Multidrug and toxin extrusion protein

Overview
NameMultidrug and toxin extrusion protein
Smed IDSMED30030864
Length (bp)1955
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Multidrug and toxin extrusion protein (SMED30030864) t-SNE clustered cells

Violin plots show distribution of expression levels for Multidrug and toxin extrusion protein (SMED30030864) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Multidrug and toxin extrusion protein (SMED30030864) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Multidrug and toxin extrusion protein (SMED30030864) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030864

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30030864SMESG000005477.1 PL06010B2A07ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030864SMESG000005477.1 SMESG000005476.1 PL08003B1C08ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30030864SMESG000005477.1 dd_Smed_v4_2361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030864SMESG000005477.1 SMESG000005476.1 Contig27357newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30030864SMESG000005477.1 dd_Smed_v6_2361_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A1 (solute carrier family 47 member 1 [Source:HGNC Symbol;Acc:HGNC:25588])

HSP 1 Score: 294.664 bits (753), Expect = 6.664e-91
Identity = 168/476 (35.29%), Postives = 263/476 (55.25%), Query Frame = 3
Query:   90 PASIRKQQEG-IQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACF-----HLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRIN 1499
            PA +R   E  ++V G +        +  EL+ L  LA P  L+ L  FL   IS + CGHL K E DA +LA  +I V G S+  G S+ACDTL SQ YGS N K +G++LQR+ +V     L+L CF      LN + IL+   QD ++SR+T TYVT+++P L   F +M   +YL +Q IV P + +   A L N +  Y+ ++ L  G+  SA+        +  +   YI   K+++ TW G+     LQ W SF +L +P ++M+ +E W +EVGSFL+G +  V+LG QSI  + A + YM+ AG S+A ++R+G  LGA +  +A  S+  ++L   + A+  + +LLS K ++ YIFT D +I  +   ++ +  +    +A   ++G V+R  G Q  GAI+    YY +G+PIGI L+F     + G W G++I    +   ++     +NW+K   +A +  N
Sbjct:    7 PAPVRGGPEATLEVRGSRCLRL--SAFREELRALLVLAGPAFLVQLMVFLISFISSVFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSALV-----LLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKLHQATWGGWSL-ECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVGLPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHAN 474          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A1 (solute carrier family 47 member 1 [Source:HGNC Symbol;Acc:HGNC:25588])

HSP 1 Score: 294.664 bits (753), Expect = 9.273e-91
Identity = 164/471 (34.82%), Postives = 260/471 (55.20%), Query Frame = 3
Query:   90 PASIRKQQEG-IQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRIN 1499
            PA +R   E  ++V G +        +  EL+ L  LA P  L+ L  FL   IS + CGHL K E DA +LA  +I V G S+  G S+ACDTL SQ YGS N K +G++LQR+ +V+ +         LN + IL+   QD ++SR+T TYVT+++P L   F +M   +YL +Q IV P + +   A L N +  Y+ ++ L  G+  SA+        +  +   YI   K+++ TW G+     LQ W SF +L +P ++M+ +E W +EVGSFL+G +  V+LG QSI  + A + YM+ AG S+A ++R+G  LGA +  +A  S+  ++L   + A+  + +LLS K ++ YIFT D +I  +   ++ +  +    +A   ++G V+R  G Q  GAI+    YY +G+PIGI L+F     + G W G++I    +   ++     +NW+K   +A +  N
Sbjct:    7 PAPVRGGPEATLEVRGSRCLRL--SAFREELRALLVLAGPAFLVQLMVFLISFISSVFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSALVLLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKLHQATWGGWSL-ECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVGLPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHAN 474          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A2 (solute carrier family 47 member 2 [Source:HGNC Symbol;Acc:HGNC:26439])

HSP 1 Score: 266.159 bits (679), Expect = 4.578e-80
Identity = 160/486 (32.92%), Postives = 257/486 (52.88%), Query Frame = 3
Query:  129 YGG---KLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHA--------------GLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWE---KEASKAAIRINEAKLSECQT 1526
            +GG    L   +   +  E+  L  L+ P+ L  +  F+   +S + CGHL K E  + +LA   + V G S+ +G S+ACDTL SQ +GS N+K +G++LQR  +V+ +  L      LN + IL+   QD ++SR+T  YV +++PGL   F +   ++YLQ+Q I +P + S  +    N V  Y  + VL  G+  SA              L YI + K++  TW G+  S  LQ W  FF L +P ++MI VE W +E+GSFL G ++ V L  Q++  + A + YM H+              GLSI V +R+G  LGA +  +A  SA + +L+    +++  T++  LK+ L +IFTNDE++  +   +L +  +    +A     G V+R  GKQ  GA +   +YY IG+P+GI+L FVV   I G W+G+L  + +  A ++     ++W+   +EA K + R  + +     T
Sbjct:   12 HGGCCPALSRLVPRGFGTEMWTLFALSGPLFLFQVLTFMIYIVSTVFCGHLGKVELASVTLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLLLCCLPCWALFLNTQHILLLFRQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQKITWPQVLSGVVGNCVNGVANYALVSVLNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWS-SQCLQDWGPFFSLAVPSMLMICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMRHSHRLAYAAHVTRIPLGLSIGVCVRVGMALGAADTVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVFEAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFLATAAFVAYTARLDWKLAAEEAKKHSGRQQQQRAESTAT 496          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A2 (solute carrier family 47 member 2 [Source:HGNC Symbol;Acc:HGNC:26439])

HSP 1 Score: 254.603 bits (649), Expect = 1.820e-75
Identity = 160/508 (31.50%), Postives = 256/508 (50.39%), Query Frame = 3
Query:  129 YGG---KLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQ------------------------------------NIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWE---KEASKAAIRINEAKLSECQT 1526
            +GG    L   +   +  E+  L  L+ P+ L  +  F+   +S + CGHL K E  + +LA   + V G S+ +G S+ACDTL SQ +GS N+K +G++LQR  +V+ +  L      LN + IL+   QD ++SR+T  YV +++PGL   F +   ++YLQ+Q                                     I +P + S  +    N V  Y  + VL  G+  SA              L YI + K++  TW G+  S  LQ W  FF L +P ++MI VE W +E+GSFL G ++ V L  Q++  + A + YMI  GLSI V +R+G  LGA +  +A  SA + +L+    +++  T++  LK+ L +IFTNDE++  +   +L +  +    +A     G V+R  GKQ  GA +   +YY IG+P+GI+L FVV   I G W+G+L  + +  A ++     ++W+   +EA K + R  + +     T
Sbjct:   12 HGGCCPALSRLVPRGFGTEMWTLFALSGPLFLFQVLTFMIYIVSTVFCGHLGKVELASVTLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLLLCCLPCWALFLNTQHILLLFRQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQGWLKGQEEESPFQTPGLSILHPSHSHLSRASFHLFQKITWPQVLSGVVGNCVNGVANYALVSVLNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWS-SQCLQDWGPFFSLAVPSMLMICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVCVRVGMALGAADTVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVFEAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFLATAAFVAYTARLDWKLAAEEAKKHSGRQQQQRAESTAT 518          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A1 (solute carrier family 47 member 1 [Source:HGNC Symbol;Acc:HGNC:25588])

HSP 1 Score: 234.187 bits (596), Expect = 1.924e-69
Identity = 147/439 (33.49%), Postives = 230/439 (52.39%), Query Frame = 3
Query:   90 PASIRKQQEG-IQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACF-----HLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRG 1388
            PA +R   E  ++V G +        +  EL+ L  LA P  L+ L  FL   IS + CGHL K E DA +LA                          YGS N K +G++LQR+ +V     L+L CF      LN + IL+   QD ++SR+T TYVT+++P L   F +M   +YL +Q IV P + +   A L N +  Y+ ++ L  G+  SA+        +  +   YI   K+++ TW G+     LQ W SF +L +P ++M+ +E W +EVGSFL+G +  V+LG QSI  + A + YM+ AG S+A ++R+G  LGA +  +A  S+  ++L   + A+  + +LLS K ++ YIFT D +I  +   ++ +  +    +A   ++G V+R  G Q  GAI+    YY +G+PIGI L+F     + G
Sbjct:    7 PAPVRGGPEATLEVRGSRCLRL--SAFREELRALLVLAGPAFLVQLMVFLISFISSVFCGHLGKLELDAVTLAIAT-----------------------YGSQNLKHVGVILQRSALV-----LLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKLHQATWGGWSL-ECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVGLPIGIALMFATTLGVMG 414          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Match: BX248108.1 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:560089])

HSP 1 Score: 304.294 bits (778), Expect = 1.170e-94
Identity = 168/526 (31.94%), Postives = 283/526 (53.80%), Query Frame = 3
Query:  138 KLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFH-----LNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGHKRPTSSVTDIIISKSIHE 1700
            KLR  L   Y  E+ +L KLA P+ +  L  FL   +S + CGHL KTE    +LA  +I V G SI  G ++ACDTL SQ +GS+N KR+G++LQR +++     L+LACF      +N EPIL+ + Q   ++ ++  YV +++P L   F +     YLQ+Q I++P + +     + N ++ Y+ +Y+L  G+  SA   A     +  I  TYI    ++K TW G+ + + LQ W SF +L LP ++M+  E WT+E+G FLAG I++V+LG QSI  + A + YM   G ++A  +R+G  LGA    +A LSAK +++   + + +   ++    + + YIF+ DE+I +    ++++ G +   DA+ + TG ++R  GKQ  GA+     YY +G PIG+ L+F     I G W+G    + ++   ++ + + ++W+K   +A IR    +L+E + +   +    E       +   +  E +   N  L    G  +    +TD +   ++ E
Sbjct:   38 KLRRLLPVNYKEEVMQLLKLAGPVFISQLMIFLISFVSTVFCGHLGKTELAGVALAIAVINVTGISIGSGLASACDTLISQTFGSNNLKRVGVILQRGILI-----LLLACFPCWALLINTEPILLAVRQSPNVASLSQLYVKIFMPALPATFMYQLQGLYLQNQGIIWPQVITGAAGNILNALINYVFLYLLDLGVPGSAAANAISQYSLAVILYTYIRCMGLHKATWDGWSW-DCLQEWGSFIRLALPSMLMLCAEWWTYEIGGFLAGLISEVELGAQSIVYELASVMYMFPLGFAVAAGVRVGNALGAGNTEQAKLSAKVSLVCGLLVSSVIAVVIAGTNNIIGYIFSKDEDIVLRVSQVMVMYGFVHLFDATSAITGGIVRGAGKQQIGALCNMVGYYCVGFPIGVSLMFAFNMGIVGLWIGFFTCVFLQSLFFIILIYRLDWKKATQEALIRAG-VQLTEIKYESFGL----ENKGCTEEAAQENTEEGQTDTNTDL---EGLSKGEGGITDAVALVTVGE 549          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Match: slc47a2.1 (solute carrier family 47 member 2.1 [Source:NCBI gene;Acc:560024])

HSP 1 Score: 303.908 bits (777), Expect = 1.882e-94
Identity = 162/508 (31.89%), Postives = 276/508 (54.33%), Query Frame = 3
Query:  138 KLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFH-----LNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGH 1646
            KLR+ L   Y  E+ EL KLA P+ +  L  FL   +S + CGHL KTE    +LA  +I V G SI  G ++ACDTL SQ +GS+N KR+G++LQR +++     L+LACF      +N EPIL+ + Q   ++ ++  YV +++P L   F +    RYLQ+Q I++P + +     + N ++ Y+ +++L  G+  SA         +      YI    ++K TW G+   + LQ W +F +L LP ++M+ VE WT+E+G FLAG I++ +LG QS+  + A + YM   G ++A ++R+G  LGA    +A LSAK  ++   + + +  T++   K  + YIFT +EEI      ++++ G     DA    TG ++R  GKQL GA+     YY +G P G+ L+F ++  I G W+G    + ++   ++ + + ++W+K   +A IR    +L+E + +   ++           S++ ++   + + +   L + G 
Sbjct:   40 KLRSLLPVNYKTEIVELLKLAGPVFISQLMIFLISFVSTVFCGHLGKTELAGVALAIAVINVTGISIGSGLASACDTLISQTFGSNNLKRVGVILQRGILI-----LLLACFPCWALLINTEPILLAVRQSPNVASLSQLYVKIFMPALPAAFMYQLQGRYLQNQGIIWPQVITGAAGNILNALINYVFLHLLELGVAGSAAANTISQYSLAVFLYVYIRWKNLHKATWDGWS-RDCLQEWGAFIRLALPSMLMLCVEWWTYEIGGFLAGLISETELGAQSVVYELATIAYMFPLGFAVAASVRVGNALGAGNTERAKLSAKVALVCGVLVSCVVATLIGCTKDVIAYIFTTEEEIVSRVSQVMIMYGFFHLFDAIAGITGGIVRGAGKQLLGALCNIVGYYFVGFPTGVSLMFALSMGIIGLWIGFFGCVFLQSLFFIILIYKLDWKKATQEALIRAG-VQLTETKDESFGLENKGCTEEAAKESQITEEGLTDANTDLEGLSKGGE 540          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Match: slc47a3 (solute carrier family 47 member 3 [Source:ZFIN;Acc:ZDB-GENE-130530-755])

