMYSA
ELENCILEKWLSSASEQIYNRISTVGRMDDDSITRDKIQNSLDPLNQALM
KPSHQIWI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0005488binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006355regulation of transcription, DNA-templated
GO:0016310phosphorylation
GO:0016573histone acetylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR033317TRA1/TRRAP
IPR013202Kinin_peptide
IPR003822PAH
IPR003151PIK-rel_kinase_FAT
IPR014009PIK_FAT
IPR011009Kinase-like_dom_sf
IPR016024ARM-type_fold
IPR000651Ras-like_Gua-exchang_fac_N
Vocabulary: cellular component
TermDefinition
GO:0000123histone acetyltransferase complex
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003151PIK-related kinase, FATPFAMPF02259FATcoord: 2919..3245
e-value: 8.8E-9
score: 35.0
NoneNo IPR availablePANTHERPTHR11139ATAXIA TELANGIECTASIA MUTATED ATM -RELATEDcoord: 23..4007
IPR033317Transcription-associated protein 1PANTHERPTHR11139:SF1TRANSFORMATION/TRANSCRIPTION DOMAIN-ASSOCIATED PROTEINcoord: 23..4007
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 3559..3937
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 11..915
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 1149..1804