HSP 1 Score: 299.286 bits (765), Expect = 4.527e-93
Identity = 159/453 (35.10%), Postives = 260/453 (57.40%), Query Frame = 3
Query:  147 NWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEA 1505
            ++L   Y  E   +  LA+P+ L  LF +L    S + CGHL K E D  +LA  +I V G  I  G S ACDTL SQ YG+ N +++G++ Q+A+I++ +T L      +N E IL+   Q  E++R++  YV ++LPGL   + F+   +YLQ+Q I +P++ +  +A + N ++ YI ++VL  G+  SA         + TI   YI    +YK TW+G+   + LQ W+SF  L +P ++M+  E WT+E+G  LAG I++V+LG QS+    A + YM   G SIA ++R+G  +GA + ++A LSAK +++     A++  T++   K+ +  IFTND++I      +++L       DA+ ++  ++++  GKQ  GAI     YY IG PIGI L+F     I G W+GLL+ + ++   ++ +   +NW+K + +A IR   A
Sbjct:   22 SFLPVDYTREFVSMCTLAFPVFLAILFDYLILFTSSVFCGHLGKLELDGVTLAVAVINVLGVGIGFGLSAACDTLISQTYGAGNLQQVGVITQKAIIILLLTCLPCCAILINTESILLLAGQSPEVARVSQLYVNVFLPGLPAVYMFIVQVKYLQNQGIFWPLVITGVVANILNALINYILLFVLNMGVEGSAAANTISQYSLATILFIYIRWKGLYKETWKGWSM-DCLQEWDSFIYLAIPSMLMMCGEWWTYEIGGLLAGLISEVELGAQSVMYGLANIAYMFPIGFSIAGSVRVGNAMGAGDVAQAKLSAKVSIMCAVSVAVVLATVIGCSKNVIARIFTNDKDIIQRVATVMVLYTPFHIFDATTAAGSSIVKGLGKQKLGAICNLLGYYGIGCPIGIPLMFAAKMGIFGLWIGLLVSVFLQSIFFIVLLVKLNWKKASEEAQIRAGVA 473          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Match: slc47a4 (solute carrier family 47 member 4 [Source:ZFIN;Acc:ZDB-GENE-130530-865])

HSP 1 Score: 268.47 bits (685), Expect = 9.549e-81
Identity = 152/461 (32.97%), Postives = 248/461 (53.80%), Query Frame = 3
Query:  135 GKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASA----IIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEA 1505
            G +R  +   Y  EL  + ++  P+++     FL   +  + CG L  T     ++A+  I V   +  LG + ACDTL SQ +GS N  R+G++LQR ++++T+  L      +N +P+L++L Q+ E++R+   YV +YLP +   F +     YLQ+Q ++ P M++S +A + N++  Y  +Y   FG+  SA      Q F C  +F     +I   K+++ TW G+    ALQ W S+ KL +P  +M   E W +EVG FLAG +++V L  Q + I  A++ YMI  G+  A  +R+G  LGA E + A L++K ++++  + AI+   +L S K  + YIFT+DE I  +   +L +   LQF +        V+   G+Q   AI   F YY IG+P  IVL+F     + GFW+GLLI + +    +    F +NW+K   +A  R  ++
Sbjct:   23 GFMRRCIPLVYREELYHILRMTGPLLVCRFLNFLLFFVVTMFCGRLGNTVLAGYAMASATINVTAAATGLGLALACDTLVSQTFGSKNLLRVGIILQRGIVILTLFSLPCWALLVNTQPLLLYLGQEPEVARIAQLYVVVYLPAIPAMFLYQLQLSYLQNQGVIKPQMYASAVANVANVIANYFLLYWWDFGVYGSAAANTFAQVFNCFALFC----FIRWQKLHEKTWGGWSLE-ALQDWGSYMKLAIPSTLMTCFEWWIYEVGGFLAGMLSEVDLAAQHVVIMLAYINYMIPLGMQGAACVRVGNALGAGETAAAILTSKVSLISAAVIAIIQGFVLGSTKTVIGYIFTSDESITELVSQLLNIYCPLQFFNGILCVGMGVLLGTGQQKIAAIANLFGYYCIGLPSSIVLMFTAGLQVAGFWLGLLIAVFLLAIFFTVAIFKLNWKKMTEEAIARTGKS 478          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Match: slc47a3 (solute carrier family 47 member 3 [Source:ZFIN;Acc:ZDB-GENE-130530-755])

HSP 1 Score: 256.529 bits (654), Expect = 7.766e-79
Identity = 135/389 (34.70%), Postives = 226/389 (58.10%), Query Frame = 3
Query:  315 IQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASK 1481
            I V G  I  G S ACDTL SQ YG+ N +++G++ Q+A+I++ +T L      +N E IL+   Q  E++R++  YV ++LPGL   + F+   +YLQ+Q I +P++ +  +A + N ++ YI ++VL  G+  SA         + TI   YI    +YK TW+G+   + LQ W+SF  L +P ++M+  E WT+E+G  LAG I++V+LG QS+    A + YM   G SIA ++R+G  +GA + ++A LSAK +++     A++  T++   K+ +  IFTND++I      +++L       DA+  +  ++++  GKQ  GAI     YY IG PIGI L+F     I G W+GLL+ + ++   ++ +   +NW+K + +
Sbjct:    1 INVLGVGIGFGLSAACDTLISQTYGAGNLQQVGVITQKAIIILLLTCLPCCAILINTESILLLAGQSPEVARVSQLYVNVFLPGLPAVYMFIVQVKYLQNQGIFWPLVITGVVANILNALINYILLFVLNMGVEGSAAANTISQYSLATILFIYIRWKGLYKETWKGWSM-DCLQEWDSFIYLAIPSMLMMCGEWWTYEIGGLLAGLISEVELGAQSVMYGLANIAYMFPIGFSIAGSVRVGNAMGAGDVAQAKLSAKVSIMCAVSVAVVLATVIGCSKNVIARIFTNDKDIIQRVATVMVLYTPFHIFDATTVAGSSIVKGLGKQKLGAICNLLGYYGIGCPIGIPLMFAAKMGIFGLWIGLLVSVFLQSIFFIVLLVKLNWKKASEE 388          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Xenopus
Match: tmed6 (transmembrane p24 trafficking protein 6 [Source:Xenbase;Acc:XB-GENE-967876])

HSP 1 Score: 271.166 bits (692), Expect = 2.639e-82
Identity = 155/448 (34.60%), Postives = 243/448 (54.24%), Query Frame = 3
Query:  174 ELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSE 1517
            ELK L  ++ P+VL  L       I+ + CGHL K+E DA +L N I+ + G SI LG  +ACDT FSQIYG  N K +G++LQR +++++++      F +N + IL+ L QD  ++R+   YV   +P L     F    RYLQ+Q I++P +  S +AC+ N ++ Y+ ++VL  G+  +AI      +    I   YIW+ KI+  TW G+     L+ W SFF L LP ++M+ ++ WTFE+   L+G IN V+LGGQSI  Q   L   I   LS+A  IR+G +LGA E  +A  SA+ + +       L   +L+ L+  +  IFTND  I  +  +I+ L  + Q + ++ +    ++R  G Q  GA +    Y  I  P+ + L+F     ++GFW G+  GL +   +++   +  NW+    KA  R    +L E
Sbjct:   27 ELKILVSISGPLVLTYLLDVAPILITTVFCGHLGKSELDAFALGNSIVILAGQSIGLGICSACDTFFSQIYGGKNLKLIGVVLQRGILILSLSCFPCWAFFVNTKNILLLLGQDPSVARLAELYVLTCIPALVGINFFNLEIRYLQNQGIIWPQVVVSFLACIINGILNYVLLFVLKIGVIGAAIAVTVSIVSKVIILFFYIWIRKIHVDTWPGWT-KECLKDWGSFFALALPTMIMLSLKWWTFEIAIILSGLINLVELGGQSIMHQIMNLLNKISLALSLASCIRVGTYLGAGETEQAKRSARLSFVISAFPVFLGVGLLIGLRREIASIFTNDSSILFLVSDIMPLCAVFQIVGSACNLFYGILRGIGMQKVGAFVTVGGYLLIVFPMAVPLMFPAKLGVKGFWTGINAGLAVMDIVFVIYLWKANWKLITEKALERAGLKELKE 473          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Xenopus
Match: slc47a2 (solute carrier family 47 (multidrug and toxin extrusion), member 2 [Source:NCBI gene;Acc:100125051])

HSP 1 Score: 233.032 bits (593), Expect = 1.271e-67
Identity = 156/474 (32.91%), Postives = 242/474 (51.05%), Query Frame = 3
Query:  105 KQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLG--FSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFH-----LNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIF-FTINWEKEASKAAIRINE 1502
            +Q      Y  K   +L  + + E ++L  LA P        FL      +   HL K   D  +    I  + G  I +G   S A D L  Q +G SN K +G++LQR +++     L+L CF      +N E IL+   QD E+S++T  YV ++LP L   F +   ++YLQ+Q I+YP + +  IA ++N +  YI +YVLG G+  SA        +   +   YI   ++Y  TW G+      + W +F +L +  ++M+ +E W FE+  FLAG +  V L  Q+I  Q A + Y+I  GL IA +IR+G  LGA    +A  SA   +    + A+L+  +L +LK  + YIFT+D  I  +   +L +       DA  ++ G ++R  GK   GAI     YY IG+P+GI L+F     I GFW G+L   GI  +I++ IF F I+W++ + +A  R +E
Sbjct:   25 EQGPETTAYSQKRCLFLPMEVWQEAQKLLALAAPAPYTENQTFLIEICPDMGSEHLGKIRLDFLTWPIDIWPISG-QIWVGQVLSMAGDFLVLQTFGGSNLKLVGIILQRGILI-----LLLFCFPCWALLINTESILLLFRQDPEVSKLTQIYVLIFLPALPAAFLYQLLAKYLQNQGIIYPQVLTGFIANIFNALFNYILLYVLGLGVMGSACANTVSQFIQMILLFLYIVWRRLYADTWGGWS-QACFEEWGAFIRLAVASMLMLCIEWWAFEISMFLAGVLGMVDLAAQAIIYQVAIVVYLIPLGLCIAGSIRVGHGLGAGNTEQAKRSALVVLCMTELCALLSGILLATLKDVVAYIFTSDPNIVALVSYVLPVYSACLLFDACVAACGGILRGSGKLKVGAISHTVGYYVIGLPLGISLMFAAKLGIIGFWFGIL-ACGIAQSIFLIIFVFKIDWKRASEEAQTRASE 490          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Xenopus
Match: ccdc85a (coiled-coil domain containing 85A [Source:Xenbase;Acc:XB-GENE-954470])

HSP 1 Score: 213.386 bits (542), Expect = 6.346e-61
Identity = 152/449 (33.85%), Postives = 224/449 (49.89%), Query Frame = 3
Query:  129 YGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACF-----HLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASA----IIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTD--YMAAILTTT--MLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIY 1436
            +GG  R       F  +    KLA          FL   +S I CGHL K E DA +LAN +I V G S+ LG S+ACDTL SQI+G  N K +G++LQR +++     L LACF      +N E IL+   QD +++  +    ++ L          T   Y+  Q IVY  +  S ++ + N +V Y+ ++VL  G+  SA    I Q   CLL+F     YI V +++  TW G+     LQ W SF  L +P ++M+ +E WT+E+G+ ++G +  V+LG QS+  Q     YMI  G+ +A ++R+G  LGA    +A  S     L     + A++     ML S K+   YIFTND  +            +L +L  S    G ++R  G+Q  GAII    YY IG+P+   L+F V   I+ ++   L  L I  A Y
Sbjct:   40 HGGGGRACTGLATFSHIFGAEKLA------QFLCFLINVVSAIFCGHLGKVELDAVTLANAVIAVTGLSVGLGLSSACDTLISQIFGGKNLKLIGIILQRGILI-----LFLACFPCWALFINTENILLLFKQDPKVASSSRQCKSVSLN--------QTKMSYVIFQGIVYVQIIVSFVSNIINCIVNYVFLFVLRLGVIGSAWANTIAQFSQCLLIF----LYIRVKRLHVNTWGGWSI-ECLQDWSSFISLAIPSMLMVCIEWWTYEIGNLMSGLLGVVELGAQSVIYQVVTTAYMIPFGIGMATSVRVGNALGAGNIEQAKTSTTVAFLVTGASLPAVIFVDILMLASFKNQFAYIFTNDRWVFTF---------LLLYLSFSFCVAGGILRGTGRQKIGAIINMVGYYLIGLPLAAALMFAVNIGIKVYYSCFLGKLAILYASY 455          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Xenopus
Match: ccdc85a (coiled-coil domain containing 85A [Source:Xenbase;Acc:XB-GENE-954470])

HSP 1 Score: 211.846 bits (538), Expect = 1.038e-60
Identity = 141/408 (34.56%), Postives = 212/408 (51.96%), Query Frame = 3
Query:  210 VLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACF-----HLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASA----IIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTD--YMAAILTTT--MLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFW 1394
            +L     FL   +S I CGHL K E DA +LAN +I V G S+ LG S+ACDTL SQI+G  N K +G++LQR +++     L LACF      +N E IL+   QD +++  +    ++ L          T   Y+  Q IVY  +  S ++ + N +V Y+ ++VL  G+  SA    I Q   CLL+F     YI V +++  TW G+     LQ W SF  L +P ++M+ +E WT+E+G+ ++G +  V+LG QS+  Q     YM+ +  S+A ++R+G  LGA    +A  S     L     + A++     ML S K+   YIFTND  +            +L +L  S    G ++R  G+Q  GAII    YY IG+P+   L+F V   I+G +
Sbjct:   33 ILAQFLCFLINVVSAIFCGHLGKVELDAVTLANAVIAVTGLSVGLGLSSACDTLISQIFGGKNLKLIGIILQRGILI-----LFLACFPCWALFINTENILLLFKQDPKVASSSRQCKSVSLN--------QTKMSYVIFQGIVYVQIIVSFVSNIINCIVNYVFLFVLRLGVIGSAWANTIAQFSQCLLIF----LYIRVKRLHVNTWGGWSI-ECLQDWSSFISLAIPSMLMVCIEWWTYEIGNLMSGLLGVVELGAQSVIYQVVTTAYMVRSA-SMATSVRVGNALGAGNIEQAKTSTTVAFLVTGASLPAVIFVDILMLASFKNQFAYIFTNDRWVFTF---------LLLYLSFSFCVAGGILRGTGRQKIGAIINMVGYYLIGLPLAAALMFAVNIGIKGIY 412          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Xenopus
Match: tysnd1 (trypsin domain containing 1 [Source:Xenbase;Acc:XB-GENE-972865])

HSP 1 Score: 108.612 bits (270), Expect = 1.078e-26
Identity = 55/148 (37.16%), Postives = 85/148 (57.43%), Query Frame = 3
Query:  144 RNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHF 587
            R  L    + E+K+L  +A P+ L  +  F+   +S I CGHL K E D+ +LA  +I V G S+  G S+ACDTL SQ +G  N KR+G +LQRA++++ +         +N E IL+   Q+ +++R T  YVT+++P L     F
Sbjct:   35 RQLLPVNMWQEVKDLCVIAGPVFLSQIMVFMVNVVSSIFCGHLGKIELDSVTLAVAVINVTGVSVGSGLSSACDTLISQTFGGRNLKRVGTILQRAILIVLLFCFPCWAIFINTEQILLLCKQNPDVARFTQMYVTIFMPALPVSLKF 182          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Mouse
Match: Slc47a1 (solute carrier family 47, member 1 [Source:MGI Symbol;Acc:MGI:1914723])

HSP 1 Score: 286.574 bits (732), Expect = 4.334e-88
Identity = 158/458 (34.50%), Postives = 245/458 (53.49%), Query Frame = 3
Query:  141 LRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACF-----HLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRIN 1499
            LR  L   +  EL+ L  LA P  L  L  FL   IS + CGHL K E DA +LA  +I V G S+  G S+ACDTL SQ YGS N K +G++LQR  ++     L+L CF      +N E IL+   QD ++SR+T TYV +++P L   F +    +YL +Q IV P + +   A L N +  Y+ +Y L  G+  SA+        +      YI   ++++ TW G+ +   LQ W SF +L +P ++M+ +E W +EVGSFL+G +  V+LG QSI  + A + YMI +G S+A  +R+G  LGA    +A  S+  +++   + A+    +LL  K  + YIFT D +I  +   ++ +  +    +    + G ++R  G Q  GAI+    YY IG+PIGI L+F     + G W G++I    +   ++     +NW++   +A +  N
Sbjct:   23 LRCLLLPGFLEELRALLVLAGPAFLAQLMMFLISFISSVFCGHLGKLELDAVTLAIAVINVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQRGTLI-----LLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMIFIPALPAAFLYTLQVKYLLNQGIVLPQIMTGIAANLVNALANYVFLYHLHLGVMGSALANTISQFALAIFLFLYILWRRLHQATWGGWSW-ECLQDWASFLRLAIPSMLMLCIEWWAYEVGSFLSGILGMVELGAQSITYELAIIVYMIPSGFSVAANVRVGNALGAGNIDQAKKSSAISLIVTELFAVTFCVLLLGCKDLVGYIFTTDRDIVALVAQVIPIYAVSHLFEGLACTCGGILRGTGNQKVGAIVNAIGYYVIGLPIGIALMFAAKLGVIGLWSGIIICTTCQTTCFLAFIARLNWKRACQQAQVHAN 474          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Mouse
Match: Slc47a2 (solute carrier family 47, member 2 [Source:MGI Symbol;Acc:MGI:3588190])

HSP 1 Score: 286.189 bits (731), Expect = 7.310e-88
Identity = 176/566 (31.10%), Postives = 285/566 (50.35%), Query Frame = 3
Query:  141 LRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACF-----HLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKI-DRSTIMKRAILVGITLCLFISSILVKIYLPR 1820
            LR  LS     E   L  LA P+ L  L  FL   +S I CGHL K E DA +LA  ++ V G S+  G ++ACDTL SQ +G  N KR+G++LQR +++     L+L CF      LN E +L+ L QD +++R+   YV + +P L   F F   +RYLQSQ I+ P +     A + N+ +    +Y L  G+  SA         +  +   Y+W  +I+  TW G+      Q W S+ +L +P + M+ +E WTFE+G+FLAG +N  +LG Q++  + A + YM+  G  +A ++R+G  LGA    +A  S    +L   + A+L   +L +LK  + YIFTND++I  +   ++ +       DA   + G V+R  GKQ  GA++    YY  G PIG+ L+F     I G W GL++ +  +   Y+      NW + A +A +R   A L             S K  + + ++LP   E E     +L   P   RP S    +++ ++       + + +  R  +  R + + +++ + I+ I+V+++  R
Sbjct:   32 LRGALSPDVRREAAALVALAGPVFLAQLMIFLISIVSSIFCGHLGKVELDAVTLAVSVVNVTGISVGTGLASACDTLMSQSFGGKNLKRVGVILQRGILI-----LLLCCFPCWAIFLNTERLLLLLRQDPDVARLAQVYVMICIPALPAAFLFQLQTRYLQSQGIIMPQVIVGIAANVVNVGMNAFLLYALDLGVVGSAWANTTSQFFLSALLFLYVWWKRIHIHTWGGWT-RECFQEWSSYTRLAIPSMFMVCIEWWTFEIGTFLAGLVNVTELGAQAVIYELASVAYMVPFGFGVAASVRVGNALGAGNADQARCSCTTVLLCAGVCALLVGILLAALKDVVAYIFTNDKDIISLVSQVMPIFAPFHLFDALAGTCGGVLRGTGKQKIGAVLNTIGYYGFGFPIGVSLMFAAKLGIIGLWAGLIVCVSFQAFSYLIYILRTNWSRVAEQAQVR---AGLK------------STKELIPTPADLP-ILEREVMDGVIL---PDIIRPESQTGQLVVEENSQCAVPTVGEVLTGRQLVFYRGMALTVSVAVLIAGIVVRVFNDR 572          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Mouse
Match: Slc47a2 (solute carrier family 47, member 2 [Source:MGI Symbol;Acc:MGI:3588190])

HSP 1 Score: 276.944 bits (707), Expect = 2.282e-85
Identity = 155/452 (34.29%), Postives = 238/452 (52.65%), Query Frame = 3
Query:  141 LRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACF-----HLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASK 1481
            LR  LS     E   L  LA P+ L  L  FL   +S I CGHL K E DA +LA  ++ V G S+  G ++ACDTL SQ +G  N KR+G++LQR +++     L+L CF      LN E +L+ L QD +++R+   YV + +P L   F F   +RYLQSQ I+ P +     A + N+ +    +Y L  G+  SA         +  +   Y+W  +I+  TW G+      Q W S+ +L +P + M+ +E WTFE+G+FLAG +N  +LG Q++  + A + YM+  G  +A ++R+G  LGA    +A  S    +L   + A+L   +L +LK  + YIFTND++I  +   ++ +       DA   + G V+R  GKQ  GA++    YY  G PIG+ L+F     I G W GL++ +  +   Y+      NW + A +
Sbjct:   32 LRGALSPDVRREAAALVALAGPVFLAQLMIFLISIVSSIFCGHLGKVELDAVTLAVSVVNVTGISVGTGLASACDTLMSQSFGGKNLKRVGVILQRGILI-----LLLCCFPCWAIFLNTERLLLLLRQDPDVARLAQVYVMICIPALPAAFLFQLQTRYLQSQGIIMPQVIVGIAANVVNVGMNAFLLYALDLGVVGSAWANTTSQFFLSALLFLYVWWKRIHIHTWGGWT-RECFQEWSSYTRLAIPSMFMVCIEWWTFEIGTFLAGLVNVTELGAQAVIYELASVAYMVPFGFGVAASVRVGNALGAGNADQARCSCTTVLLCAGVCALLVGILLAALKDVVAYIFTNDKDIISLVSQVMPIFAPFHLFDALAGTCGGVLRGTGKQKIGAVLNTIGYYGFGFPIGVSLMFAAKLGIIGLWAGLIVCVSFQAFSYLIYILRTNWSRVAEQ 477          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Mouse
Match: Slc47a1 (solute carrier family 47, member 1 [Source:MGI Symbol;Acc:MGI:1914723])

HSP 1 Score: 138.272 bits (347), Expect = 5.913e-37
Identity = 81/218 (37.16%), Postives = 119/218 (54.59%), Query Frame = 3
Query:  231 FLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACF-----HLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGL 869
            FL   IS + CGHL K E DA +LA  +I V G S+  G S+ACDTL SQ YGS N K +G++LQR  ++     L+L CF      +N E IL+   QD ++SR+T TYV +++P L   F +    +YL +Q IV P + +   A L N +  Y+ +Y L  G+  SA+        +      YI   ++++ TW G+ +   LQ W SF +L +
Sbjct:    3 FLISFISSVFCGHLGKLELDAVTLAIAVINVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQRGTLI-----LLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMIFIPALPAAFLYTLQVKYLLNQGIVLPQIMTGIAANLVNALANYVFLYHLHLGVMGSALANTISQFALAIFLFLYILWRRLHQATWGGWSW-ECLQDWASFLRLAI 214          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Mouse
Match: Slc47a1 (solute carrier family 47, member 1 [Source:MGI Symbol;Acc:MGI:1914723])

HSP 1 Score: 119.013 bits (297), Expect = 2.287e-30
Identity = 69/164 (42.07%), Postives = 93/164 (56.71%), Query Frame = 3
Query:  141 LRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFH-----LNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQ 617
            LR  L   +  EL+ L  LA P  L  L  FL   IS + CGHL K E DA +LA  +I V G S+  G S+ACDTL SQ YGS N K +G++LQR  ++     L+L CF      +N E IL+   QD ++SR+T TYV +++P L   F +    +YL +Q
Sbjct:   23 LRCLLLPGFLEELRALLVLAGPAFLAQLMMFLISFISSVFCGHLGKLELDAVTLAIAVINVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQRGTLI-----LLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMIFIPALPAAFLYTLQVKYLLNQ 181          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|A1L1P9|S47A1_DANRE (Multidrug and toxin extrusion protein 1 OS=Danio rerio OX=7955 GN=slc47a1 PE=2 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.421e-93
Identity = 162/508 (31.89%), Postives = 276/508 (54.33%), Query Frame = 3
Query:  138 KLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFH-----LNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGH 1646
            KLR+ L   Y  E+ EL KLA P+ +  L  FL   +S + CGHL KTE    +LA  +I V G SI  G ++ACDTL SQ +GS+N KR+G++LQR +++     L+LACF      +N EPIL+ + Q   ++ ++  YV +++P L   F +    RYLQ+Q I++P + +     + N ++ Y+ +++L  G+  SA         +      YI    ++K TW G+   + LQ W +F +L LP ++M+ VE WT+E+G FLAG I++ +LG QS+  + A + YM   G ++A ++R+G  LGA    +A LSAK  ++   + + +  T++   K  + YIFT +EEI      ++++ G     DA    TG ++R  GKQL GA+     YY +G P G+ L+F ++  I G W+G    + ++   ++ + + ++W+K   +A IR    +L+E + +   ++           S++ ++   + + +   L + G 
Sbjct:   40 KLRSLLPVNYKTEIVELLKLAGPVFISQLMIFLISFVSTVFCGHLGKTELAGVALAIAVINVTGISIGSGLASACDTLISQTFGSNNLKRVGVILQRGILI-----LLLACFPCWALLINTEPILLAVRQSPNVASLSQLYVKIFMPALPAAFMYQLQGRYLQNQGIIWPQVITGAAGNILNALINYVFLHLLELGVAGSAAANTISQYSLAVFLYVYIRWKNLHKATWDGWS-RDCLQEWGAFIRLALPSMLMLCVEWWTYEIGGFLAGLISETELGAQSVVYELATIAYMFPLGFAVAASVRVGNALGAGNTERAKLSAKVALVCGVLVSCVVATLIGCTKDVIAYIFTTEEEIVSRVSQVMIMYGFFHLFDAIAGITGGIVRGAGKQLLGALCNIVGYYFVGFPTGVSLMFALSMGIIGLWIGFFGCVFLQSLFFIILIYKLDWKKATQEALIRAG-VQLTETKDESFGLENKGCTEEAAKESQITEEGLTDANTDLEGLSKGGE 540          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|Q5RFD2|S47A1_PONAB (Multidrug and toxin extrusion protein 1 OS=Pongo abelii OX=9601 GN=SLC47A1 PE=2 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 4.210e-91
Identity = 166/476 (34.87%), Postives = 262/476 (55.04%), Query Frame = 3
Query:   90 PASIRKQQEG-IQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACF-----HLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRIN 1499
            PA +R   E  ++++G +        +  EL+ L  LA P  L+ L  FL   IS + CGHL K E DA +LA  +I V G S+  G S+ACDTL SQ YGS N K +G++LQR+ ++     L+L CF      LN + IL+   QD ++SR+T TYVT+++P L   F +M   +YL +Q IV P + +   A L N +  Y+ ++ L  G   SA+        +  +   YI   K+++ TW G+     LQ W SF  L +P ++M+ +E W +EVGSFL+G +  V+LG QSI  + A + YM+ AG S+A ++R+G  LGA +  +A  S+  ++L   + A+  + +LLS K ++ YIFT D +I  +   ++ +  +    +A   ++G V+R  G Q  GAI+    YY +G+PIGI L+F     + G W G++I    +   ++     +NW+K   +A +  N
Sbjct:    7 PAPVRGGPEATLEIHGSRFLRL--SAFREELRALLVLAGPAFLVQLMVFLISFISSVFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSALI-----LLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGAIGSALANLISQYTLALLLFFYILGKKLHQATWGGWSL-ECLQDWASFLHLAVPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVGLPIGIALMFATKLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHAN 474          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|Q96FL8|S47A1_HUMAN (Multidrug and toxin extrusion protein 1 OS=Homo sapiens OX=9606 GN=SLC47A1 PE=1 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 3.200e-90
Identity = 168/476 (35.29%), Postives = 263/476 (55.25%), Query Frame = 3
Query:   90 PASIRKQQEG-IQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACF-----HLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRIN 1499
            PA +R   E  ++V G +        +  EL+ L  LA P  L+ L  FL   IS + CGHL K E DA +LA  +I V G S+  G S+ACDTL SQ YGS N K +G++LQR+ +V     L+L CF      LN + IL+   QD ++SR+T TYVT+++P L   F +M   +YL +Q IV P + +   A L N +  Y+ ++ L  G+  SA+        +  +   YI   K+++ TW G+     LQ W SF +L +P ++M+ +E W +EVGSFL+G +  V+LG QSI  + A + YM+ AG S+A ++R+G  LGA +  +A  S+  ++L   + A+  + +LLS K ++ YIFT D +I  +   ++ +  +    +A   ++G V+R  G Q  GAI+    YY +G+PIGI L+F     + G W G++I    +   ++     +NW+K   +A +  N
Sbjct:    7 PAPVRGGPEATLEVRGSRCLRL--SAFREELRALLVLAGPAFLVQLMVFLISFISSVFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSALV-----LLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKLHQATWGGWSL-ECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVGLPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHAN 474          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|A7KAU2|S47A1_RABIT (Multidrug and toxin extrusion protein 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC47A1 PE=2 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 1.625e-88
Identity = 168/512 (32.81%), Postives = 269/512 (52.54%), Query Frame = 3
Query:  144 RNWLS----EKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMI-------IDKISEKTNLISTSELPDDAE--DEKHPNPVLLFRP 1640
            R+WL       +  EL+ L  LA P  L  L  FL   +S + CGHL K E +A +LA  +I V G S+  G S+ACDTL SQ YGS N K +G++LQR  +++ +  L      LN + IL+   QD  +SR+T TYVT+++P L   F +    +YL +Q IV P + +   A L N +  Y+ +Y L  G+  SA+        +  +   YI  SK+Y+ TW G+     LQ W SFF+L +P ++M+ +E W +E+GSFL+G +  V+LG QS+  + A + YMI  GLS+AV +R+G  LGA    +A  S+   +L   + A++   MLLS K  + YIFT+D +I  +   +  +  +    ++   ++G ++R  G Q  GAI+    YY +G+PIGI L+F     + G W+G+++    +   ++     +NW K   +A +  N    +    +  +       +   S    ++  ++  + AE  ++ HP   L  RP
Sbjct:   19 RHWLRCLVLSDFREELRALLVLACPAFLAQLMVFLISFVSSVFCGHLSKLELNAVTLAIAVINVMGVSVGFGLSSACDTLISQTYGSRNLKHVGVILQRGSLILLLCCLPCWALFLNTQHILLLFRQDPAVSRLTQTYVTIFIPALPATFLYTLQVKYLLNQGIVLPQVVTGVAANLVNALANYLFVYQLHLGVMGSALANTVAQFTLALLLFLYILRSKVYQATWGGWSL-ECLQDWASFFRLAIPSMLMLCMEWWAYEIGSFLSGILGMVELGAQSVTYELAVIVYMIPMGLSVAVNVRVGNALGAGNIEQAKKSSAVALLVTELIAVVFCVMLLSCKDLVGYIFTSDRDIIALVAQVTPIYAVSHLFESLAGTSGGILRGSGNQKFGAIVNAIGYYVVGLPIGIALMFAAKLGVIGLWLGIVVCAVSQAVCFLGFIARLNWTKACQQARVHANLTVNTASNGNSAVLPDQPHPVGPDSHGGIVLRDADRKEGAELNEQVHPELPLPVRP 529          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|Q8K0H1|S47A1_MOUSE (Multidrug and toxin extrusion protein 1 OS=Mus musculus OX=10090 GN=Slc47a1 PE=1 SV=2)

HSP 1 Score: 286.574 bits (732), Expect = 3.031e-87
Identity = 158/458 (34.50%), Postives = 245/458 (53.49%), Query Frame = 3
Query:  141 LRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACF-----HLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRIN 1499
            LR  L   +  EL+ L  LA P  L  L  FL   IS + CGHL K E DA +LA  +I V G S+  G S+ACDTL SQ YGS N K +G++LQR  ++     L+L CF      +N E IL+   QD ++SR+T TYV +++P L   F +    +YL +Q IV P + +   A L N +  Y+ +Y L  G+  SA+        +      YI   ++++ TW G+ +   LQ W SF +L +P ++M+ +E W +EVGSFL+G +  V+LG QSI  + A + YMI +G S+A  +R+G  LGA    +A  S+  +++   + A+    +LL  K  + YIFT D +I  +   ++ +  +    +    + G ++R  G Q  GAI+    YY IG+PIGI L+F     + G W G++I    +   ++     +NW++   +A +  N
Sbjct:   23 LRCLLLPGFLEELRALLVLAGPAFLAQLMMFLISFISSVFCGHLGKLELDAVTLAIAVINVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQRGTLI-----LLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMIFIPALPAAFLYTLQVKYLLNQGIVLPQIMTGIAANLVNALANYVFLYHLHLGVMGSALANTISQFALAIFLFLYILWRRLHQATWGGWSW-ECLQDWASFLRLAIPSMLMLCIEWWAYEVGSFLSGILGMVELGAQSITYELAIIVYMIPSGFSVAANVRVGNALGAGNIDQAKKSSAISLIVTELFAVTFCVLLLGCKDLVGYIFTTDRDIVALVAQVIPIYAVSHLFEGLACTCGGILRGTGNQKVGAIVNAIGYYVIGLPIGIALMFAAKLGVIGLWSGIIICTTCQTTCFLAFIARLNWKRACQQAQVHAN 474          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A0H3YJI2 (Multidrug and toxin extrusion protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc47a-4 PE=2 SV=1)

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 332/595 (55.80%), Postives = 419/595 (70.42%), Query Frame = 3
Query:  153 LSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLL------------FRPGHK----RPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYP 1889
            ++EK+ PELK L KLAWPI+LMNLFRFLNPTISVIMCGHL K EFDAASLAN +I VFG S+DLGFSTACDTLF++IYGS NR +LGLMLQ+A++VMTI Y IL CFHLNIEP+LI L QDVEISR+ A YV +YLPGLFFDF F+  +RYLQ+QN+VYPMM SS I C++N+V QYIAIY L FGI ASA+IQ   C +MF++QL ++  SKIYKPTWQG EF NAL+GW  FFKLG+PGI+M+GVEEW FE+G+F++GA++DVQLG QSIA Q   +CY +H+GLSIAV IR GQFLGAN+P +ASL+ KA +L +   +  T T++L+ ++YLP++FTNDEEI  +A+ ILL++  +QFLDA  S+   + RACGKQ+ GAIIM    Y +G+P+GI+LI+VV  DI+GFW+GL+I L  EV+I+  + F I+W  EA KA         S C+ D  I+  I +     S  + PD  ED K                    R   K    R    +++++I       +L +N K    TI+KR  L  ITL LF SSI VKIYLP K YIPCI    N T L  +KHYP
Sbjct:   19 MTEKFLPELKCLLKLAWPIILMNLFRFLNPTISVIMCGHLTKKEFDAASLANALINVFGVSVDLGFSTACDTLFARIYGSRNRHKLGLMLQKAILVMTILYFILGCFHLNIEPVLILLQQDVEISRLAAKYVVIYLPGLFFDFQFLAIARYLQNQNVVYPMMVSSFIGCIFNVVFQYIAIYQLKFGIEASALIQGLSCCVMFSLQLVHLIKSKIYKPTWQGIEFLNALEGWGIFFKLGIPGIIMLGVEEWMFEIGNFISGALSDVQLGAQSIAFQIEMICYTLHSGLSIAVAIRAGQFLGANKPKEASLTGKAIILIELSLSTFTATIILAFRNYLPFVFTNDEEIINLAQKILLILVPIQFLDAGCSTASGIFRACGKQVKGAIIMICGCYLLGIPVGIILIYVVGTDIQGFWIGLVIALVAEVSIFFIVIFRIDWNNEALKAQ--------STCK-DTNIVSPIDKDK---SYEKYPDTLEDSKLLKSESDSEEEEHESVLKTVRKNSKITGRRSIGGISEVLIDSCRDYPNLRMNYKTMHKTIVKRITLTTITLILFCSSIFVKIYLPEKYYIPCI---SNQTNLPLHKHYP 598          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A0H3YKK1 (Multidrug and toxin extrusion protein OS=Schmidtea mediterranea OX=79327 GN=slc47a-1 PE=2 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 6.990e-133
Identity = 230/629 (36.57%), Postives = 359/629 (57.07%), Query Frame = 3
Query:  147 NWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTML--------------------LSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGF-------------WVGLLIGLGIE-VAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKI-------DRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMY 1910
            N+  + +  E+  L  +  P VL   FR LNP IS+IMCGH  K EFD  SLAN II +FG SIDLGFST+ +TLF+QI+GS  +K++G++LQRAVIVMT+ Y+ LACFHLN+EPILI L QD+ I+ +TA Y+ LYLPGLFFDF FM  SRYLQ+QNIVYPM  SS I  ++N+++QY+AI+V  FG  ++A+ QA    +MF  +L YI +SK+Y  TW GF   N+ + W+  F LGLPGI ++G+EEW FE G+ +AG ++ +QLG QSIA Q + + ++I  G+ +A + RIGQ++G+ +        K + L   M   L   M+                    LS +  +  +F+ND EI+  +  +L+ I    FLD  G+    ++  C +Q  GA  M   YY IG PIG +L++V    I+G              WVG+++ L ++ ++  +F+++T NW+   +++   I + +L E  +DD+  D      NL +T +  +        N   +     K P+ S T+ +I+    E +L  ++KI       +++ ++K+ + + + + +F+ +I++++Y     + PC+       +         CN + Y
Sbjct:   32 NFSLKDFKQEIFSLMSIFIPSVLTTFFRMLNPVISLIMCGHFSKYEFDVVSLANSIINIFGYSIDLGFSTSFNTLFAQIFGSEQKKKMGIILQRAVIVMTLIYMFLACFHLNMEPILISLKQDIGIAYLTAKYIILYLPGLFFDFQFMIISRYLQNQNIVYPMTISSFIGTVFNLILQYLAIHVYQFGFQSAAVCQAISSFVMFACELGYILISKVYMDTWNGFSLLNSFRDWKVIFLLGLPGIFLVGLEEWGFETGTVVAGTLSIIQLGAQSIAFQISTISFLISLGIYLATSTRIGQYVGSKDLRSIKRVIKVDSLFGGMNIWLLNFMINMKPPIIILVLICCVFCTVTLSFRQKICELFSNDPEIQEESTKLLIYISFYPFLDVFGAIFSGILCGCARQSVGAYAMIICYYVIGFPIGFILVYVFQTGIKGLINSFKAFCLFLGMWVGIMVALFVKALSTGLFVYYT-NWDYVFNQSESNIEKIQLDETISDDINSD---NSKNLSTTLDTVERLLKRFWKNKSFI-----KIPSESETENLIN---DEPELNASRKITIYQTQVNKNMLIKKFLFILLVITMFLFAIIIRVYSTMLWHFPCVIVLNETERFYQLISARVCNISSY 648          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A3Q0KMD5 (Multidrug and toxin extrusion protein OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 4.890e-129
Identity = 199/463 (42.98%), Postives = 298/463 (64.36%), Query Frame = 3
Query:  153 LSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAII--QAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDM 1535
            L+   + E+K+L  LA P ++  L RF+NP+ISV++CGHL + E DA+SLAN II +FG SID GFS+ACDTLFSQ YGS NRK +G +LQRA+ V+ + Y+ L C HLNIE +L+ L Q+  I+ +T+ Y+  +LPGL FDF F+TF+RYLQSQNI+ PM++S+    ++NI+ QY  +  L +G+ ASA+    +FGC  MF  +L YI  SK+YK TW GF  ++A   W  FFKLG+PG++M+G+EEW FE+ + +AG +  V LG Q+I  Q   + YM+  GL  AV IR+GQ LGA +P  A       +    + A+ T   ++ L+ Y+PY+FT+DE++ ++A  +L ++ + QF +     + A++ ACG+Q  GAI +F  YY  G+PI  +L +  +  I G W+GL IG G+   +Y  +    +W ++  +A   + E  LS   T+++
Sbjct:   19 LNSDRYNEIKKLFALALPTMISQLLRFINPSISVMVCGHLSREELDASSLANCIINIFGLSIDTGFSSACDTLFSQAYGSRNRKLMGTLLQRALCVVCLMYMTLVCIHLNIETVLLLLGQNPLIASLTSEYIAYFLPGLGFDFLFLTFARYLQSQNIIQPMVYSTFTGTVFNILAQYYFVVRLNYGLRASAVCLSLSFGC--MFLCELGYILASKVYKETWNGFNLNSAFSNWGIFFKLGIPGVLMVGLEEWCFEIMTIMAGTLGSVTLGAQAIVFQIQSIIYMVPLGLFTAVNIRVGQKLGAFDPVGARYVYTTALTIISIVALFTGLPVVFLRQYIPYMFTSDEKVCLLASRLLPMLLLFQFFEGFAGISEAILLACGRQSIGAITIFLGYYCTGMPIAALLTYQTSLGILGSWIGLTIGFGLTTMVYTILALRTDWTEQVRRARNNVTET-LSVYSTNNI 478          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A267E4V0 (Multidrug and toxin extrusion protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004257g2 PE=3 SV=1)

HSP 1 Score: 399.823 bits (1026), Expect = 3.204e-127
Identity = 202/513 (39.38%), Postives = 310/513 (60.43%), Query Frame = 3
Query:  144 RNWLSEKYFP-----ELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRI--NEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDE---KHPNPVLLFRPGHKR 1652
            R WL  + FP     E   +  L+WP +L   F+F   T S+IMCG L K + D+ +LAN  I V G  I +G STACDTLFSQ +GS N+KR+G+ LQR ++VM    ++L C HLNI+P+L+WL Q+  I+  TA Y+  ++PGLFFD+ F+  SR+LQ+QNI+YP M +  +  ++N+V QY+AI++  +G  +SA++QA    +MF + L Y   + +YK  W G++   +L  W  F KL +PGI +I +EEW+FE+ + +AG + +VQLG QSI  Q   + YMI  G+S+AV IR+GQ LG N+P  A+ S +  +L   + A+L  T+  SL++YLP+IF++DEEI  VA N+L ++G  Q  D   +++   +R CG+Q+ GA+++F  +Y IG+P+GI L       + G W+GLL+G  IE   +  +   +NW  EA  A +R    +A  +E    D  I   +  +++++       A+     +HP   L  R   +R
Sbjct:   53 RLWL--RMFPLGFRDEFLVMFALSWPAILTTFFQFFLQTTSIIMCGQLGKIDLDSVALANSFINVAGICIGVGMSTACDTLFSQTFGSRNKKRMGMYLQRGLMVMYSVLVLLWCLHLNIKPVLLWLGQNSVIADKTARYMLYFMPGLFFDYSFLVLSRFLQNQNIMYPPMIAGFVGNIFNVVSQYLAIHIFDYGYLSSAVLQASSLAVMFFLTLIYTLCTGVYKDCWDGWKV-ESLYKWWDFVKLAVPGIFLIALEEWSFEISTIVAGTLGEVQLGAQSIVFQMEAISYMIPFGISVAVNIRVGQQLGGNQPLGAAQSFRIGLLMMSVTALLMLTIFASLRNYLPFIFSSDEEIVHVASNVLPILGAFQIADGVTATSSGAIRGCGRQIQGAVVLFVGFYIIGLPMGISLALATDLQVLGMWIGLLVGYSIEAVAFCCLVLRLNWRLEAHNAQLRAYGEDAAEAEIVDADQSIGN-NNSSSVVAGGNATATAQTTGKIRHPTCPLTLRASARR 561          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A267GF85 (Multidrug and toxin extrusion protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000574g1 PE=3 SV=1)

HSP 1 Score: 400.979 bits (1029), Expect = 5.438e-127
Identity = 206/512 (40.23%), Postives = 308/512 (60.16%), Query Frame = 3
Query:  144 RNWLSEKYFP-----ELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRI--NEAKLSECQTDDMII------------DKISEKTN--LISTSELPDDAEDEKHP 1616
            R WL  + FP     E   +  L+WP +L   F+F   T S+IMCG L K + D+ +LAN  I V G  I +G STACDTLFSQ +GS N+KR+G+ LQR ++VM    ++L C HLNI+P+L+WL Q+  I+  TA Y+  ++PGLFFD+ F+  SR+LQ+QNI+YP M +  +  ++N+V QY+AI++  +G  +SA++QA    +MF + L Y   + +YK  W G++   +L  W  F KL +PGI +I +EEW+FE+ + +AG + +VQLG QSI  Q   + YMI  G+S+AV IR+GQ LG N+P  A+ S +  +L   + A+L  T+  SL++YLP+IF++DEEI  VA N+L ++G  Q  D   +++   +R CG+Q+ GA+++F  +Y IG+P+GI L       + G W+GLL+G  IE   +  +   +NW  EA  A +R    +A  +E    D  I            +   + +N    S S LP DAE E  P
Sbjct:   53 RLWL--RMFPLGFRDEFLVMFALSWPAILTTFFQFFLQTTSIIMCGQLGKIDLDSVALANSFINVAGICIGVGMSTACDTLFSQTFGSRNKKRMGMYLQRGLMVMYSVLVLLWCLHLNIKPVLLWLGQNSVIADKTARYMLYFMPGLFFDYSFLVLSRFLQNQNIMYPPMIAGFVGNIFNVVSQYLAIHIFDYGYLSSAVLQASSLAVMFFLTLIYTLCTGVYKDCWDGWKV-ESLYNWCDFVKLAVPGIFLIALEEWSFEISTIVAGTLGEVQLGAQSIVFQMEAISYMIPFGISVAVNIRVGQQLGGNQPLGAAQSFRIGLLMMSVTALLMLTIFASLRNYLPFIFSSDEEIVHVASNVLPILGAFQIADGVTATSSGAIRGCGRQIQGAVVLFVGFYIIGLPMGISLALATDLQVLGMWIGLLVGYSIEAVAFCCLVLRLNWRLEAHNAQLRAYGEDAAEAEIVDADQSIGNNNSSSVVAGGNATGDSSNHWQDSASYLPSDAESECSP 561          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Cavefish
Match: slc47a3 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:103046114])

HSP 1 Score: 313.538 bits (802), Expect = 1.051e-98
Identity = 173/490 (35.31%), Postives = 280/490 (57.14%), Query Frame = 3
Query:  144 RNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFH-----LNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSE--LPD 1592
            R    E+   E+KEL+ LA P++L  +  +L   +S + CGHL  TE D  +LA  I+ V   ++  G ++ACDTL SQ +GS N +R+G+++QR +I+     L+LACF      +N E IL+ + Q+ ++++++  YV +++P L   F F+  S YLQ+Q I++P++ +  IA + N +  Y+ ++VL  G+  SA        LM  +   YI    ++K TW G+     LQ W++FF L +PG++M+  E WT+E+G+FLAG I+ V+LG QSI  + A + YM   G S+A  +R+G  +GA + ++A LSAK  M      A+    ++   K  + YIF+NDE+IR     +++L      LDA+ ++ G+++R  GKQ  GA+   F YYA+G PIG+ L+F     I G W GLLI +  +   ++ +   +NWEK   +A IR   A +   + DD  +D + +  ++ S  E   PD
Sbjct:   17 RCLFPEEVKKEVKELSALALPVLLSYIMVYLISFVSTVFCGHLGSTELDGVALAIAILNVSSVAVGYGLASACDTLISQTFGSGNLQRVGVIVQRGLII-----LLLACFPCWAILINTESILLLVKQNPDVAKLSQMYVKIFMPALPALFVFIIESTYLQNQGIIWPLVITGAIANVLNALSNYVFLFVLDLGVPGSAAANTVSQYLMAIVLFIYIRCRGLHKDTWYGWSM-ECLQEWDTFFHLAIPGLLMLCAEWWTYELGAFLAGLISPVELGAQSIIYELANVAYMFPIGFSVAGCVRVGNAMGAGDTAQAKLSAKLAMACAVSVAVCLAIIVGFTKDVISYIFSNDEQIRARVATVMVLYAPFHLLDATAAAAGSIVRGLGKQKLGAVGNVFGYYAVGFPIGVSLMFAAKMGIFGLWTGLLICVFFQSVFFITLLSKLNWEKATEEAQIR---AGVHMNEKDD--VDAVQQYEDVGSYEEGTYPD 495          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Cavefish
Match: slc47a3 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:103046114])

HSP 1 Score: 313.538 bits (802), Expect = 2.347e-98
Identity = 173/490 (35.31%), Postives = 280/490 (57.14%), Query Frame = 3
Query:  144 RNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFH-----LNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSE--LPD 1592
            R    E+   E+KEL+ LA P++L  +  +L   +S + CGHL  TE D  +LA  I+ V   ++  G ++ACDTL SQ +GS N +R+G+++QR +I+     L+LACF      +N E IL+ + Q+ ++++++  YV +++P L   F F+  S YLQ+Q I++P++ +  IA + N +  Y+ ++VL  G+  SA        LM  +   YI    ++K TW G+     LQ W++FF L +PG++M+  E WT+E+G+FLAG I+ V+LG QSI  + A + YM   G S+A  +R+G  +GA + ++A LSAK  M      A+    ++   K  + YIF+NDE+IR     +++L      LDA+ ++ G+++R  GKQ  GA+   F YYA+G PIG+ L+F     I G W GLLI +  +   ++ +   +NWEK   +A IR   A +   + DD   D++ +  ++ S  E   PD
Sbjct:   17 RCLFPEEVKKEVKELSALALPVLLSYIMVYLISFVSTVFCGHLGSTELDGVALAIAILNVSSVAVGYGLASACDTLISQTFGSGNLQRVGVIVQRGLII-----LLLACFPCWAILINTESILLLVKQNPDVAKLSQMYVKIFMPALPALFVFIIESTYLQNQGIIWPLVITGAIANVLNALSNYVFLFVLDLGVPGSAAANTVSQYLMAIVLFIYIRCRGLHKDTWYGWSM-ECLQEWDTFFHLAIPGLLMLCAEWWTYELGAFLAGLISPVELGAQSIIYELANVAYMFPIGFSVAGCVRVGNAMGAGDTAQAKLSAKLAMACAVSVAVCLAIIVGFTKDVISYIFSNDEQIRARVATVMVLYAPFHLLDATAAAAGSIVRGLGKQKLGAVGNVFGYYAVGFPIGVSLMFAAKMGIFGLWTGLLICVFFQSVFFITLLSKLNWEKATEEAQIR---AGVHMNEKDDA--DRVQQYEDVGSYEEGTYPD 495          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Cavefish
Match: slc47a2.1 (solute carrier family 47 member 1 [Source:NCBI gene;Acc:103046628])

HSP 1 Score: 299.671 bits (766), Expect = 7.470e-93
Identity = 158/502 (31.47%), Postives = 271/502 (53.98%), Query Frame = 3
Query:  132 GGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFH-----LNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNP 1622
            G  +R+W+   +  E  +L KLA P+ +  L  FL   +S + CGHL  TE    +LA  +I V G SI  G ++ACDTL SQ +GS+N KR+G++LQR V++     L+LACF      +N EPIL+ + Q   ++ ++  YV +Y+P L   F +    RYLQ+Q I++P + +     + N ++ YI +++L  G+  SA   +     +      YI    ++K TW G+   + LQ W +F +L  P ++M+ VE WT+E+G FLAG I + +LG QS+  + A + YM   G ++A ++R+G  LGA    +A LS K  ++   + +     ++  LK  + Y FT ++EI V    ++ + G     DA+ + TG ++R  GKQL GA+     +Y +G PIG+ L+F ++  I G W G  + + ++   ++ +   ++W+K   +A +R    + +E + +   ++  S + +    ++     ED  + NP
Sbjct:   35 GRTVRSWIPVNFREEAVQLLKLAGPVFISQLMIFLISFVSTVFCGHLGNTELAGVALAIAVINVTGLSIGSGLASACDTLISQTFGSNNLKRVGVILQRGVLI-----LLLACFPCWAILINTEPILLAVRQSPRVASLSQLYVKIYMPSLPAAFMYQLQGRYLQNQGIIWPQVITGAAGNILNALINYIFLHLLHLGVAGSAAANSISQCSLAVFLYVYIRWKGLHKATWDGWS-RDCLQEWGAFIRLAFPSMLMLCVEWWTYEIGGFLAGLIGETELGAQSVIYELATIAYMFPLGFAVAASVRVGNALGAGNTEQAKLSGKVALICGLLVSCGVAALISGLKDVIAYTFTTEQEIIVRVSEVMAMYGFFHLFDATAAITGGIVRGAGKQLVGAMCNIVGFYFVGFPIGVSLMFALSMGIVGLWAGFFVCVFLQSVFFLILICKLDWKKATKEAQVRAGICQ-TEMKDESYAMENKSCEADEYQGTK--PSKEDHTYKNP 527          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Cavefish
Match: slc47a1 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:103037560])

HSP 1 Score: 276.174 bits (705), Expect = 1.546e-83
Identity = 184/602 (30.56%), Postives = 303/602 (50.33%), Query Frame = 3
Query:  135 GKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASA----IIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEE-IRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTD---------DMII----DKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDR--STIMKRAI-LVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPN 1877
            G +R+W+   Y  EL ++  L  P+++  +  FL P +S I  GHL   E    +LA+  I V  T+   G + ACDTL SQ +G  N KR+G +LQR+++++ +  L      +N E IL+ + Q+ E++R+   YV  +LP +   F       YLQ+Q I+ P M+++ +A + N+ + YI I+ +G G+  SA    I Q   CLL+F     YI   K++  TW G+  + +LQ W+SF +L +P  +M+  E W +E+G FLAG + +V L  Q + ++   + YM   G+  A  +R+G  LGA + ++A +++K  ++   + A+L   +L S K  + +IFT+DE  IR+V+EN+   +   QF DA    +  ++   GKQ   AI     YY IG+P+GI L+F     I G  +GLL+ + I+   ++ + F +NW+K   KA  R  +     C            D +I    D I    N  S S+    +ED K      +     ++  S+  D       +EE  +  KK+      +++R + L+   L L +    V ++L   L  P +    N T  S N
Sbjct:   33 GFVRHWVPLAYREELYQVLCLTGPLLVSRILSFLQPFVSTIFVGHLGNAELAGYALASATINVTTTATGCGLALACDTLVSQTFGGENLKRVGEILQRSILILLLFCLPCWAILINSESILLAMQQEAEVARIAQLYVLAFLPAVPAMFLHQLQVAYLQNQGIILPQMYTAAVANILNVAINYILIFSMGLGVKGSAAANCISQISICLLLFG----YIRWKKLHVRTWGGWT-TASLQEWDSFMQLAIPSTLMLCFEWWIYEIGGFLAGMLGEVDLAAQHVLLELGAITYMFPLGVHAAACVRVGNALGAGDTARAIITSKVTLIVSGVLAVLQGILLGSTKSIMGFIFTSDENIIRIVSENLTFYV-FSQFFDALVCVSSGILLGAGKQKIAAISNLICYYCIGLPLGISLMFAAKLRILGLTLGLLVCVIIQACFFISLIFKLNWQKVTEKAQKRAGKKTRVTCVAQKGPVGGPIIDTVIGEGEDSIEHTANGASVSQ--PISEDSKASGYAPVCTKEQEKAKSAKAD-----GENEEGAVRPKKLLSVPQLVLRRGLTLLSAALILVVG---VAVHLTCPLPEPSVQMKSNLTIDSGN 618          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Cavefish
Match: ENSAMXT00000033072.1 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:103022207])

HSP 1 Score: 254.218 bits (648), Expect = 1.662e-75
Identity = 150/539 (27.83%), Postives = 268/539 (49.72%), Query Frame = 3
Query:  135 GKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKR 1751
            G +R +L   Y  E+  + ++  P+V   +  +L P +  + CG L  +      +A+  I +   +   G + ACDTL SQ +GS N   +G++LQR V+++ +  L      +N +P+L+ L QD E++R+   YV +YLP +   F       YLQ+Q ++ P ++++  A + N++  YI I  L FG+  SA+  A   + +      YI   +++  TW G+    +LQ W ++ KL +P  +M+  E W +E+G FLAG ++++ L  Q   +  A   YM + G+  A  +R+G  LGA + + A L+ K ++    + A++   +L  LK  + ++FT+D  I  +  +IL +   L+F D        ++   G+Q   A+     YY IG+P+GI L+F    ++ GFW+GLLI + I+   ++ + F +NWE+   +A  R  ++ L+  Q     +D   E +  I  +       + ++ N       GH+        +I        D LL+++  R T   R
Sbjct:   24 GCVRRYLPLVYREEIYHILRMTGPLVAFRILNYLLPFVITMFCGRLGNSVLAGYGMASATISITTAATGGGLALACDTLVSQTFGSKNLLHVGVILQRGVLILLLFCLPCWALLINTQPLLLLLGQDPEVARIAQLYVIVYLPAVPASFLHQLQVAYLQNQGVILPQVYTAIAANIANVLTNYILITWLDFGVYGSAVANAVAEIYICVFLYAYIRWKRLHCETWGGWSLE-SLQDWGAYMKLAIPSTMMLCFEWWIYEIGGFLAGMLSEMDLAAQHAVLMLATTNYMFNLGMQGATCVRVGNALGAGDTTGAVLTCKVSLTLTALLAVVQGAVLAGLKPVIGFLFTDDRVIVQMVSDILTVYCFLEFFDGLVCVCMGILLGSGQQKIAAVANLIGYYCIGLPLGISLMFAAKLEVVGFWLGLLICVCIQSTFFIVVIFRLNWERVTKEAIERSGKSNLNRRQ-----LDFEGEPSQSIVPANYTSQNSENQNLN-------GHQ-------AVIPHNPNENSDALLDRERPRETCKVR 542          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Yeast
Match: YDR338C_mRNA (Putative protein of unknown function; member of the multi-drug and toxin extrusion (MATE) family of the multidrug/oligosaccharidyl-lipid/polysaccharide (MOP) exporter superfamily [Source:SGD;Acc:S000002746])

HSP 1 Score: 159.458 bits (402), Expect = 1.035e-41
Identity = 124/476 (26.05%), Postives = 223/476 (46.85%), Query Frame = 3
Query:  174 ELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLA----NVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIY--VLGFG-INASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVG-----LLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTN 1565
            E + LA  ++P++   L   + P +  +  GHL K E  A SLA    N+ + +F      G +T+ DTL  Q YGS     +G+ LQR +    + Y+  A      EP+L ++  + E+  +T+ ++ + + G      F    R+LQ+Q I    ++   I    N++V Y  ++   +G G I A+  +     L+ F +    +++    +  W GF    A   W     L   GI+M+  EE ++E+ +  +       L  QS     A L YMI   + I+ + RI  F+GA     A +S++  +   ++A  +   +L+  ++ +  I++ D E+  +   +L L+GI+Q  D+  +  G+ +R  G Q  G+I+   +YY  G+P+ ++L +     + G W+G     LLIGL   V  Y  +F   +W+K  + A I + E +  E  +D+ + D      N
Sbjct:  228 EARVLASYSFPLIFTFLLEQIFPMVCSLTVGHLGKNELAAVSLASMTSNITLAIFE-----GIATSLDTLCPQAYGSGRFYSVGVHLQRCIAFSLVIYIPFAVMWWYSEPLLSYIIPEKELINLTSRFLRVLILGAPAYIFFENLKRFLQAQGIFDAGIYVLTICAPLNVLVSYTLVWNKYIGVGFIGAAIAVVLNFWLMFFLLLFYALYIDG--RKCWGGFS-RKAFTHWNDLGHLAFSGIIMLEAEELSYELLTLFSAYYGVSYLAAQSAVSTMAALLYMIPFAIGISTSTRIANFIGAKRTDFAHISSQVGLSFSFIAGFINCCILVFGRNLIANIYSKDPEVIKLIAQVLPLVGIVQNFDSLNAVAGSCLRGQGMQSLGSIVNLMAYYLFGIPLALILSWFFDMKLYGLWIGIGSAMLLIGL---VEAYYVLF--PDWDKIMTYAEI-LKETEDDEVDSDEYLTDSDDPDEN 689          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Yeast
Match: ERC1 (Member of the multi-drug and toxin extrusion (MATE) family; the MATE family is part of the multidrug/oligosaccharidyl-lipid/polysaccharide (MOP) exporter superfamily; overproduction confers ethionine resistance and accumulation of S-adenosylmethionine [Source:SGD;Acc:S000001074])

HSP 1 Score: 111.309 bits (277), Expect = 4.111e-26
Identity = 91/408 (22.30%), Postives = 176/408 (43.14%), Query Frame = 3
Query:   90 PASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYL-ILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIY--VLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYK---PTWQGF-EFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQ 1292
            PA I    E     G K+    S  +  E + +   A P++   + +      S+    HL   E    +L ++   + G +   G  T  DTL +Q YG+ N   +G+++QR  ++  + +L ++  + +  E IL  +  + E+  + A Y+ +   G+     F    R+LQ Q I +       +    N ++ Y+ ++   +G G   + +       LM    L Y   +K  +     W G      A + W     L +PG+VM+  E   FEV +  A  +    LG QSI    A L Y +   +S++ + R+  F+GA+      ++ + ++L  ++ + +   ++   K  +  +F+ +  +  +  + L L+  +Q  DA  +ST   +R  G+Q
Sbjct:  140 PAEIANTWESAIESGQKI----STTFKRETQVITMNALPLIFTFILQNSLSLASIFSVSHLGTKELGGVTLGSMTANITGLAAIQGLCTCLDTLCAQAYGAKNYHLVGVLVQRCAVITILAFLPMMYVWFVWSEKILALMIPERELCALAANYLRVTAFGVPGFILFECGKRFLQCQGIFHASTIVLFVCAPLNALMNYLLVWNDKIGIGYLGAPLSVVINYWLMTLGLLIYAMTTKHKERPLKCWNGIIPKEQAFKNWRKMINLAIPGVVMVEAEFLGFEVLTIFASHLGTDALGAQSIVATIASLAYQVPFSISVSTSTRVANFIGASLYDSCMITCRVSLLLSFVCSSMNMFVICRYKEQIASLFSTESAVVKMVVDTLPLLAFMQLFDAFNASTAGCLRGQGRQ 543          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Nematostella
Match: EDO46474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ02])

HSP 1 Score: 233.417 bits (594), Expect = 3.313e-70
Identity = 135/405 (33.33%), Postives = 214/405 (52.84%), Query Frame = 3
Query:  174 ELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRG 1388
            E  ++ KLAWP V+  +F F   T SVI  GHL + E    SLA+  I V G S+ +G  TA +TL SQ YG+     +G  LQR + ++++  L+   F +  E  L+ +  + +ISRMT  Y+ + LP L   F      RYLQ Q I+ P+++   +     I + Y+ +  L  GI+  AI       L   + L YI++ KI+  TW+G+ FS  L  W  F  L +PG++MI VE W+FE+GSFL G I+D  +    I  Q A + +M+  G  +A T+ +G  LG+N+P +A L  K +++     + L    ++  + Y+   FT+D E+  +    L ++G     DAS      ++R  G+Q  G ++   +Y+ I +P+GI L F+   D+ G
Sbjct:    3 ECIQILKLAWPTVISQVFTFGLSTQSVIFAGHLGELELATVSLASSFINVTGYSVAVGLCTALETLCSQAYGAKKYGMVGTYLQRGICILSVAMLLTYSFWMQTEHFLLGIGVEQQISRMTDKYIMMSLPILPGIFGQTLLQRYLQVQGIMQPVLYIGMVVFCCAIGINYLLVLTLHLGISGIAISFYVNYYLFSVLLLVYIYIRKIHHLTWKGWSFS-CLDDWRQFIGLAVPGMMMICVEWWSFEIGSFLLGRIDDSNVAAHGILFQLATISFMLPIGTGLAATVSVGMALGSNQPDRAKLVTKVSLIITIAFSALVAICVVCARKYIVLAFTDDREVINLTIQTLPIVGTFLVFDASQGVMAGIIRGSGRQKIGLVLNVITYFIIALPLGITLTFIAHLDLLG 406          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Medaka
Match: ENSORLT00000002449.2 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101156384])

HSP 1 Score: 342.428 bits (877), Expect = 2.237e-109
Identity = 178/496 (35.89%), Postives = 285/496 (57.46%), Query Frame = 3
Query:  138 KLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFH-----LNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEK 1610
            ++R ++ E+Y  ELK L +LA P+V+  L  F+   +S++ CGHL KTE    SL+  II V G SI  G S  CDTL SQ +GS N KR+G++LQR V++     L+LACF      +N EP+L+   Q+ E+SR++  YV +++P L   F +   SRYLQ+Q I++P + +  I  ++N ++ Y+ +Y L  G+  SA   A    L+  +   YI +  ++K TW G+   + LQ W  F KL +P ++M+ +E W FEVG FLAG I + +LG  S+A Q A + YM+  G+S A ++R+G  LGA +  +A LS K  ++  ++ A +  T+L S K  + YIFT+D+EI   A  ++ ++G   F D     TG ++R  GKQ+ GA+     YY  GVPIG+ L+F    ++ G W GL I + ++ + ++   + +NW+K A +A +R       E + +    ++I  + ++ + S   +D   EK
Sbjct:   38 RMRGFIPEEYRNELKHLFRLAGPVVISQLMVFMISFVSMVFCGHLGKTELAGVSLSIAIINVTGISIGTGLSLTCDTLISQTFGSGNLKRVGVILQRGVLI-----LLLACFPCWAVLINTEPLLLAFKQNPEVSRLSQLYVNIFMPSLPASFMYQLQSRYLQNQGIIWPQVITGAIGNIFNAIINYVLLYPLDLGVAGSAAANAISQFLLAVLLFVYICLKGLHKATWDGWSL-DCLQEWGPFVKLAIPSMLMLCLEWWIFEVGGFLAGMIGEAELGAHSVAYQLAVIAYMLPLGISAAASVRVGNALGAGKVEQAKLSCKVPIICGFIVAFMMGTILGSTKDVIGYIFTSDQEILDKAPGVVFVLGFTHFFDCIAGITGGILRGAGKQMVGALCNLVGYYVFGVPIGVSLMFAAHMNVVGLWTGLTICVFMQSSFFLIYLWKLNWKKAAEEAQVRAGVQIKDEKEMEITDCNRIHSQVSVTAPSCDGEDHTYEK 527          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Medaka
Match: slc47a3 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101163594])

HSP 1 Score: 317.005 bits (811), Expect = 6.064e-100
Identity = 179/562 (31.85%), Postives = 297/562 (52.85%), Query Frame = 3
Query:  138 KLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFH-----LNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKI 1808
            ++R  +   +  E+KE++KLA P+++  L  F    +S + CGHL +TE    SLA  +  V G SI +G ++ACDTL SQ YGS N +++G++LQRA+++     L+LACF      +N  PIL+   Q+ E++ +   YV +++P L   F F   SRYLQ+Q I++P + +  +  L N ++ YI ++VL  G+  SA+   F    M  I   YI    ++K TW G+     L  W S+ +L +P +VM+ VE WT+E+G FLAG I++V+LG QSI  + A + YM   G S+A  +R+G  LGA E  +  LSAK  +    + ++    ++  LK ++ Y+FT DE+IR    +++        LDA  ++   ++R  GKQ  GAI     YY IG P+G+ L+F     I+G W GL   + ++    +F    +NW+    +A IR        C+T                TS  P+DAE+ + P+            T+ + DI    ++ +++L       R+ +++R + + + L +  + I++ +
Sbjct:   26 RIRMLVPVGFKSEIKEMSKLAGPVMIAQLMSFAVSFVSTVFCGHLGRTELAGVSLAIAVSNVTGVSIGVGLASACDTLISQTYGSGNLQKVGVILQRAILI-----LLLACFPCWAILINTRPILLAFRQEPEVASLAQLYVKIFMPALPAAFMFSLLSRYLQNQGIIWPQVITGFLVNLLNALINYIFLFVLKMGVAGSALANTFSQFSMAGILFGYIVCRGLHKATWGGWS-KECLHDWGSYIRLAIPSMVMMCVEWWTYEIGGFLAGLISEVELGAQSIVYELANVAYMFPLGFSVAGNVRVGNALGAGETEQGKLSAKLTLFCAGLVSVGMALLIGGLKDHISYVFTYDEKIRERVSDVISFYAPFLLLDAISAACSGIIRGAGKQRVGAICNIVGYYGIGFPVGVPLMFAAKLGIKGLWTGLFTCVSLQCVFLIFYLIRMNWKDVTIEAQIRAG-----ACET-------------YTETSPEPEDAENYRCPS-----------DTTQLDDIDTLPAVSKDELAF-----RNLVLRRGLALALMLFILAAGIILNL 547          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Medaka
Match: slc47a1 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101170536])

HSP 1 Score: 267.7 bits (683), Expect = 3.667e-80
Identity = 154/461 (33.41%), Postives = 253/461 (54.88%), Query Frame = 3
Query:  141 LRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHL--NIEPILIWLSQDVEISRMTATYVTLYLPGLFFDF-HFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFG----CLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINE 1502
            ++ WL   Y  EL  + +LA P++L  +  F  P +  I CGH+   E    +LA+V I V  T+   G + ACDTL SQ +G  N KR+G++LQR+ +++   +  L C+ L  N E +L+ + Q+ +++R+   YV ++LP +   F H +  S YLQ+Q I+ P M+++G+A ++N+   Y+ I VL  G+  SAI  +      CLL+F     YI   K+++ TW G+  +N LQ W S+ KL  P  +MI +E W +E+G FLAGA+ +  L  Q + ++   L YM   G+S AV +R+G  LGA   ++A ++ K  ++   + +++   ++   K     IFT+D +I  +  N L +   LQF D+    +  ++   G Q   A+    SYY IG+P+G  L+F     I G W+G+L    I+ A ++ + F I+W K   KA +R  +
Sbjct:   49 VKRWLPPAYREELYHILRLAGPLLLSRILNFFIPFVVTIYCGHMGNVELAGYALASVTINVTTTATGYGLAVACDTLISQTFGGKNLKRVGVILQRSSLILL--FFCLPCWALLINAENLLLLMKQNADVARIAQLYVMMFLPAVPAMFLHHLQVS-YLQNQGIILPQMYTAGVANVFNLGANYLLISVLKLGVVGSAIANSLSQIVICLLLFG----YIRWRKLHEKTWGGWT-TNCLQDWGSYMKLATPSALMICLEWWVWEIGGFLAGALGEKDLAAQHVLVEIGSLSYMFPLGISAAVCVRVGNALGAGNITRAFVACKLALVLAGVLSVVQGVVIACCKPVAGSIFTSDIDILEIVSNNLTVYIFLQFFDSILCVSSGILVGSGLQKIAALTNLVSYYCIGLPVGAALMFGAHLRILGLWLGILTCSCIQAAFFLVVIFKIDWNKITLKAQLRAGK 501          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Medaka
Match: slc47a4 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101165411])

HSP 1 Score: 258.84 bits (660), Expect = 3.506e-77
Identity = 174/596 (29.19%), Postives = 290/596 (48.66%), Query Frame = 3
Query:  141 LRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHL--NIEPILIWLSQDVEISRMTATYVTLYLPGL-FFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASA----IIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRST----IMKRAILVGITLCLFISSILVK--IYLPRKLYIPCIPTHGN-NTKLSPNKHY 1886
            +RN +   +  EL  + ++  P++L  +  +L P +  + CG L         LA+  + V   +   G + ACDTL SQ +G  N  R+G++LQR +I++ +    L C+ L  N + +L+ L QD  ++R+   Y+T YLP +     H +  S YLQ+Q I+ P M+++ +A + N+   YI IY L  G+  SA    + Q + C+ +F     YIW  K++  TW G+    +LQ W S+ KL +P  +M   E W +E G F AG +++ +L  Q   I  AFL YM   G+  A   R+G  LGA + ++A LS+K ++      AI+   +L S K  + +IFT+DE I  +  +++     LQF D        +    GKQ   A+     YY IG+P+ + L+FV    + GFW+GLLI + ++   Y+ + F +NW+K   +A  R  +         D ++D         +T      A +  H         G+   T+   D  + +   E  ++L ++ D  +    I++R I V   L L    I+V   + LP   +     T G  NT  +P++++
Sbjct:   34 VRNKVPVAHREELYHILRMTGPLLLARILHYLLPFVVTMFCGRLGNNVMAGYGLASATLNVTSAATGFGLALACDTLVSQTFGGRNLLRVGIILQRGIIILLL--FCLPCWGLLINAQAVLLCLGQDPVVARIAQLYITAYLPAVPAMYLHHLQVS-YLQNQGIIMPQMYAAALANIANVATNYIFIYWLQLGVVGSAAANTLSQVYICVFLFG----YIWWKKLHTTTWGGWSVE-SLQEWGSYMKLAIPSTLMTCFEWWVYEFGGFFAGMLSEEELAAQHAVIMVAFLTYMFPLGIQAAACARVGNALGAGDTARAILSSKISLALAGCFAIVEGIVLGSTKTVIGFIFTSDERIVGLVSHLINAYCFLQFFDGLVCVCTGIFLGTGKQKIPAVAHLIGYYCIGLPLCVTLMFVAKLRVLGFWIGLLICVILQSTFYIVVIFKLNWKKMTEEAVKRAQKNTRMALVDADALLD---------NTGNNASQASNNGHS------VEGYVPVTTENNDGKLEEP--ERHVVLKQRRDNLSTSQLILRRGITVIAALGLLSVGIIVHFLVPLPETQFAKANTTEGWINTTYAPSQYF 604          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Medaka
Match: slc47a4 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101165658])

HSP 1 Score: 246.514 bits (628), Expect = 6.905e-73
Identity = 148/468 (31.62%), Postives = 239/468 (51.07%), Query Frame = 3
Query:  141 LRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHL--NIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASA----IIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQT 1526
            +R+ + E +  EL  + ++  P++L  +  +L P +  + CG L         LA+  I V   +   G   ACDTL SQ +G  N  R+G++LQR++I++ +    L C+ L  N   IL+ L QD E++R+   Y+T +LP +   F       YLQ+Q I+ P M+++ +  + N+V  YI IY L  G+  SA    + Q + C+ +F     YIW  KI+  TW G+    +LQ W S+ KL +P  +M   E W +E G F AG +++ +L  Q   I  +F+ YM   G+  A   R+G  LGA + + A L+++  +       ++   +L S K  + +IFT DE I  +   ++     LQF D        +    GKQ   A+  F  YY +G+ + I L+F     I GFWVGLL+ +  +   Y+ + F +NWEK A +A   +  A+++ C T
Sbjct:   14 VRHSVPEAHREELYHILRMTGPLLLSRILNYLLPFVVTMFCGRLGNEVMAGYGLASATINVTTAATGYGLGLACDTLVSQTFGGKNLLRVGVILQRSIIILLL--FCLPCWGLLINAHAILLCLGQDPEVARIAQLYITAFLPAVPAMFLHNLQVSYLQNQGIILPQMYTATLGNVANVVTNYILIYWLDLGVGGSAAANTLSQIYICVFLFL----YIWWRKIHVKTWGGWSV-ESLQEWGSYMKLAVPSTLMKCFEWWVYEFGGFFAGMMSEDELAAQHAVIMVSFITYMFPFGIQAAACARVGNALGAGDNTGALLTSRVALTLAGSICVVEGLVLGSTKTVIGFIFTADERIIHLVSQLMTAYCFLQFFDGLVCVCTGIFLGAGKQKIPAVANFIGYYCLGLSLSITLMFAAKLRILGFWVGLLVCVIFQSTFYIVVIFRLNWEKIADEA---VKRAQITTCMT 471          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000005477.1 (SMESG000005477.1)

HSP 1 Score: 1259.97 bits (3259), Expect = 0.000e+0
Identity = 614/615 (99.84%), Postives = 614/615 (99.84%), Query Frame = 3
Query:   72 VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYSM 1916
            VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAED KHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYSM
Sbjct:    9 VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDVKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYSM 623          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000005477.1 (SMESG000005477.1)

HSP 1 Score: 1258.43 bits (3255), Expect = 0.000e+0
Identity = 613/615 (99.67%), Postives = 614/615 (99.84%), Query Frame = 3
Query:   72 VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYSM 1916
            VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAED KHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYS+
Sbjct:    9 VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDVKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYSI 623          

HSP 2 Score: 220.32 bits (560), Expect = 1.752e-61
Identity = 102/108 (94.44%), Postives = 107/108 (99.07%), Query Frame = 3
Query:  108 QQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRA 431
            +++GIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANV+IQVFGTS+DLGFSTACDTLFSQIYGSSNRKRLGLMLQR 
Sbjct:  751 KEDGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVLIQVFGTSVDLGFSTACDTLFSQIYGSSNRKRLGLMLQRG 858          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000005477.1 (SMESG000005477.1)

HSP 1 Score: 1257.28 bits (3252), Expect = 0.000e+0
Identity = 613/615 (99.67%), Postives = 614/615 (99.84%), Query Frame = 3
Query:   72 VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYSM 1916
            VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAED KHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYS+
Sbjct:    9 VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDVKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYSI 623          

HSP 2 Score: 1033.86 bits (2672), Expect = 0.000e+0
Identity = 520/618 (84.14%), Postives = 554/618 (89.64%), Query Frame = 3
Query:  108 QQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTI---TYLILACFHLNIEPIL-----------IWLSQDVEISRM-TATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYSM 1916
            +++GIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANV+IQVFGTS+DLGFSTACDTLFSQIYGSSNRKRLGLMLQR   V  +    Y +     LN   IL             L ++++  +    + +T+     +FDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYV GFGINASAIIQAFGC +MF IQ  YIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWT EVGSFLAGAI+DVQLGGQSIAIQTAFLCYMIH+GLSIAVTIRIGQFLGANEP KAS+SAKANMLTDY+AAILTT ML SL+HYLPYIFTNDEEIRVVAEN+LLLIGILQ LDAS SST AVMRACGKQL GAIIMFFSYYA+GVPIGIVLIFVVA DIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKL++C+ DD+ ID+ SEKTNLI T ELP+DAE+ KHP+PVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTI+KRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDT+YSM
Sbjct:  751 KEDGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVLIQVFGTSVDLGFSTACDTLFSQIYGSSNRKRLGLMLQRDKCVNEVRATAYPVETLNDLNTSGILPNKLVYKVGSPDMLLRNLDPPKFCNGSRLTVKALNNYFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVFGFGINASAIIQAFGCFIMFMIQFIYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTCEVGSFLAGAISDVQLGGQSIAIQTAFLCYMIHSGLSIAVTIRIGQFLGANEPQKASISAKANMLTDYIAAILTTIMLFSLRHYLPYIFTNDEEIRVVAENLLLLIGILQLLDASASSTAAVMRACGKQLLGAIIMFFSYYAVGVPIGIVLIFVVATDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLTKCRIDDISIDETSEKTNLIGTRELPEDAENAKHPDPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTILKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTLYSM 1368          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000005477.1 (SMESG000005477.1)

HSP 1 Score: 1256.51 bits (3250), Expect = 0.000e+0
Identity = 613/615 (99.67%), Postives = 614/615 (99.84%), Query Frame = 3
Query:   72 VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYSM 1916
            VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAED KHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYS+
Sbjct:    9 VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDVKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYSI 623          

HSP 2 Score: 220.705 bits (561), Expect = 1.595e-61
Identity = 104/113 (92.04%), Postives = 108/113 (95.58%), Query Frame = 3
Query:   93 ASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRA 431
            A +R   +GIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANV+IQVFGTS+DLGFSTACDTLFSQIYGSSNRKRLGLMLQR 
Sbjct:  781 AVLRHDIDGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVLIQVFGTSVDLGFSTACDTLFSQIYGSSNRKRLGLMLQRG 893          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000005477.1 (SMESG000005477.1)

HSP 1 Score: 1255.74 bits (3248), Expect = 0.000e+0
Identity = 613/615 (99.67%), Postives = 614/615 (99.84%), Query Frame = 3
Query:   72 VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDEKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYSM 1916
            VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAED KHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYS+
Sbjct:    9 VLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWLSQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIACLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPTWQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLGGQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTDYMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGSSTGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLLIGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISEKTNLISTSELPDDAEDVKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEEDLLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGNNTKLSPNKHYPFCNDTMYSI 623          

HSP 2 Score: 214.542 bits (545), Expect = 2.440e-59
Identity = 103/113 (91.15%), Postives = 107/113 (94.69%), Query Frame = 3
Query:   93 ASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFSTACDTLFSQIYGSSNRKRLGLMLQRA 431
            A +R   +GIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLAN +IQVFGTS+DLGFSTACDTLFSQIYGSSNRKRLGLMLQR 
Sbjct:  781 AVLRHDIDGIQVYGGKLRNWLSEKYFPELKELAKLAWPIVLMNLFRFLNPTISVIMCGHLRKTEFDAASLAN-LIQVFGTSVDLGFSTACDTLFSQIYGSSNRKRLGLMLQRG 892          
The following BLAST results are available for this feature:
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC47A16.664e-9135.29solute carrier family 47 member 1 [Source:HGNC Sym... [more]
SLC47A19.273e-9134.82solute carrier family 47 member 1 [Source:HGNC Sym... [more]
SLC47A24.578e-8032.92solute carrier family 47 member 2 [Source:HGNC Sym... [more]
SLC47A21.820e-7531.50solute carrier family 47 member 2 [Source:HGNC Sym... [more]
SLC47A11.924e-6933.49solute carrier family 47 member 1 [Source:HGNC Sym... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX248108.11.170e-9431.94multidrug and toxin extrusion protein 1-like [Sour... [more]
slc47a2.11.882e-9431.89solute carrier family 47 member 2.1 [Source:NCBI g... [more]
slc47a34.527e-9335.10solute carrier family 47 member 3 [Source:ZFIN;Acc... [more]
slc47a49.549e-8132.97solute carrier family 47 member 4 [Source:ZFIN;Acc... [more]
slc47a37.766e-7934.70solute carrier family 47 member 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmed62.639e-8234.60transmembrane p24 trafficking protein 6 [Source:Xe... [more]
slc47a21.271e-6732.91solute carrier family 47 (multidrug and toxin extr... [more]
ccdc85a6.346e-6133.85coiled-coil domain containing 85A [Source:Xenbase;... [more]
ccdc85a1.038e-6034.56coiled-coil domain containing 85A [Source:Xenbase;... [more]
tysnd11.078e-2637.16trypsin domain containing 1 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc47a14.334e-8834.50solute carrier family 47, member 1 [Source:MGI Sym... [more]
Slc47a27.310e-8831.10solute carrier family 47, member 2 [Source:MGI Sym... [more]
Slc47a22.282e-8534.29solute carrier family 47, member 2 [Source:MGI Sym... [more]
Slc47a15.913e-3737.16solute carrier family 47, member 1 [Source:MGI Sym... [more]
Slc47a12.287e-3042.07solute carrier family 47, member 1 [Source:MGI Sym... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1L1P9|S47A1_DANRE1.421e-9331.89Multidrug and toxin extrusion protein 1 OS=Danio r... [more]
sp|Q5RFD2|S47A1_PONAB4.210e-9134.87Multidrug and toxin extrusion protein 1 OS=Pongo a... [more]
sp|Q96FL8|S47A1_HUMAN3.200e-9035.29Multidrug and toxin extrusion protein 1 OS=Homo sa... [more]
sp|A7KAU2|S47A1_RABIT1.625e-8832.81Multidrug and toxin extrusion protein 1 OS=Oryctol... [more]
sp|Q8K0H1|S47A1_MOUSE3.031e-8734.50Multidrug and toxin extrusion protein 1 OS=Mus mus... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJI20.000e+055.80Multidrug and toxin extrusion protein (Fragment) O... [more]
A0A0H3YKK16.990e-13336.57Multidrug and toxin extrusion protein OS=Schmidtea... [more]
A0A3Q0KMD54.890e-12942.98Multidrug and toxin extrusion protein OS=Schistoso... [more]
A0A267E4V03.204e-12739.38Multidrug and toxin extrusion protein OS=Macrostom... [more]
A0A267GF855.438e-12740.23Multidrug and toxin extrusion protein OS=Macrostom... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc47a31.051e-9835.31multidrug and toxin extrusion protein 1-like [Sour... [more]
slc47a32.347e-9835.31multidrug and toxin extrusion protein 1-like [Sour... [more]
slc47a2.17.470e-9331.47solute carrier family 47 member 1 [Source:NCBI gen... [more]
slc47a11.546e-8330.56multidrug and toxin extrusion protein 1-like [Sour... [more]
ENSAMXT00000033072.11.662e-7527.83multidrug and toxin extrusion protein 1-like [Sour... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YDR338C_mRNA1.035e-4126.05Putative protein of unknown function; member of th... [more]
ERC14.111e-2622.30Member of the multi-drug and toxin extrusion (MATE... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO464743.313e-7033.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000002449.22.237e-10935.89multidrug and toxin extrusion protein 1 [Source:NC... [more]
slc47a36.064e-10031.85multidrug and toxin extrusion protein 1 [Source:NC... [more]
slc47a13.667e-8033.41multidrug and toxin extrusion protein 1 [Source:NC... [more]
slc47a43.506e-7729.19multidrug and toxin extrusion protein 1 [Source:NC... [more]
slc47a46.905e-7331.62multidrug and toxin extrusion protein 1 [Source:NC... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005477.10.000e+099.84SMESG000005477.1[more]
SMESG000005477.11.752e-6199.67SMESG000005477.1[more]
SMESG000005477.10.000e+099.67SMESG000005477.1[more]
SMESG000005477.11.595e-6199.67SMESG000005477.1[more]
SMESG000005477.12.440e-5999.67SMESG000005477.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030864 ID=SMED30030864|Name=Multidrug and toxin extrusion protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1955bp
CCCTTCAATTTTAAAAAAAATATCAAATAATCACAAATAAAATTTGCAGC
ATTAAAATGACAAAGTTTTGCGTTCTTTGCACAAACATTCCCGCATCAAT
CCGCAAACAGCAAGAGGGGATTCAAGTTTATGGAGGAAAACTTAGAAACT
GGCTTTCTGAGAAGTATTTTCCAGAACTGAAAGAATTGGCAAAACTTGCA
TGGCCGATTGTTTTGATGAATTTGTTTCGATTCTTGAATCCAACTATTAG
TGTCATAATGTGCGGTCATTTGCGAAAAACAGAATTCGATGCTGCTTCCC
TGGCAAATGTAATAATTCAAGTGTTTGGTACTTCTATCGACTTGGGGTTT
TCTACAGCTTGTGATACTTTATTTTCGCAAATCTATGGAAGTTCAAACCG
TAAACGGCTGGGATTGATGCTTCAAAGAGCTGTAATAGTCATGACTATAA
CGTATTTGATACTAGCTTGCTTCCATCTCAATATAGAGCCCATATTAATA
TGGCTGAGTCAAGATGTGGAAATCTCTAGAATGACTGCCACATACGTCAC
TCTGTATTTGCCAGGATTATTTTTTGACTTTCATTTCATGACCTTTTCTC
GATACCTTCAAAGTCAAAATATTGTTTATCCTATGATGTTTTCATCTGGA
ATTGCTTGCCTTTACAATATTGTTGTCCAATATATCGCGATTTATGTTCT
CGGTTTCGGTATAAACGCATCTGCCATCATTCAAGCATTTGGATGCCTTC
TGATGTTCACAATTCAATTAACTTATATATGGGTATCGAAAATATATAAA
CCAACTTGGCAAGGCTTTGAGTTCTCCAATGCACTTCAAGGTTGGGAAAG
CTTTTTCAAACTTGGTCTACCAGGAATCGTCATGATAGGCGTTGAAGAAT
GGACATTTGAAGTAGGGAGTTTCTTAGCGGGAGCCATTAATGATGTTCAG
TTAGGGGGTCAAAGCATAGCAATCCAAACTGCATTTCTATGTTATATGAT
ACATGCTGGTCTGTCCATTGCTGTGACTATTCGTATTGGTCAATTTCTAG
GAGCCAACGAACCTTCAAAAGCTTCTCTTTCAGCTAAGGCAAACATGCTA
ACAGACTATATGGCAGCCATTCTGACGACGACGATGTTATTATCTTTAAA
ACACTACTTGCCTTACATTTTCACCAACGATGAAGAAATAAGAGTAGTTG
CTGAAAACATTCTTTTATTAATTGGAATTCTGCAATTCCTCGATGCATCT
GGTAGTTCAACTGGCGCTGTAATGAGAGCTTGTGGTAAGCAATTGCCCGG
AGCAATCATTATGTTCTTTAGCTACTATGCCATAGGGGTACCGATTGGTA
TCGTTCTAATTTTTGTAGTGGCCCCGGATATCAGAGGGTTTTGGGTCGGA
TTACTGATCGGTCTAGGAATAGAGGTAGCAATTTACATGTTCATTTTCTT
CACAATTAATTGGGAGAAAGAAGCATCAAAGGCTGCAATAAGAATAAACG
AAGCAAAATTATCAGAGTGTCAAACTGATGACATGATTATCGATAAAATA
TCTGAAAAAACAAATCTCATTAGTACAAGTGAATTGCCAGATGACGCGGA
AGATGAAAAACATCCGAATCCAGTGCTATTATTCCGACCTGGACATAAAA
GACCTACTAGCAGCGTTACGGATATAATTATTTCTAAATCAATTCACGAA
GAAGATTTATTACTCAATAAAAAGATTGACAGATCTACTATTATGAAAAG
AGCGATTTTAGTTGGAATTACTTTATGTTTATTTATTTCGTCCATTTTGG
TAAAAATCTACCTGCCCCGCAAGCTGTACATTCCATGCATTCCAACGCAT
GGCAATAATACCAAGTTATCCCCGAATAAGCATTATCCGTTTTGTAATGA
CACAATGTATTCCATGTGAGCATTTAGGGAAATGAATATTTTCAAATACA
ATTCA
back to top

protein sequence of SMED30030864-orf-1

>SMED30030864-orf-1 ID=SMED30030864-orf-1|Name=SMED30030864-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=621bp
MTKFCVLCTNIPASIRKQQEGIQVYGGKLRNWLSEKYFPELKELAKLAWP
IVLMNLFRFLNPTISVIMCGHLRKTEFDAASLANVIIQVFGTSIDLGFST
ACDTLFSQIYGSSNRKRLGLMLQRAVIVMTITYLILACFHLNIEPILIWL
SQDVEISRMTATYVTLYLPGLFFDFHFMTFSRYLQSQNIVYPMMFSSGIA
CLYNIVVQYIAIYVLGFGINASAIIQAFGCLLMFTIQLTYIWVSKIYKPT
WQGFEFSNALQGWESFFKLGLPGIVMIGVEEWTFEVGSFLAGAINDVQLG
GQSIAIQTAFLCYMIHAGLSIAVTIRIGQFLGANEPSKASLSAKANMLTD
YMAAILTTTMLLSLKHYLPYIFTNDEEIRVVAENILLLIGILQFLDASGS
STGAVMRACGKQLPGAIIMFFSYYAIGVPIGIVLIFVVAPDIRGFWVGLL
IGLGIEVAIYMFIFFTINWEKEASKAAIRINEAKLSECQTDDMIIDKISE
KTNLISTSELPDDAEDEKHPNPVLLFRPGHKRPTSSVTDIIISKSIHEED
LLLNKKIDRSTIMKRAILVGITLCLFISSILVKIYLPRKLYIPCIPTHGN
NTKLSPNKHYPFCNDTMYSM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0042908xenobiotic transport
GO:0006855drug transmembrane transport
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0042910xenobiotic transporter activity
GO:0015238drug transmembrane transporter activity
GO:0015297antiporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR002528MATE_fam
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane