WD repeat-containing protein 1

Overview
NameWD repeat-containing protein 1
Smed IDSMED30030860
Length (bp)2058
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat-containing protein 1 (SMED30030860) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat-containing protein 1 (SMED30030860) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat-containing protein 1 (SMED30030860) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat-containing protein 1 (SMED30030860) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030860

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30030860SMESG000001249.1 PL08005B2A03ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30030860SMESG000001249.1 dd_Smed_v4_1739_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030860SMESG000001249.1 dd_Smed_v4_1739_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030860SMESG000001249.1 dd_Smed_v4_1739_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030860SMESG000001249.1 dd_Smed_v4_1739_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat-containing protein 1 vs. Ensembl Human
Match: WDR1 (WD repeat domain 1 [Source:HGNC Symbol;Acc:HGNC:12754])

HSP 1 Score: 469.929 bits (1208), Expect = 8.923e-158
Identity = 250/618 (40.45%), Postives = 378/618 (61.17%), Query Frame = 3
Query:   93 ELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEEL-GNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIAL-SNNEVFSVGVDDRLVITDLLSKTMKDD--LKLTSQPRKVSV-VDSLVAVACYKEI-MLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTP---RDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVT 1913
            E+ +  A+LP+ ERG   ++G DPK  NFLYTNG  VI+RNID+   +DIYT+H+ +  VAKY+PSGFYIASGD++GK+RIWDTTQKEH+LK EYQP +GKI DI+W+ D+ ++A+ G+GREKFGAV   D+G++VGEI+G  K IN++D+K +RP+RLAT S+D   AF EGPPFKFK     HS F NC+R+SP+G+ F +A AD +I+++DGKTGE++  L G+ AH GGIYAI+++ D +HL+SA GDK  K+W ++     V  +  GSTV D Q+GC W  D ++SVSLSG I+     D     KP  VI GH K I  L+   + G + + S   DG I  WD   G+ +      H+NQ+  + +  + ++ S  +DD +  T L+ +       +KL  QP+ V+V       V C  +I +L +  +  ++    YEP  +A+ P   T+ +GG +  + +Y I       TL  E  LL       D  +S++G+ L   D+ + V++F V    S +++   +H         ++ C+A + D+   ASG +D  + +W++  P  +  I++AH + +++SL W D HTL +   D+++K+W +T
Sbjct:    4 EIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYTEHAHQVVVAKYAPSGFYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVS-VNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYL---DRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILG----TTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHH--------AKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTIT 605          
BLAST of WD repeat-containing protein 1 vs. Ensembl Human
Match: WDR1 (WD repeat domain 1 [Source:HGNC Symbol;Acc:HGNC:12754])

HSP 1 Score: 469.929 bits (1208), Expect = 8.923e-158
Identity = 250/618 (40.45%), Postives = 378/618 (61.17%), Query Frame = 3
Query:   93 ELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEEL-GNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIAL-SNNEVFSVGVDDRLVITDLLSKTMKDD--LKLTSQPRKVSV-VDSLVAVACYKEI-MLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTP---RDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVT 1913
            E+ +  A+LP+ ERG   ++G DPK  NFLYTNG  VI+RNID+   +DIYT+H+ +  VAKY+PSGFYIASGD++GK+RIWDTTQKEH+LK EYQP +GKI DI+W+ D+ ++A+ G+GREKFGAV   D+G++VGEI+G  K IN++D+K +RP+RLAT S+D   AF EGPPFKFK     HS F NC+R+SP+G+ F +A AD +I+++DGKTGE++  L G+ AH GGIYAI+++ D +HL+SA GDK  K+W ++     V  +  GSTV D Q+GC W  D ++SVSLSG I+     D     KP  VI GH K I  L+   + G + + S   DG I  WD   G+ +      H+NQ+  + +  + ++ S  +DD +  T L+ +       +KL  QP+ V+V       V C  +I +L +  +  ++    YEP  +A+ P   T+ +GG +  + +Y I       TL  E  LL       D  +S++G+ L   D+ + V++F V    S +++   +H         ++ C+A + D+   ASG +D  + +W++  P  +  I++AH + +++SL W D HTL +   D+++K+W +T
Sbjct:    4 EIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYTEHAHQVVVAKYAPSGFYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVS-VNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYL---DRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILG----TTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHH--------AKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTIT 605          
BLAST of WD repeat-containing protein 1 vs. Ensembl Human
Match: WDR1 (WD repeat domain 1 [Source:HGNC Symbol;Acc:HGNC:12754])

HSP 1 Score: 298.901 bits (764), Expect = 1.664e-96
Identity = 137/243 (56.38%), Postives = 186/243 (76.54%), Query Frame = 3
Query:   78 RMLSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEEL-GNPAHKGGIYAIA 803
            R +     +  A+LP+ ERG   ++G DPK  NFLYTNG  VI+RNID+   +DIYT+H+ +  VAKY+PSGFYIASGD++GK+RIWDTTQKEH+LK EYQP +GKI DI+W+ D+ ++A+ G+GREKFGAV   D+G++VGEI+G  K IN++D+K +RP+RLAT S+D   AF EGPPFKFK     HS F NC+R+SP+G+ F +A AD +I+++DGKTGE++  L G+ AH GGIYA++
Sbjct:    3 RRICVSAEKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYTEHAHQVVVAKYAPSGFYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAVS 245          
BLAST of WD repeat-containing protein 1 vs. Ensembl Human
Match: WDR1 (WD repeat domain 1 [Source:HGNC Symbol;Acc:HGNC:12754])

HSP 1 Score: 238.039 bits (606), Expect = 2.553e-70
Identity = 150/466 (32.19%), Postives = 245/466 (52.58%), Query Frame = 3
Query:  582 EDGVVAFLEGPPFK---FKTNHQC--------HSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELG-NPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIAL-SNNEVFSVGVDDRLVITDLLSKTMKDD--LKLTSQPRKVSV-VDSLVAVACYKEI-MLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTP---RDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVT 1913
            E GV   + G P       TN +C        HS F NC+R+SP+G+ F +A AD +I+++DGKTGE++  LG + AH GGIYAI+++ D +HL+SA GDK  K+W ++     V  +  GSTV D Q+GC W  D ++SVSLSG I+     D     KP  VI GH K I  L+   + G + + S   DG I  WD   G+ +      H+NQ+  + +  + ++ S  +DD +  T L+ +       +KL  QP+ V+V       V C  +I +L +  +  ++    YEP  +A+ P   T+ +GG +  + +Y I       TL  E  LL       D  +S++G+ L   D+ + V++F V    S +++   +H         ++ C+A + D+   ASG +D  + +W++  P  +  I++AH + +++SL W D HTL +   D+++K+W +T
Sbjct:   16 ERGVSKIIGGDPKGNNFLYTNGKCVILRNIDDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSV-NSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYL---DRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILG----TTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHH--------AKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTIT 465          

HSP 2 Score: 87.4261 bits (215), Expect = 1.680e-17
Identity = 128/518 (24.71%), Postives = 199/518 (38.42%), Query Frame = 3
Query:   93 ELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKC-EYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKST-RPFRLATSSEDGVVAFLE-GPPFKFKTNHQCHSNFANCLRYSPNG--DVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLS-GNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKDDLKLTSQPRKVSVV----DSLVAVAC--YKEIMLANNTEPLTLLPVSY----EPSCLALSPNKTTLVVGGEEFKIFVY---------KIANDYR-----SLTLLSEFTLLNTPRD 1556
            E+ +  A+LP+ ERG   ++G DPK  NFLYTNG  VI+RNIDD         HS      ++SP G   A+   +G+I I+D    E +      +   G I  ISWS D+T L +   G +K   + +V   + V     M   + +  L    +   L + S  G + +L+   P K     + HS    CL    NG      S   D  I  +D +TGE  +      H   +  +  +  G  LIS   D  ++   +   R + G+   G    D+Q  C  +G    +V +  G I L K                               K  S D+ G                   +  ++ ++    + V   GVD  + +  +L  T+KD+ KL      V+ V    D      C   K + + +  +  +   V Y    +  CLA SP+      GG +  ++V+         KI + +R     SL  L E TL+ T  D
Sbjct:    4 EIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDD---------HSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHL-LSASG-DKTSKIWDVSVNSVVSTFP-MGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGEN-DSFAGKGHTNQVSRMTVDESG-QLISCSMDDTVRYTSLML-RDYSGQ---GVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLK----------------------------DQRKCFSIDNPG-------------------YEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHD 456          
BLAST of WD repeat-containing protein 1 vs. Ensembl Human
Match: WDR1 (WD repeat domain 1 [Source:HGNC Symbol;Acc:HGNC:12754])

HSP 1 Score: 238.039 bits (606), Expect = 2.553e-70
Identity = 150/466 (32.19%), Postives = 245/466 (52.58%), Query Frame = 3
Query:  582 EDGVVAFLEGPPFK---FKTNHQC--------HSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELG-NPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIAL-SNNEVFSVGVDDRLVITDLLSKTMKDD--LKLTSQPRKVSV-VDSLVAVACYKEI-MLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTP---RDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVT 1913
            E GV   + G P       TN +C        HS F NC+R+SP+G+ F +A AD +I+++DGKTGE++  LG + AH GGIYAI+++ D +HL+SA GDK  K+W ++     V  +  GSTV D Q+GC W  D ++SVSLSG I+     D     KP  VI GH K I  L+   + G + + S   DG I  WD   G+ +      H+NQ+  + +  + ++ S  +DD +  T L+ +       +KL  QP+ V+V       V C  +I +L +  +  ++    YEP  +A+ P   T+ +GG +  + +Y I       TL  E  LL       D  +S++G+ L   D+ + V++F V    S +++   +H         ++ C+A + D+   ASG +D  + +W++  P  +  I++AH + +++SL W D HTL +   D+++K+W +T
Sbjct:   16 ERGVSKIIGGDPKGNNFLYTNGKCVILRNIDDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSV-NSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYL---DRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILG----TTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHH--------AKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTIT 465          

HSP 2 Score: 87.4261 bits (215), Expect = 1.680e-17
Identity = 128/518 (24.71%), Postives = 199/518 (38.42%), Query Frame = 3
Query:   93 ELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKC-EYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKST-RPFRLATSSEDGVVAFLE-GPPFKFKTNHQCHSNFANCLRYSPNG--DVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLS-GNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKDDLKLTSQPRKVSVV----DSLVAVAC--YKEIMLANNTEPLTLLPVSY----EPSCLALSPNKTTLVVGGEEFKIFVY---------KIANDYR-----SLTLLSEFTLLNTPRD 1556
            E+ +  A+LP+ ERG   ++G DPK  NFLYTNG  VI+RNIDD         HS      ++SP G   A+   +G+I I+D    E +      +   G I  ISWS D+T L +   G +K   + +V   + V     M   + +  L    +   L + S  G + +L+   P K     + HS    CL    NG      S   D  I  +D +TGE  +      H   +  +  +  G  LIS   D  ++   +   R + G+   G    D+Q  C  +G    +V +  G I L K                               K  S D+ G                   +  ++ ++    + V   GVD  + +  +L  T+KD+ KL      V+ V    D      C   K + + +  +  +   V Y    +  CLA SP+      GG +  ++V+         KI + +R     SL  L E TL+ T  D
Sbjct:    4 EIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDD---------HSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHL-LSASG-DKTSKIWDVSVNSVVSTFP-MGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGEN-DSFAGKGHTNQVSRMTVDESG-QLISCSMDDTVRYTSLML-RDYSGQ---GVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLK----------------------------DQRKCFSIDNPG-------------------YEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHD 456          
BLAST of WD repeat-containing protein 1 vs. Ensembl Celegans
Match: aipl-1 (AIP1 (Actin Interacting Protein 1) Like [Source:UniProtKB/TrEMBL;Acc:O17939])

HSP 1 Score: 427.943 bits (1099), Expect = 5.689e-142
Identity = 247/613 (40.29%), Postives = 356/613 (58.08%), Query Frame = 3
Query:   93 ELLQT--LATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQ---LEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNN-EVFSVGVDDRLVITDLLSKTMKDDLKLTSQPRKVSVVDSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPA-NKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKV 1910
            E  QT    +LPR  RG  ++LGS P     LY NGNSV    ID L  +DIYT+H+ + TVAK SP+GFY ASGD  G IRIWDTTQ  HILK      SG + DI+W S++ ++A  G+G+E+FG V  +DT T+ G ++G ++ +N++D K TRPFR+ + S+D  VA  EGPPFKFK     H  F    RY+ +G +F S G+D  + +++G  GE+   LE+    AH G I+A+A++ D S + +A  DK +K+W ++  R      V GS ++D Q+G  W    +I+VS+SG ++    DD        ++  GH K ITALS SS    L S+D++G I TW+I +G +    K+ H+  I     S+N ++F+VG DD+L ITD    T     KL SQP  + V D L  VACYK +++ +   P T  P+ +  +C+A    K+ + VGG++ K+ VYK+  D R L  L +           FS++G  L   D  RKV  + V    +  S+ +P     W FHT +V  VA + D+  +A+GS+D S+IIW +++P  +  IIK AHPMS++  + W D  T+ SAGQDSNIK W V
Sbjct:    3 EFSQTAVFPSLPRAARGVPVILGSSPAGDKILYCNGNSVFTIPIDSLNSADIYTEHAHQTTVAKISPTGFYCASGDTQGNIRIWDTTQSTHILKHTIPVFSGPVKDIAWDSESKRIAAVGEGKERFGHVFLLDTTTSNGSLTGQSRTMNSVDFKPTRPFRIISGSDDNTVAIFEGPPFKFKHTFDHHKKFVQSTRYNNDGSLFASTGSDGTVVLYNGVDGEKVGVLEDAKGVAHTGSIFALAWSPDQSRIATASADKSVKIWDVSA-RKLERTIVMGSKIEDQQLGIVWTKSALITVSVSGFLNFLNPDD----GSVEKIRQGHNKAITALSKSSDGKFLFSADAEGHITTWEISSGTSSR--KSPHTTMITGAQTSSNGDLFTVGWDDQLKITDGSGDTKS--FKLPSQPCGLEVSDDLAIVACYKHVVVLSRGTP-TENPIEFHSTCVAFCAEKSLVAVGGKDAKVHVYKLNGDGR-LEELKKIEHSAEITAVSFSDDGEYLAVTDLARKVIPYSVS---TDFSVTSP---NSWTFHTSKVLTVAWSPDNQRLATGSIDTSVIIWDMKKPGEHPVIIKGAHPMSSVNVVRWLDETTVVSAGQDSNIKFWNV 598          
BLAST of WD repeat-containing protein 1 vs. Ensembl Celegans
Match: aipl-1 (AIP1 (Actin Interacting Protein 1) Like [Source:UniProtKB/TrEMBL;Acc:O17939])

HSP 1 Score: 427.943 bits (1099), Expect = 5.689e-142
Identity = 247/613 (40.29%), Postives = 356/613 (58.08%), Query Frame = 3
Query:   93 ELLQT--LATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQ---LEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNN-EVFSVGVDDRLVITDLLSKTMKDDLKLTSQPRKVSVVDSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPA-NKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKV 1910
            E  QT    +LPR  RG  ++LGS P     LY NGNSV    ID L  +DIYT+H+ + TVAK SP+GFY ASGD  G IRIWDTTQ  HILK      SG + DI+W S++ ++A  G+G+E+FG V  +DT T+ G ++G ++ +N++D K TRPFR+ + S+D  VA  EGPPFKFK     H  F    RY+ +G +F S G+D  + +++G  GE+   LE+    AH G I+A+A++ D S + +A  DK +K+W ++  R      V GS ++D Q+G  W    +I+VS+SG ++    DD        ++  GH K ITALS SS    L S+D++G I TW+I +G +    K+ H+  I     S+N ++F+VG DD+L ITD    T     KL SQP  + V D L  VACYK +++ +   P T  P+ +  +C+A    K+ + VGG++ K+ VYK+  D R L  L +           FS++G  L   D  RKV  + V    +  S+ +P     W FHT +V  VA + D+  +A+GS+D S+IIW +++P  +  IIK AHPMS++  + W D  T+ SAGQDSNIK W V
Sbjct:    3 EFSQTAVFPSLPRAARGVPVILGSSPAGDKILYCNGNSVFTIPIDSLNSADIYTEHAHQTTVAKISPTGFYCASGDTQGNIRIWDTTQSTHILKHTIPVFSGPVKDIAWDSESKRIAAVGEGKERFGHVFLLDTTTSNGSLTGQSRTMNSVDFKPTRPFRIISGSDDNTVAIFEGPPFKFKHTFDHHKKFVQSTRYNNDGSLFASTGSDGTVVLYNGVDGEKVGVLEDAKGVAHTGSIFALAWSPDQSRIATASADKSVKIWDVSA-RKLERTIVMGSKIEDQQLGIVWTKSALITVSVSGFLNFLNPDD----GSVEKIRQGHNKAITALSKSSDGKFLFSADAEGHITTWEISSGTSSR--KSPHTTMITGAQTSSNGDLFTVGWDDQLKITDGSGDTKS--FKLPSQPCGLEVSDDLAIVACYKHVVVLSRGTP-TENPIEFHSTCVAFCAEKSLVAVGGKDAKVHVYKLNGDGR-LEELKKIEHSAEITAVSFSDDGEYLAVTDLARKVIPYSVS---TDFSVTSP---NSWTFHTSKVLTVAWSPDNQRLATGSIDTSVIIWDMKKPGEHPVIIKGAHPMSSVNVVRWLDETTVVSAGQDSNIKFWNV 598          
BLAST of WD repeat-containing protein 1 vs. Ensembl Celegans
Match: unc-78 (Actin-interacting protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q11176])

HSP 1 Score: 425.246 bits (1092), Expect = 9.477e-141
Identity = 247/630 (39.21%), Postives = 371/630 (58.89%), Query Frame = 3
Query:   93 ELLQT--LATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQL-----EELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYV-FGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPY--EVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSI-ALSNNEVFSVGVDDRLVITDL------LSKTMKDDLKLTSQPRKVSV-VDSLVAV-ACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDF---MFSNNGSLLVCGDSDRKVSLFKVG-QFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANK-FIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKV 1910
            E  QT    +LPRT RG  +VLG+ P      Y NG SV    +  L D++IYT+HS + TVAK SPSG+Y ASGD++G +RIWDTTQ  HILK      SG + DISW S++ ++A  G+GRE+FG V   DTGT+ G ++G A+ +N++D K +RPFR+ + S+D  VA  EGPPFKFK+    H+ F + +RY+P+G +F S G D  I +++G  G +      + L N AH G ++ + ++ DG+ + SA  DK +K+W +   +  V + +  G+ ++D Q+G  W    ++S+S +G      F + +  E     +V  GH K ITALS S+    L S+D++G I +WDI  G +  +  +VH+  I  I   S  ++F+V  DD L +          SK + +  KL+SQP  ++V  D  +AV ACYK I + ++ + LT +P+SY  SC+ALS +K  + VGG++ K+ VYK+     S   +SE   +  P +     FSNNG+ LV  D  RKV  + V   F+         H   W FHT +V+CV+ + D+  +A+GSLD S+I+W++ +P++   IIK AH MS++ S++W +  T+ SAGQDSNIK W V
Sbjct:    3 EFSQTALFPSLPRTARGTAVVLGNTPAGDKIQYCNGTSVYTVPVGSLTDTEIYTEHSHQTTVAKTSPSGYYCASGDVHGNVRIWDTTQTTHILKTTIPVFSGPVKDISWDSESKRIAAVGEGRERFGHVFLFDTGTSNGNLTGQARAMNSVDFKPSRPFRIISGSDDNTVAIFEGPPFKFKSTFGEHTKFVHSVRYNPDGSLFASTGGDGTIVLYNGVDGTKTGVFEDDSLKNVAHSGSVFGLTWSPDGTKIASASADKTIKIWNVATLK--VEKTIPVGTRIEDQQLGIIWTKQALVSISANG------FINFVNPELGSIDQVRYGHNKAITALSSSADGKTLFSADAEGHINSWDISTGISNRVFPDVHATMITGIKTTSKGDLFTVSWDDHLKVVPAGGSGVDSSKAVAN--KLSSQPLGLAVSADGDIAVAACYKHIAIYSHGK-LTEVPISYNSSCVALSNDKQFVAVGGQDSKVHVYKL-----SGASVSEVKTIVHPAEITSVAFSNNGAFLVATDQSRKVIPYSVANNFELA-------HTNSWTFHTAKVACVSWSPDNVRLATGSLDNSVIVWNMNKPSDHPIIIKGAHAMSSVNSVIWLNETTIVSAGQDSNIKFWNV 609          
BLAST of WD repeat-containing protein 1 vs. Ensembl Celegans
Match: unc-78 (Actin-interacting protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q11176])

HSP 1 Score: 425.246 bits (1092), Expect = 9.477e-141
Identity = 247/630 (39.21%), Postives = 371/630 (58.89%), Query Frame = 3
Query:   93 ELLQT--LATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQL-----EELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYV-FGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPY--EVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSI-ALSNNEVFSVGVDDRLVITDL------LSKTMKDDLKLTSQPRKVSV-VDSLVAV-ACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDF---MFSNNGSLLVCGDSDRKVSLFKVG-QFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANK-FIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKV 1910
            E  QT    +LPRT RG  +VLG+ P      Y NG SV    +  L D++IYT+HS + TVAK SPSG+Y ASGD++G +RIWDTTQ  HILK      SG + DISW S++ ++A  G+GRE+FG V   DTGT+ G ++G A+ +N++D K +RPFR+ + S+D  VA  EGPPFKFK+    H+ F + +RY+P+G +F S G D  I +++G  G +      + L N AH G ++ + ++ DG+ + SA  DK +K+W +   +  V + +  G+ ++D Q+G  W    ++S+S +G      F + +  E     +V  GH K ITALS S+    L S+D++G I +WDI  G +  +  +VH+  I  I   S  ++F+V  DD L +          SK + +  KL+SQP  ++V  D  +AV ACYK I + ++ + LT +P+SY  SC+ALS +K  + VGG++ K+ VYK+     S   +SE   +  P +     FSNNG+ LV  D  RKV  + V   F+         H   W FHT +V+CV+ + D+  +A+GSLD S+I+W++ +P++   IIK AH MS++ S++W +  T+ SAGQDSNIK W V
Sbjct:    3 EFSQTALFPSLPRTARGTAVVLGNTPAGDKIQYCNGTSVYTVPVGSLTDTEIYTEHSHQTTVAKTSPSGYYCASGDVHGNVRIWDTTQTTHILKTTIPVFSGPVKDISWDSESKRIAAVGEGRERFGHVFLFDTGTSNGNLTGQARAMNSVDFKPSRPFRIISGSDDNTVAIFEGPPFKFKSTFGEHTKFVHSVRYNPDGSLFASTGGDGTIVLYNGVDGTKTGVFEDDSLKNVAHSGSVFGLTWSPDGTKIASASADKTIKIWNVATLK--VEKTIPVGTRIEDQQLGIIWTKQALVSISANG------FINFVNPELGSIDQVRYGHNKAITALSSSADGKTLFSADAEGHINSWDISTGISNRVFPDVHATMITGIKTTSKGDLFTVSWDDHLKVVPAGGSGVDSSKAVAN--KLSSQPLGLAVSADGDIAVAACYKHIAIYSHGK-LTEVPISYNSSCVALSNDKQFVAVGGQDSKVHVYKL-----SGASVSEVKTIVHPAEITSVAFSNNGAFLVATDQSRKVIPYSVANNFELA-------HTNSWTFHTAKVACVSWSPDNVRLATGSLDNSVIVWNMNKPSDHPIIIKGAHAMSSVNSVIWLNETTIVSAGQDSNIKFWNV 609          
BLAST of WD repeat-containing protein 1 vs. Ensembl Celegans
Match: snrp-40.2 (Small Nuclear RibonucleoProtein homolog [Source:UniProtKB/TrEMBL;Acc:O02097])

HSP 1 Score: 69.707 bits (169), Expect = 1.554e-12
Identity = 53/188 (28.19%), Postives = 90/188 (47.87%), Query Frame = 3
Query:  669 RYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEP---RGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNEVF 1223
            ++S +G    SAG D +IF+++   GE         HKG I  + FN D SHL+SAG DK ++VW +      R F       ++VD  + G       + S S  G + +    D+   E   + I  +Q+  TA++F+   + ++    D +I  WD++     Y+    H + I S+++S+N  F
Sbjct:   43 QFSSDGSFLASAGYDQQIFLWN-VFGECENFAVLKGHKGAIMEVKFNADSSHLVSAGTDKTVRVWDMETGSCIRNFKSHTDIVNSVDVNRRG----PQMICSASDDGTVMVH---DMRSKEAAKKFICKYQQ--TAVTFNDAADNVICGGIDNQIKVWDMLRNDVRYVLSG-HRDTITSLSVSHNGNF 219          
BLAST of WD repeat-containing protein 1 vs. Ensembl Fly
Match: flr (gene:FBgn0260049 transcript:FBtr0075845)

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 287/603 (47.60%), Postives = 386/603 (64.01%), Query Frame = 3
Query:  111 ATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKDD-LKLTSQPRKVSVV--DSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKV 1910
            ATLPRT+RGQ IVLG+DPK KNFLYTNGNSVIIRNI++   +D+YT+HS    VAKYSPSGFYIASGD +GKIRIWDT  KEH+LK E+QPI+G I DISWS DN ++   G+GRE+FG V   +TGT+VGEISG +K IN+ D +  RPFR+ T SED  +A  EGPPFKFK   Q HS F   +RYSP+G  F SAG D K+F++DG + E + E G+PAHKGG+YA+A+  D + L++  GDK  ++W + E R  V E+V G+TVDD QV C W GD +I+VSLSG I+     D     KP  V+ GH KPIT L  S   + + +   DG +  W+  +G  + +    H NQI  IA   + V++ G+DD L    +   +  D  +KL  QPR ++++  ++++A+AC KE+ L  + + +  LP+ YE S +A++ + + + VGG++ K+ +Y +      L    E   L    D  +S +   LV  D+ RKV L+ V ++        P HN+ W FH+ RV+ VA + +S LVASGSLD +IIIWSV  PA   IIKNAHP S IT LVW D +T+ S GQD N K W V
Sbjct:   16 ATLPRTQRGQPIVLGADPKGKNFLYTNGNSVIIRNIENPAIADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKEHLLKNEFQPIAGPIKDISWSPDNQRIVAVGEGRERFGHVFMSETGTSVGEISGQSKSINSADFRPARPFRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEFGSPAHKGGVYALAWKPDSTQLLTCSGDKTCRLWTV-ESRELVSEFVMGTTVDDQQVSCLWQGDNLITVSLSGVITYLNVAD---PSKPLRVVKGHNKPITVLGLSDDRSTIYTGSHDGVVTNWNSGSGTNDRITGTGHGNQINGIAAWGDFVYTCGIDDSLRQFSVEGNSYTDYVVKLNCQPRGLAILRNENIIALACIKELTLVQDQKKIFSLPIKYEASSIAVNADTSDVAVGGDDQKLHIYTLKGGV--LEPKVELDHLGAVTDVSYSPDLKYLVACDAHRKVVLYSVEEYK-------PAHNKEWGFHSARVNTVAWSPNSLLVASGSLDTTIIIWSVANPAKHTIIKNAHPQSQITRLVWLDNNTVISTGQDCNTKVWHV 605          
BLAST of WD repeat-containing protein 1 vs. Ensembl Fly
Match: flr (gene:FBgn0260049 transcript:FBtr0075846)

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 287/603 (47.60%), Postives = 386/603 (64.01%), Query Frame = 3
Query:  111 ATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKDD-LKLTSQPRKVSVV--DSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKV 1910
            ATLPRT+RGQ IVLG+DPK KNFLYTNGNSVIIRNI++   +D+YT+HS    VAKYSPSGFYIASGD +GKIRIWDT  KEH+LK E+QPI+G I DISWS DN ++   G+GRE+FG V   +TGT+VGEISG +K IN+ D +  RPFR+ T SED  +A  EGPPFKFK   Q HS F   +RYSP+G  F SAG D K+F++DG + E + E G+PAHKGG+YA+A+  D + L++  GDK  ++W + E R  V E+V G+TVDD QV C W GD +I+VSLSG I+     D     KP  V+ GH KPIT L  S   + + +   DG +  W+  +G  + +    H NQI  IA   + V++ G+DD L    +   +  D  +KL  QPR ++++  ++++A+AC KE+ L  + + +  LP+ YE S +A++ + + + VGG++ K+ +Y +      L    E   L    D  +S +   LV  D+ RKV L+ V ++        P HN+ W FH+ RV+ VA + +S LVASGSLD +IIIWSV  PA   IIKNAHP S IT LVW D +T+ S GQD N K W V
Sbjct:   12 ATLPRTQRGQPIVLGADPKGKNFLYTNGNSVIIRNIENPAIADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKEHLLKNEFQPIAGPIKDISWSPDNQRIVAVGEGRERFGHVFMSETGTSVGEISGQSKSINSADFRPARPFRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEFGSPAHKGGVYALAWKPDSTQLLTCSGDKTCRLWTV-ESRELVSEFVMGTTVDDQQVSCLWQGDNLITVSLSGVITYLNVAD---PSKPLRVVKGHNKPITVLGLSDDRSTIYTGSHDGVVTNWNSGSGTNDRITGTGHGNQINGIAAWGDFVYTCGIDDSLRQFSVEGNSYTDYVVKLNCQPRGLAILRNENIIALACIKELTLVQDQKKIFSLPIKYEASSIAVNADTSDVAVGGDDQKLHIYTLKGGV--LEPKVELDHLGAVTDVSYSPDLKYLVACDAHRKVVLYSVEEYK-------PAHNKEWGFHSARVNTVAWSPNSLLVASGSLDTTIIIWSVANPAKHTIIKNAHPQSQITRLVWLDNNTVISTGQDCNTKVWHV 601          
BLAST of WD repeat-containing protein 1 vs. Ensembl Fly
Match: Poc1 (gene:FBgn0036354 transcript:FBtr0321318)

HSP 1 Score: 73.1738 bits (178), Expect = 2.011e-13
Identity = 64/297 (21.55%), Postives = 129/297 (43.43%), Query Frame = 3
Query:  243 YTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTW 1133
            +T HS   T  ++ P G  IA+   +  + +W+  Q    ++  +   S  +  ++WS     +A  G  R     +         GE    +K + ++D  ST    L T+S+D           +F ++    +N+    ++SPNG +  +A  D  + ++D  +GE +        +     +A++  G+ L  A G   +K++ ++  +      V  + V+D+    +  G  ++S S    I +    DL++G +P   + GH   + A++FS   +K  +  SD ++L W
Sbjct:   14 FTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIR--FASHSAPVNGVAWSPKGNLVASAGHDRTV--KIWEPKLRGVSGEFVAHSKAVRSVDFDSTGHLML-TASDDKSAKIWRVARRQFVSSFAQQNNWVRSAKFSPNGKLVATASDDKSVRIYDVDSGECVRTFTE--ERAAPRQLAWHPWGNMLAVALGCNRIKIFDVSGSQLLQLYVVHSAPVNDVAFHPS--GHFLLSGSDDRTIRIL---DLLEG-RPIYTLTGHTDAVNAVAFSRDGDKFATGGSDRQLLVW 297          
BLAST of WD repeat-containing protein 1 vs. Ensembl Fly
Match: Poc1 (gene:FBgn0036354 transcript:FBtr0075863)

HSP 1 Score: 72.0182 bits (175), Expect = 4.266e-13
Identity = 64/297 (21.55%), Postives = 129/297 (43.43%), Query Frame = 3
Query:  243 YTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTW 1133
            +T HS   T  ++ P G  IA+   +  + +W+  Q    ++  +   S  +  ++WS     +A  G  R     +         GE    +K + ++D  ST    L T+S+D           +F ++    +N+    ++SPNG +  +A  D  + ++D  +GE +        +     +A++  G+ L  A G   +K++ ++  +      V  + V+D+    +  G  ++S S    I +    DL++G +P   + GH   + A++FS   +K  +  SD ++L W
Sbjct:   14 FTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIR--FASHSAPVNGVAWSPKGNLVASAGHDRTV--KIWEPKLRGVSGEFVAHSKAVRSVDFDSTGHLML-TASDDKSAKIWRVARRQFVSSFAQQNNWVRSAKFSPNGKLVATASDDKSVRIYDVDSGECVRTFTE--ERAAPRQLAWHPWGNMLAVALGCNRIKIFDVSGSQLLQLYVVHSAPVNDVAFHPS--GHFLLSGSDDRTIRIL---DLLEG-RPIYTLTGHTDAVNAVAFSRDGDKFATGGSDRQLLVW 297          
BLAST of WD repeat-containing protein 1 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 69.3218 bits (168), Expect = 3.056e-12
Identity = 81/352 (23.01%), Postives = 143/352 (40.62%), Query Frame = 3
Query:  252 HSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGK---ICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWI-----GDTVISVSLSGNISLFKFDDLIKGEKPYEVILGH--QKPITALSFS-SGLNKLVSSDSDGKILTWDI--------INGKAE-YLCKNVH--SNQIQSIALSNNEVFSVGVDD 1241
            H+   +  K+SP+G ++AS   +  I+IW     +       + ISG    I D++WSSD+  L  G    +K   V  + TG ++  + G                                           HSN+  C  ++P  ++ VS   D  + ++D +TG+ L+ L  PAH   + A+ FN DGS ++S+  D + ++W     +         + +DD     +++     G  +++ +L   + L+   D  KG K  +   GH  +K     +FS +G   +VS   D  +  W++        + G  +  LC   H   N I S AL N++   +   D
Sbjct:   71 HTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKF-----EKTISGHKLGISDVAWSSDSRLLVSGSD--DKTLKVWELSTGKSLKTLKG-------------------------------------------HSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTL--PAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQ------CLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLW---DYSKG-KCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSD 360          

HSP 2 Score: 62.003 bits (149), Expect = 7.636e-10
Identity = 50/188 (26.60%), Postives = 88/188 (46.81%), Query Frame = 3
Query:  612 PPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFV---FDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFV-----GEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGK 1151
            P +  K     H+   + +++SPNG+   S+ AD  I +   +DGK  + +       HK GI  +A++ D   L+S   DK LKVW+++  +          YVF          C +   + + VS S + S+  +D  ++  K  + +  H  P++A+ F+   + +VSS  DG    WD  +G+
Sbjct:   60 PNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTIS-----GHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVF---------CCNFNPQSNLIVSGSFDESVRIWD--VRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQ 231          
BLAST of WD repeat-containing protein 1 vs. Ensembl Zebrafish
Match: WDR1 (WD repeat domain 1 [Source:HGNC Symbol;Acc:HGNC:12754])

HSP 1 Score: 348.206 bits (892), Expect = 9.772e-111
Identity = 216/631 (34.23%), Postives = 337/631 (53.41%), Query Frame = 3
Query:   84 LSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEEL-GNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAE-YLCKNVHSNQIQ-SIALSNNEVFSVGVDDRLV----------ITDLLSKTMKDDLKLTSQPRKVSVVDSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIA-----NDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVTV 1916
            +S EL +  A+LP  ERG   VLG DPK  NFLYTNG SVIIRNI++   +D+YT+H  +  VAKY PSGFYIASGD++GK+RIWDTTQKEH+LK EYQP  GKI DI+W+ D+ +LA+ G+GREKFGAV   DTG++VGEI G +K IN++D+K TRP+RL T S+D    FLEGPPFKFK       +   C+  S    ++ +      + +   +  E+   L G  AH GGIYA++++ D + LISA GD+ +K+W +      V  +  GS V D Q+GC W+   ++SVSLSG I+     D     +P   I GH K I  ++   + G   + S   DG I  WD  +G+ E ++ K VH   I  S+  ++        D+ L+          +   +   +   + ++  P  +S    +V V    +   A N +  T L ++   S ++ +P+   + V  ++ K+ +Y +      +D ++L +    T      D  +S +G+ L   D  + V++F V       S    +H         +V C++ + D+   A+  +D  + +W+      +  + + H + +++ L W + +TL +   D+ IKQW + +
Sbjct:    1 MSYELKRVFASLPHMERGVAKVLGGDPKGNNFLYTNGKSVIIRNIENPAIADVYTEHPHQVIVAKYCPSGFYIASGDVSGKVRIWDTTQKEHLLKYEYQPFGGKIKDIAWTEDSKRLAVVGEGREKFGAVFLWDTGSSVGEIVGHSKIINSVDIKQTRPYRLVTGSDDNCTTFLEGPPFKFKCTMTVSRHV--CVFVSKGSSLYSTFSTTEPMLLRRHQNTEKYSNLGGEKAHDGGIYAVSWSPDSTQLISASGDRTVKLWDVGSGTS-VSTFSLGSDVLDQQLGCLWVNKHLLSVSLSGYINYL---DRNNPNRPLRTIKGHTKSIQCVTVHKADGRTSIYSGSHDGHINYWDAESGENEAFVGKGVHKTVIHLSLKDAHMTAEENCFDNSLMRYVLLLLVVVVVVDVVAVVVHLICVSWGPGALSTTVLVVEVVVVGDHKRAQNKQ--TRLNLT---SMISGAPSGQCVCVCVQDGKVHLYSVQGNTLKDDGKALEVQGPVT------DMSYSKDGAFLAVTDEKKVVTVFTVADAYKEKSEFYGHH--------AKVVCLSWSPDNEHFATSGMDMMVYVWTASDTEKRIKLPDCHRLHHVSGLAWLNPNTLVTTSHDACIKQWTLKI 606          
BLAST of WD repeat-containing protein 1 vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 68.5514 bits (166), Expect = 5.448e-12
Identity = 60/245 (24.49%), Postives = 101/245 (41.22%), Query Frame = 3
Query:  252 HSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGK---ICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITE-------------PRGFV-----GEYVFGSTVDD 923
            H+   +  K+SPSG ++AS   +  I+IW     +       + ISG    I D++WSSD+  L       +K   + +V +G          KC+  L                                 + HSN+  C  ++P  ++ VS   D  + ++D KTG+ L+ L  PAH   + A+ FN DGS ++S+  D + ++W                 P  FV     G+Y+  +T+D+
Sbjct:   44 HTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKF-----EKTISGHKLGISDVAWSSDSNLLV--SASDDKTLKIWDVSSG----------KCLKTL---------------------------------KGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL--PAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDN 236          

HSP 2 Score: 62.003 bits (149), Expect = 6.929e-10
Identity = 50/189 (26.46%), Postives = 89/189 (47.09%), Query Frame = 3
Query:  612 PPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFV---FDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFV-----GEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKA 1154
            P +  K     H+   + +++SP+G+   S+ AD  I +   +DGK  + +       HK GI  +A++ D + L+SA  DK LK+W ++  +          YVF          C +   + + VS S + S+  +D  +K  K  + +  H  P++A+ F+   + +VSS  DG    WD  +G+ 
Sbjct:   33 PNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTIS-----GHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVF---------CCNFNPQSNLIVSGSFDESVRIWD--VKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQC 205          
BLAST of WD repeat-containing protein 1 vs. Ensembl Zebrafish
Match: apaf1 (apoptotic peptidase activating factor 1 [Source:NCBI gene;Acc:58131])

HSP 1 Score: 69.707 bits (169), Expect = 8.787e-12
Identity = 97/449 (21.60%), Postives = 177/449 (39.42%), Query Frame = 3
Query:  672 YSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRG-FVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKP--YEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIING-------------------KAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKDDLKLTSQPRKVSVVDSLVAVACYKEIMLANNTEPLTLLPVSYEPS--------------CLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWT-DAHTLFSAGQDSNIKQWK 1907
            +S +G    S GA   + VF   +GE+L EL   AH+  +   AF+ D  H+ +   DK +K+W +   RG  + E+             T  G  V+  + S +   F    L    K      + GH +P+    FS     L +S SDG +  +++ +                    KA   C    ++  Q I  + N VF   V+               DL L  +  ++S +      AC    +LA      T+   ++E S              C+  SP+ + L+   ++  I +++    + S  +      L    D +FS++ + ++  DS  ++ +       SG +      +E     + R+ C  I+ ++  VA GS D ++ +  +E P++K  +K +     +    +T D   L ++ +DS I+ WK
Sbjct:  625 FSKDGSKIASCGASKALRVFKSTSGEKLLEL--QAHEEDVLCCAFSPDDRHIATCASDKKVKLWNVE--RGVLIREFEVEHEEQINHCQFTNTGRRVLLATCSNDK--FTNTKLWNPNKKTSQNTMFGHMEPVNHCCFSPNDLYLATSSSDGSLKLFEVSSANEWKSIDVDSFFPESDEEIKAMVKCSTWSADGSQIICAARNTVFVFDVE-------------TSDLLLELKTSRLSTIQ--FCHACPNSSLLAVALSHYTVELWNFESSKKKAECSGHLSWVHCVQFSPDGSLLLSSSDDQTIRLWETDRVHTSSAV-----ALKRDTDVLFSHSDATIIAPDSSNRLQVL------SGSTGAVVLESEEL---SSRIRCSCISRNAAFVALGSEDGTVQV--IEVPSSKASVKLSGHTKTVHHCQFTDDCEILITSSEDSTIRVWK 1036          

HSP 2 Score: 56.6102 bits (135), Expect = 9.926e-8
Identity = 69/316 (21.84%), Postives = 130/316 (41.14%), Query Frame = 3
Query:  252 HSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWS-SDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGN--PAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYE--------VILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLC 1166
            H S     ++SP G  + S   +  IR+W+T +    +         +  D+ +S SD T +A     R +   V++  TG  V E   ++  I    +     F +A  SEDG V  +E P  K       H+   +  +++ + ++ +++  D+ I V+  +TGE +   G+  P  K   + +  +     L S   D  +KVW +T           G  + D+          V+S  +S +  LF      +  K +         ++ GH+  + +  FS    +L + D +G+I  W +++G    +C
Sbjct:  883 HLSWVHCVQFSPDGSLLLSSSDDQTIRLWETDR----VHTSSAVALKRDTDVLFSHSDATIIAPDSSNRLQ---VLSGSTGAVVLESEELSSRIRCSCISRNAAF-VALGSEDGTVQVIEVPSSKASVKLSGHTKTVHHCQFTDDCEILITSSEDSTIRVWKWRTGECMVLQGHMEPVRK---FHLLSSSSSPRLFSWSFDGTVKVWDLTR----------GQMLQDLVCH----EGAVLSCDVSSDGRLFATTSANRTAKVWSSASWKMIFLLEGHKDCVRSCRFSWDNKRLATGDDNGEIRLWSMLDGALLKIC 1173          
BLAST of WD repeat-containing protein 1 vs. Ensembl Zebrafish
Match: poc1b (POC1 centriolar protein B [Source:NCBI gene;Acc:386932])

HSP 1 Score: 68.1662 bits (165), Expect = 1.671e-11
Identity = 78/353 (22.10%), Postives = 142/353 (40.23%), Query Frame = 3
Query:   96 LLQTLATLPRTERGQFIVLGS---DPKNKNFLYTNGN-SVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWI---GDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTW 1133
            L+Q   TL R  +G   V+     +P NK     + + S++I N+     +  +  H+   T   ++PSG  +AS   +  +R+W  + K       ++  +  +  + +S D       GQ                                      RL T+S+D  V        KF  +   H+N+  C R+SP+G +  S G D  + ++D  + + +    +  + G    + FN  G+ + S+G D  +K+W I   +  +  Y     V +  V C      G+ +IS S    I +    DL++G   Y  + GH+ P+  ++FS   +   S  +D ++L W
Sbjct:    3 LIQEDPTLERHFKGHKDVISCADFNPNNKQLATGSCDKSLMIWNLAPKARAFRFVGHTDVITGVNFAPSGSLVASSSRDQTVRLWTPSIKGE--STVFKAHTASVRSVHFSRD-------GQ--------------------------------------RLVTASDDKSVKVWGVERKKFLYSLNRHTNWVRCARFSPDGRLIASCGDDRTVRLWDTSSHQCINIFTD--YGGSATFVDFNSSGTCIASSGADNTIKIWDIRTNK-LIQHY----KVHNAGVNCFSFHPSGNYLISGSSDSTIKIL---DLLEGRLIY-TLHGHKGPVLTVTFSRDGDLFASGGADSQVLMW 297          
BLAST of WD repeat-containing protein 1 vs. Ensembl Zebrafish
Match: poc1b (POC1 centriolar protein B [Source:NCBI gene;Acc:386932])

HSP 1 Score: 67.3958 bits (163), Expect = 3.079e-11
Identity = 51/193 (26.42%), Postives = 90/193 (46.63%), Query Frame = 3
Query:  564 RLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWI---GDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTW 1133
            RL T+S+D  V        KF  +   H+N+  C R+SP+G +  S G D  + ++D  + + +    +  + G    + FN  G+ + S+G D  +K+W I   +  +  Y     V +  V C      G+ +IS S    I +    DL++G   Y  + GH+ P+  ++FS   +   S  +D ++L W
Sbjct:  116 RLVTASDDKSVKVWGVERKKFLYSLNRHTNWVRCARFSPDGRLIASCGDDRTVRLWDTSSHQCINIFTD--YGGSATFVDFNSSGTCIASSGADNTIKIWDIRTNK-LIQHY----KVHNAGVNCFSFHPSGNYLISGSSDSTIKIL---DLLEGRLIY-TLHGHKGPVLTVTFSRDGDLFASGGADSQVLMW 297          

HSP 2 Score: 53.5286 bits (127), Expect = 6.607e-7
Identity = 63/292 (21.58%), Postives = 114/292 (39.04%), Query Frame = 3
Query:  114 TLPRTERGQFIVLGS---DPKNKNFLYTNGN-SVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIW-------DTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTG-------TNVGEI--------------SGMAKCINNL-DLKSTRPFR--------LATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQ 866
            TL R  +G   V+     +P NK     + + S++I N+     +  +  H+   T   ++PSG  +AS   +  +R+W        T  K H         S     +  +SD+  + + G  R+KF   +N  T        +  G +              +   +CIN   D   +  F         +A+S  D  +   +    K   +++ H+   NC  + P+G+  +S  +D+ I + D   G  +  L    HKG +  + F+ DG    S G D  + +W+
Sbjct:    9 TLERHFKGHKDVISCADFNPNNKQLATGSCDKSLMIWNLAPKARAFRFVGHTDVITGVNFAPSGSLVASSSRDQTVRLWTPSIKGESTVFKAHTASVRSVHFSRDGQRLVTASDDKSVKVWGVERKKFLYSLNRHTNWVRCARFSPDGRLIASCGDDRTVRLWDTSSHQCINIFTDYGGSATFVDFNSSGTCIASSGADNTIKIWDIRTNKLIQHYKVHNAGVNCFSFHPSGNYLISGSSDSTIKILDLLEGRLIYTLH--GHKGPVLTVTFSRDGDLFASGGADSQVLMWK 298          
BLAST of WD repeat-containing protein 1 vs. Ensembl Xenopus
Match: wdr1 (WD repeat domain 1 [Source:NCBI gene;Acc:448473])

HSP 1 Score: 456.062 bits (1172), Expect = 2.752e-152
Identity = 250/625 (40.00%), Postives = 372/625 (59.52%), Query Frame = 3
Query:   84 LSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEEL-GNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIAL-SNNEVFSVGVDDRLVITDLLSK--TMKDDLKLTSQPRKVSV-VDSLVAVACYKEI-MLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIA-----NDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVTVK 1919
            +  EL +  A+LP+ ERG   ++  DPK  NFLYTNG SVIIRNI++   +DIYT+H+    VA+Y+PSGFYIASGD +GK+RIWDTTQKEH+LK EYQP +GKI DI+W+ D+ ++A+ G+GREKFG+V   DTG++VGEISG  K IN++D+K TRP+RL T S+D   AF EGPPFKFK     HS F NC+R+SP+G    SAGAD +IF++DGKTGE++  L G+ AH GGIYA++++ D + L+SA GDK  K+W +      V  +  G+ V D Q+GC W  D ++SVSLSG I+     D     +P  VI GH K I  ++   S G + + +   DG I    +  G+ +      H+NQ+  + L S+N++ +  +DD +  T L SK  +  + +K+  QP+ V+V     V   C  +I +L +  +   +  + YEP  +A+     T+ VGG +  + +Y I      ++ +SL +    T      D  +S++G+ L   D+++ V++F V     G S    Y+  H      +   VA + D+   AS  +D  + +W++  P  +  I +AH + +++SL W D HTL +   D+ +KQW VT K
Sbjct:    3 MPYELKKVFASLPQVERGVAKIITGDPKGNNFLYTNGKSVIIRNIENPAIADIYTEHAHPVVVARYAPSGFYIASGDTSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGSVFLWDTGSSVGEISGNIKVINSVDIKQTRPYRLVTGSDDNCCAFFEGPPFKFKFTMADHSRFVNCVRFSPDGSRLASAGADGQIFLYDGKTGEKVGNLGGSKAHDGGIYAVSWSADSTQLLSASGDKTAKIWDVAANSA-VTTFHLGTEVLDQQLGCLWQKDYLLSVSLSGYINYL---DKNNPSRPLRVIKGHNKSIQCMTVHNSDGRSTIYTGSHDGHINILFLATGENDTFTGKGHTNQVSRMDLDSSNQLITCSMDDTVRYTSLTSKDYSSSESVKMDVQPKCVAVGSGGYVVTLCIGQIVLLKDKKKVFAIDSLDYEPEAVAIHKGSGTVAVGGVDGNVHLYSIQGNSLKDEGKSLPVKGAVT------DLAYSHDGAFLAVTDANKVVTVFNVAD---GYSEQNVYYGHH-----AKAVSVAWSPDNEHFASSGMDMMVYVWTLSDPDARIKIPDAHRLHHVSSLAWLDEHTLATVSHDACVKQWTVTFK 609          
BLAST of WD repeat-containing protein 1 vs. Ensembl Xenopus
Match: wdr1 (WD repeat domain 1 [Source:NCBI gene;Acc:448473])

HSP 1 Score: 452.981 bits (1164), Expect = 3.494e-151
Identity = 248/621 (39.94%), Postives = 370/621 (59.58%), Query Frame = 3
Query:   96 LLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEEL-GNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIAL-SNNEVFSVGVDDRLVITDLLSK--TMKDDLKLTSQPRKVSV-VDSLVAVACYKEI-MLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIA-----NDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVTVK 1919
            + +  A+LP+ ERG   ++  DPK  NFLYTNG SVIIRNI++   +DIYT+H+    VA+Y+PSGFYIASGD +GK+RIWDTTQKEH+LK EYQP +GKI DI+W+ D+ ++A+ G+GREKFG+V   DTG++VGEISG  K IN++D+K TRP+RL T S+D   AF EGPPFKFK     HS F NC+R+SP+G    SAGAD +IF++DGKTGE++  L G+ AH GGIYA++++ D + L+SA GDK  K+W +      V  +  G+ V D Q+GC W  D ++SVSLSG I+     D     +P  VI GH K I  ++   S G + + +   DG I    +  G+ +      H+NQ+  + L S+N++ +  +DD +  T L SK  +  + +K+  QP+ V+V     V   C  +I +L +  +   +  + YEP  +A+     T+ VGG +  + +Y I      ++ +SL +    T      D  +S++G+ L   D+++ V++F V     G S    Y+  H      +   VA + D+   AS  +D  + +W++  P  +  I +AH + +++SL W D HTL +   D+ +KQW VT K
Sbjct:    1 MSKVFASLPQVERGVAKIITGDPKGNNFLYTNGKSVIIRNIENPAIADIYTEHAHPVVVARYAPSGFYIASGDTSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGSVFLWDTGSSVGEISGNIKVINSVDIKQTRPYRLVTGSDDNCCAFFEGPPFKFKFTMADHSRFVNCVRFSPDGSRLASAGADGQIFLYDGKTGEKVGNLGGSKAHDGGIYAVSWSADSTQLLSASGDKTAKIWDVAANSA-VTTFHLGTEVLDQQLGCLWQKDYLLSVSLSGYINYL---DKNNPSRPLRVIKGHNKSIQCMTVHNSDGRSTIYTGSHDGHINILFLATGENDTFTGKGHTNQVSRMDLDSSNQLITCSMDDTVRYTSLTSKDYSSSESVKMDVQPKCVAVGSGGYVVTLCIGQIVLLKDKKKVFAIDSLDYEPEAVAIHKGSGTVAVGGVDGNVHLYSIQGNSLKDEGKSLPVKGAVT------DLAYSHDGAFLAVTDANKVVTVFNVAD---GYSEQNVYYGHH-----AKAVSVAWSPDNEHFASSGMDMMVYVWTLSDPDARIKIPDAHRLHHVSSLAWLDEHTLATVSHDACVKQWTVTFK 603          
BLAST of WD repeat-containing protein 1 vs. Ensembl Xenopus
Match: wdr1 (WD repeat domain 1 [Source:NCBI gene;Acc:448473])

HSP 1 Score: 452.21 bits (1162), Expect = 6.942e-151
Identity = 248/619 (40.06%), Postives = 369/619 (59.61%), Query Frame = 3
Query:  102 QTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEEL-GNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIAL-SNNEVFSVGVDDRLVITDLLSK--TMKDDLKLTSQPRKVSV-VDSLVAVACYKEI-MLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIA-----NDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVTVK 1919
            +  A+LP+ ERG   ++  DPK  NFLYTNG SVIIRNI++   +DIYT+H+    VA+Y+PSGFYIASGD +GK+RIWDTTQKEH+LK EYQP +GKI DI+W+ D+ ++A+ G+GREKFG+V   DTG++VGEISG  K IN++D+K TRP+RL T S+D   AF EGPPFKFK     HS F NC+R+SP+G    SAGAD +IF++DGKTGE++  L G+ AH GGIYA++++ D + L+SA GDK  K+W +      V  +  G+ V D Q+GC W  D ++SVSLSG I+     D     +P  VI GH K I  ++   S G + + +   DG I    +  G+ +      H+NQ+  + L S+N++ +  +DD +  T L SK  +  + +K+  QP+ V+V     V   C  +I +L +  +   +  + YEP  +A+     T+ VGG +  + +Y I      ++ +SL +    T      D  +S++G+ L   D+++ V++F V     G S    Y+  H      +   VA + D+   AS  +D  + +W++  P  +  I +AH + +++SL W D HTL +   D+ +KQW VT K
Sbjct:    7 KVFASLPQVERGVAKIITGDPKGNNFLYTNGKSVIIRNIENPAIADIYTEHAHPVVVARYAPSGFYIASGDTSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGSVFLWDTGSSVGEISGNIKVINSVDIKQTRPYRLVTGSDDNCCAFFEGPPFKFKFTMADHSRFVNCVRFSPDGSRLASAGADGQIFLYDGKTGEKVGNLGGSKAHDGGIYAVSWSADSTQLLSASGDKTAKIWDVAANSA-VTTFHLGTEVLDQQLGCLWQKDYLLSVSLSGYINYL---DKNNPSRPLRVIKGHNKSIQCMTVHNSDGRSTIYTGSHDGHINILFLATGENDTFTGKGHTNQVSRMDLDSSNQLITCSMDDTVRYTSLTSKDYSSSESVKMDVQPKCVAVGSGGYVVTLCIGQIVLLKDKKKVFAIDSLDYEPEAVAIHKGSGTVAVGGVDGNVHLYSIQGNSLKDEGKSLPVKGAVT------DLAYSHDGAFLAVTDANKVVTVFNVAD---GYSEQNVYYGHH-----AKAVSVAWSPDNEHFASSGMDMMVYVWTLSDPDARIKIPDAHRLHHVSSLAWLDEHTLATVSHDACVKQWTVTFK 607          
BLAST of WD repeat-containing protein 1 vs. Ensembl Xenopus
Match: wdr1 (WD repeat domain 1 [Source:NCBI gene;Acc:448473])

HSP 1 Score: 412.92 bits (1060), Expect = 1.004e-135
Identity = 233/618 (37.70%), Postives = 354/618 (57.28%), Query Frame = 3
Query:  102 QTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIAL-SNNEVFSVGVDDRLVITDLLSK--TMKDDLKLTSQPRKVSV-VDSLVAVACYKEI-MLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIA-----NDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVTVK 1919
            +  A+LP+ ERG   ++  DPK  NFLYTNG SVIIRNI++   +DIYT+H+    VA+Y+PSGFYIASGD +GK+RIWDTTQKEH+LK EYQP +GKI DI+W+ D+ ++A+ G+GREKFG+V   DTG++VGEISG  K IN++D+K TRP+RL T S+D   AF EGPPFKFK     HS F NC+R+SP+G    SAGAD ++F F  +   ++           +  ++++ D + L+SA GDK  K+W +      V  +  G+ V D Q+GC W  D ++SVSLSG I+     D     +P  VI GH K I  ++   S G + + +   DG I    +  G+ +      H+NQ+  + L S+N++ +  +DD +  T L SK  +  + +K+  QP+ V+V     V   C  +I +L +  +   +  + YEP  +A+     T+ VGG +  + +Y I      ++ +SL +    T      D  +S++G+ L   D+++ V++F V     G S    Y+  H      +   VA + D+   AS  +D  + +W++  P  +  I +AH + +++SL W D HTL +   D+ +KQW VT K
Sbjct:    7 KVFASLPQVERGVAKIITGDPKGNNFLYTNGKSVIIRNIENPAIADIYTEHAHPVVVARYAPSGFYIASGDTSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGSVFLWDTGSSVGEISGNIKVINSVDIKQTRPYRLVTGSDDNCCAFFEGPPFKFKFTMADHSRFVNCVRFSPDGSRLASAGADGQVFFFFSRYSCKIVLTCAVF----VLQVSWSADSTQLLSASGDKTAKIWDVAANSA-VTTFHLGTEVLDQQLGCLWQKDYLLSVSLSGYINYL---DKNNPSRPLRVIKGHNKSIQCMTVHNSDGRSTIYTGSHDGHINILFLATGENDTFTGKGHTNQVSRMDLDSSNQLITCSMDDTVRYTSLTSKDYSSSESVKMDVQPKCVAVGSGGYVVTLCIGQIVLLKDKKKVFAIDSLDYEPEAVAIHKGSGTVAVGGVDGNVHLYSIQGNSLKDEGKSLPVKGAVT------DLAYSHDGAFLAVTDANKVVTVFNVAD---GYSEQNVYYGHH-----AKAVSVAWSPDNEHFASSGMDMMVYVWTLSDPDARIKIPDAHRLHHVSSLAWLDEHTLATVSHDACVKQWTVTFK 602          
BLAST of WD repeat-containing protein 1 vs. Ensembl Xenopus
Match: ngfr (nerve growth factor receptor [Source:Xenbase;Acc:XB-GENE-977685])

HSP 1 Score: 72.4034 bits (176), Expect = 5.720e-13
Identity = 65/295 (22.03%), Postives = 128/295 (43.39%), Query Frame = 3
Query:  252 HSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEI-SGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTW 1133
            H    T   +SP G  +AS   +  + IW+   +    K  Y      +  + +S     +A   + R       N+   ++V +  + + +C+N     S+      T+S+D  +        +F  +   H+N+  C R+SP+G +  S   D  + ++D      +    +  +KG    + FN  G+ + SAG D  +KVW I   +      V  + V+ +    +  G+ +++ S  G + +    DL++G   Y  + GHQ P+ +++FS   ++  S  +D ++L W
Sbjct:   17 HKDAVTYVDFSPDGKQLASSSADACVMIWNFKPQSRAYK--YPGHKEAVTCVQFSPSGHLVASSSKDRTVRLWAPNIKGESSVLKAHTAVVRCVNF----SSDGHTFITASDDKSIKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRLIASCSDDKTVRIWDITNRLCINTFVD--YKGHSNYVDFNPMGTCVASAGVDSTVKVWDIRTNKLLQHYQVHNAGVNSLSFHPS--GNYLLTASNDGTVKIL---DLLEGRLIY-TLHGHQGPVLSVAFSKSGDQFASGATDAQVLVW 297          

HSP 2 Score: 55.0694 bits (131), Expect = 2.547e-7
Identity = 61/254 (24.02%), Postives = 111/254 (43.70%), Query Frame = 3
Query:  567 LATSSEDGVVAFLEGPPFKFKTN-HQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEP---RGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNN-EVFSVGVDDRLVI---TDLLSKTMKDDLKLTSQ 1304
            +A+SS+D  V  L  P  K +++  + H+    C+ +S +G  F++A  D  I  ++      L  L    H   +    F+ DG  + S   DK +++W IT       FV +Y   S   D       +G  V S  +   + ++     I+  K  +    H   + +LSF    N L+++ +DG +   D++ G+  Y     H   + S+A S + + F+ G  D  V+   T+     +K+ +KL  +
Sbjct:   75 VASSSKDRTVR-LWAPNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKSIKAWNLHRQRFLYSLTE--HTNWVRCARFSPDGRLIASCSDDKTVRIWDITNRLCINTFV-DYKGHSNYVDFNP----MGTCVASAGVDSTVKVWD----IRTNKLLQHYQVHNAGVNSLSFHPSGNYLLTASNDGTVKILDLLEGRLIYTLHG-HQGPVLSVAFSKSGDQFASGATDAQVLVWKTNFDKYNIKEIVKLQQK 315          
BLAST of WD repeat-containing protein 1 vs. Ensembl Mouse
Match: Wdr1 (WD repeat domain 1 [Source:MGI Symbol;Acc:MGI:1337100])

HSP 1 Score: 473.011 bits (1216), Expect = 3.692e-159
Identity = 257/624 (41.19%), Postives = 382/624 (61.22%), Query Frame = 3
Query:   84 LSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELG-NPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNE-VFSVGVDDRLVITDLLSKTMKDD-----LKLTSQPRKVSV-VDSLVAVACYKEI-MLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTP---RDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVT 1913
            +  E+ +  A+LP+ ERG   +LG DPK  +FLYTNG  VI+RNID+   +DIYT+H+ +  VAKY+PSGFYIASGD++GK+RIWDTTQKEH+LK EYQP +GKI DI+W+ D+ ++A+ G+GREKFGAV   DTG++VGEI+G  K IN++D+K TRP+RLAT S+D   AF EGPPFKFK     HS F NC+R+SP+G+ F +A AD +IF++DGKTGE++  LG + AH GGIYAI+++ D +HL+SA GDK  K+W +      V  +  GS V D Q+GC W  D ++S+SLSG I+     D     KP  VI GH K I  L+   + G + + S   DG I  WD   G+ +      H+NQ+  + ++ +E + S  +DD +  T+L   T++D      +KL  QP+ V+V       V C  +I +L +  +  ++    YEP  +A+ P   T+ VGG +  + VY I     + TL  E  LL       D  +S++G+ L   D+ + V++F V    S +++   +H         ++ C+A + D+   ASG +D  + +W++  P  K  I++AH + +++SL W D HTL +   D+++K+W +T
Sbjct:    1 MPYEIKKVFASLPQVERGVSKILGGDPKGDHFLYTNGKCVILRNIDNPAIADIYTEHAHQVVVAKYAPSGFYIASGDISGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDTGSSVGEITGHNKVINSVDIKQTRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIFIYDGKTGEKVCALGESKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVN-VNSVVSTFPMGSNVLDQQLGCLWQKDHLLSISLSGYINYL---DKNNPSKPLRVIKGHSKSIQCLTVHRNGGKSYIYSGSHDGHINYWDSETGENDSFSGKGHTNQVSRMTVNESEQLVSCSMDDTVRYTNL---TLRDYSGQGVVKLDVQPKCVAVGPGGYTVVVCIGQIVLLKDQKKCFSIDNPGYEPEVVAVHPGGDTVAVGGTDGNVRVYSIL----ASTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHH--------AKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETKVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTIT 605          
BLAST of WD repeat-containing protein 1 vs. Ensembl Mouse
Match: Wdr1 (WD repeat domain 1 [Source:MGI Symbol;Acc:MGI:1337100])

HSP 1 Score: 153.295 bits (386), Expect = 7.269e-41
Identity = 105/350 (30.00%), Postives = 177/350 (50.57%), Query Frame = 3
Query:  903 FGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNE-VFSVGVDDRLVITDLLSKTMKDD-----LKLTSQPRKVSV-VDSLVAVACYKEI-MLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTP---RDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVT 1913
             GS V D Q+GC W  D ++S+SLSG I+     D     KP  VI GH K I  L+   + G + + S   DG I  WD   G+ +      H+NQ+  + ++ +E + S  +DD +  T+L   T++D      +KL  QP+ V+V       V C  +I +L +  +  ++    YEP  +A+ P   T+ VGG +  + VY I     + TL  E  LL       D  +S++G+ L   D+ + V++F V    S +++   +H         ++ C+A + D+   ASG +D  + +W++  P  K  I++AH + +++SL W D HTL +   D+++K+W +T
Sbjct:    1 MGSNVLDQQLGCLWQKDHLLSISLSGYINYL---DKNNPSKPLRVIKGHSKSIQCLTVHRNGGKSYIYSGSHDGHINYWDSETGENDSFSGKGHTNQVSRMTVNESEQLVSCSMDDTVRYTNL---TLRDYSGQGVVKLDVQPKCVAVGPGGYTVVVCIGQIVLLKDQKKCFSIDNPGYEPEVVAVHPGGDTVAVGGTDGNVRVYSIL----ASTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHH--------AKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETKVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTIT 332          
BLAST of WD repeat-containing protein 1 vs. Ensembl Mouse
Match: Poc1b (POC1 centriolar protein B [Source:MGI Symbol;Acc:MGI:1918511])

HSP 1 Score: 75.8702 bits (185), Expect = 2.631e-14
Identity = 66/297 (22.22%), Postives = 126/297 (42.42%), Query Frame = 3
Query:  243 YTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTW 1133
            +  H +  T A +SP+   IA+   +  + +W  + K H     Y      +  + +S     LA     R++   +  +D      E       + ++D  +     L T+SED  +        +F  +   H+++  C ++SP+G + VS   D  I ++D    + +    +    G    + FN +G+ + SAG D  +K+W I   +      V    V+ +      +G+++++ S  G + +    DLI+G   Y  + GH  P+  +SFS     L S  +D ++L W
Sbjct:   14 FKGHKAAITSADFSPNCKQIATASWDTFLMLW--SLKPHARAYRYVGHKDVVTSLQFSPQGNLLA--SASRDRTVRLWVLDRKGKSSEFKAHTAPVRSVDFSADGQL-LVTASEDKSIKVWSMFRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSV--GFANFVDFNPNGTCIASAGSDHAVKIWDIRMNKLLQHYQVHSCGVNCLSFHP--LGNSLVTASSDGTVKML---DLIEGRLIY-TLQGHTGPVFTVSFSKDGELLTSGGADAQVLIW 297          

HSP 2 Score: 56.6102 bits (135), Expect = 4.362e-8
Identity = 56/246 (22.76%), Postives = 94/246 (38.21%), Query Frame = 3
Query:  135 GQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYT--QHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQ 866
            GQ +V  S+ K+            I+     R   +Y+  +H+     AK+SP G  I S   +  I+IWDTT K+ +                   +N   ++G                 N  + +    CI             A++  D  V   +    K   ++Q HS   NCL + P G+  V+A +D  + + D   G  +  L    H G ++ ++F+ DG  L S G D  + +W+
Sbjct:  114 GQLLVTASEDKS------------IKVWSMFRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCV-------------------NNFSDSVGF---------------ANFVDFNPNGTCI-------------ASAGSDHAVKIWDIRMNKLLQHYQVHSCGVNCLSFHPLGNSLVTASSDGTVKMLDLIEGRLIYTL--QGHTGPVFTVSFSKDGELLTSGGADAQVLIWR 298          
BLAST of WD repeat-containing protein 1 vs. Ensembl Mouse
Match: Poc1b (POC1 centriolar protein B [Source:MGI Symbol;Acc:MGI:1918511])

HSP 1 Score: 75.8702 bits (185), Expect = 5.878e-14
Identity = 66/294 (22.45%), Postives = 125/294 (42.52%), Query Frame = 3
Query:  252 HSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTW 1133
            H +  T A +SP+   IA+   +  + +W  + K H     Y      +  + +S     LA     R++   +  +D      E       + ++D  +     L T+SED  +        +F  +   H+++  C ++SP+G + VS   D  I ++D    + +    +    G    + FN +G+ + SAG D  +K+W I   +      V    V+ +      +G+++++ S  G + +    DLI+G   Y  + GH  P+  +SFS     L S  +D ++L W
Sbjct:   17 HKAAITSADFSPNCKQIATASWDTFLMLW--SLKPHARAYRYVGHKDVVTSLQFSPQGNLLA--SASRDRTVRLWVLDRKGKSSEFKAHTAPVRSVDFSADGQL-LVTASEDKSIKVWSMFRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSV--GFANFVDFNPNGTCIASAGSDHAVKIWDIRMNKLLQHYQVHSCGVNCLSFHP--LGNSLVTASSDGTVKML---DLIEGRLIY-TLQGHTGPVFTVSFSKDGELLTSGGADAQVLIW 297          

HSP 2 Score: 57.3806 bits (137), Expect = 3.874e-8
Identity = 56/246 (22.76%), Postives = 94/246 (38.21%), Query Frame = 3
Query:  135 GQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYT--QHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQ 866
            GQ +V  S+ K+            I+     R   +Y+  +H+     AK+SP G  I S   +  I+IWDTT K+ +                   +N   ++G                 N  + +    CI             A++  D  V   +    K   ++Q HS   NCL + P G+  V+A +D  + + D   G  +  L    H G ++ ++F+ DG  L S G D  + +W+
Sbjct:  114 GQLLVTASEDKS------------IKVWSMFRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCV-------------------NNFSDSVGF---------------ANFVDFNPNGTCI-------------ASAGSDHAVKIWDIRMNKLLQHYQVHSCGVNCLSFHPLGNSLVTASSDGTVKMLDLIEGRLIYTLQ--GHTGPVFTVSFSKDGELLTSGGADAQVLIWR 298          
BLAST of WD repeat-containing protein 1 vs. Ensembl Mouse
Match: Poc1b (POC1 centriolar protein B [Source:MGI Symbol;Acc:MGI:1918511])

HSP 1 Score: 75.8702 bits (185), Expect = 6.186e-14
Identity = 66/294 (22.45%), Postives = 125/294 (42.52%), Query Frame = 3
Query:  252 HSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTW 1133
            H +  T A +SP+   IA+   +  + +W  + K H     Y      +  + +S     LA     R++   +  +D      E       + ++D  +     L T+SED  +        +F  +   H+++  C ++SP+G + VS   D  I ++D    + +    +    G    + FN +G+ + SAG D  +K+W I   +      V    V+ +      +G+++++ S  G + +    DLI+G   Y  + GH  P+  +SFS     L S  +D ++L W
Sbjct:   17 HKAAITSADFSPNCKQIATASWDTFLMLW--SLKPHARAYRYVGHKDVVTSLQFSPQGNLLA--SASRDRTVRLWVLDRKGKSSEFKAHTAPVRSVDFSADGQL-LVTASEDKSIKVWSMFRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSV--GFANFVDFNPNGTCIASAGSDHAVKIWDIRMNKLLQHYQVHSCGVNCLSFHP--LGNSLVTASSDGTVKML---DLIEGRLIY-TLQGHTGPVFTVSFSKDGELLTSGGADAQVLIW 297          

HSP 2 Score: 56.9954 bits (136), Expect = 4.523e-8
Identity = 56/246 (22.76%), Postives = 94/246 (38.21%), Query Frame = 3
Query:  135 GQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYT--QHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQ 866
            GQ +V  S+ K+            I+     R   +Y+  +H+     AK+SP G  I S   +  I+IWDTT K+ +                   +N   ++G                 N  + +    CI             A++  D  V   +    K   ++Q HS   NCL + P G+  V+A +D  + + D   G  +  L    H G ++ ++F+ DG  L S G D  + +W+
Sbjct:  114 GQLLVTASEDKS------------IKVWSMFRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCV-------------------NNFSDSVGF---------------ANFVDFNPNGTCI-------------ASAGSDHAVKIWDIRMNKLLQHYQVHSCGVNCLSFHPLGNSLVTASSDGTVKMLDLIEGRLIYTLQ--GHTGPVFTVSFSKDGELLTSGGADAQVLIWR 298          
BLAST of WD repeat-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9VU68|WDR1_DROME (Actin-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=flr PE=2 SV=1)

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 287/603 (47.60%), Postives = 386/603 (64.01%), Query Frame = 3
Query:  111 ATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKDD-LKLTSQPRKVSVV--DSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKV 1910
            ATLPRT+RGQ IVLG+DPK KNFLYTNGNSVIIRNI++   +D+YT+HS    VAKYSPSGFYIASGD +GKIRIWDT  KEH+LK E+QPI+G I DISWS DN ++   G+GRE+FG V   +TGT+VGEISG +K IN+ D +  RPFR+ T SED  +A  EGPPFKFK   Q HS F   +RYSP+G  F SAG D K+F++DG + E + E G+PAHKGG+YA+A+  D + L++  GDK  ++W + E R  V E+V G+TVDD QV C W GD +I+VSLSG I+     D     KP  V+ GH KPIT L  S   + + +   DG +  W+  +G  + +    H NQI  IA   + V++ G+DD L    +   +  D  +KL  QPR ++++  ++++A+AC KE+ L  + + +  LP+ YE S +A++ + + + VGG++ K+ +Y +      L    E   L    D  +S +   LV  D+ RKV L+ V ++        P HN+ W FH+ RV+ VA + +S LVASGSLD +IIIWSV  PA   IIKNAHP S IT LVW D +T+ S GQD N K W V
Sbjct:   16 ATLPRTQRGQPIVLGADPKGKNFLYTNGNSVIIRNIENPAIADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKEHLLKNEFQPIAGPIKDISWSPDNQRIVAVGEGRERFGHVFMSETGTSVGEISGQSKSINSADFRPARPFRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEFGSPAHKGGVYALAWKPDSTQLLTCSGDKTCRLWTV-ESRELVSEFVMGTTVDDQQVSCLWQGDNLITVSLSGVITYLNVAD---PSKPLRVVKGHNKPITVLGLSDDRSTIYTGSHDGVVTNWNSGSGTNDRITGTGHGNQINGIAAWGDFVYTCGIDDSLRQFSVEGNSYTDYVVKLNCQPRGLAILRNENIIALACIKELTLVQDQKKIFSLPIKYEASSIAVNADTSDVAVGGDDQKLHIYTLKGGV--LEPKVELDHLGAVTDVSYSPDLKYLVACDAHRKVVLYSVEEYK-------PAHNKEWGFHSARVNTVAWSPNSLLVASGSLDTTIIIWSVANPAKHTIIKNAHPQSQITRLVWLDNNTVISTGQDCNTKVWHV 605          
BLAST of WD repeat-containing protein 1 vs. UniProt/SwissProt
Match: sp|O88342|WDR1_MOUSE (WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Wdr1 PE=1 SV=3)

HSP 1 Score: 473.011 bits (1216), Expect = 2.582e-158
Identity = 257/624 (41.19%), Postives = 382/624 (61.22%), Query Frame = 3
Query:   84 LSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELG-NPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNE-VFSVGVDDRLVITDLLSKTMKDD-----LKLTSQPRKVSV-VDSLVAVACYKEI-MLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTP---RDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVT 1913
            +  E+ +  A+LP+ ERG   +LG DPK  +FLYTNG  VI+RNID+   +DIYT+H+ +  VAKY+PSGFYIASGD++GK+RIWDTTQKEH+LK EYQP +GKI DI+W+ D+ ++A+ G+GREKFGAV   DTG++VGEI+G  K IN++D+K TRP+RLAT S+D   AF EGPPFKFK     HS F NC+R+SP+G+ F +A AD +IF++DGKTGE++  LG + AH GGIYAI+++ D +HL+SA GDK  K+W +      V  +  GS V D Q+GC W  D ++S+SLSG I+     D     KP  VI GH K I  L+   + G + + S   DG I  WD   G+ +      H+NQ+  + ++ +E + S  +DD +  T+L   T++D      +KL  QP+ V+V       V C  +I +L +  +  ++    YEP  +A+ P   T+ VGG +  + VY I     + TL  E  LL       D  +S++G+ L   D+ + V++F V    S +++   +H         ++ C+A + D+   ASG +D  + +W++  P  K  I++AH + +++SL W D HTL +   D+++K+W +T
Sbjct:    1 MPYEIKKVFASLPQVERGVSKILGGDPKGDHFLYTNGKCVILRNIDNPAIADIYTEHAHQVVVAKYAPSGFYIASGDISGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDTGSSVGEITGHNKVINSVDIKQTRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIFIYDGKTGEKVCALGESKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVN-VNSVVSTFPMGSNVLDQQLGCLWQKDHLLSISLSGYINYL---DKNNPSKPLRVIKGHSKSIQCLTVHRNGGKSYIYSGSHDGHINYWDSETGENDSFSGKGHTNQVSRMTVNESEQLVSCSMDDTVRYTNL---TLRDYSGQGVVKLDVQPKCVAVGPGGYTVVVCIGQIVLLKDQKKCFSIDNPGYEPEVVAVHPGGDTVAVGGTDGNVRVYSIL----ASTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHH--------AKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETKVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTIT 605          
BLAST of WD repeat-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q5RKI0|WDR1_RAT (WD repeat-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Wdr1 PE=1 SV=3)

HSP 1 Score: 473.011 bits (1216), Expect = 3.004e-158
Identity = 257/624 (41.19%), Postives = 379/624 (60.74%), Query Frame = 3
Query:   84 LSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEEL-GNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIAL-SNNEVFSVGVDDRLVITDLLSKTMKDD-----LKLTSQPRKVSV-VDSLVAVACYKEI-MLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTP---RDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVT 1913
            +  E+ +  A+LP+ ERG   +LG DPK  NFLYTNG  VI+RNID+   +DIYT+H+ +  VAKY+PSGFYIASGD++GK+RIWDTTQKEHILK EYQP +GKI DI+W+ D+ ++A+ G+GREKFGAV   DTG++VGEI+G  K IN++D+K  RP+RLAT S+D   AF EGPPFKFK     HS F NC+R+SP+G+ F +A AD +IF++DGKTGE++  L G+ AH GGIYAI+++ D +HL+SA GDK  K+W +      V  +  GS V D Q+GC W  D ++S+SLSG I+     D     KP  VI GH K I  L+   + G + + S   DG I  WD   G+ +      H+NQ+  + +  + ++ S  +DD +  T+L   T++D      +KL  QP+ V+V       V C  +I +L +  +  ++    YEP  +A+ P   T+ VGG +  + VY I       TL  E  LL       D  +S++G+ L   D+ + V++F V    S +++   +H         ++ C+A + D+   ASG +D  + +W++  P  K  I++AH + +++SL W D HTL +   D+++K+W +T
Sbjct:    1 MPYEIKKVFASLPQVERGVSKILGGDPKGDNFLYTNGKCVILRNIDNPAVADIYTEHAHQVVVAKYAPSGFYIASGDISGKLRIWDTTQKEHILKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDTGSSVGEITGHNKVINSVDIKQNRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIFIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVN-VNSVVSTFPMGSNVLDQQLGCLWQKDHLLSISLSGYINYL---DKNNPSKPLRVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFSGKGHTNQVSRMTVDESGQLVSCSMDDTVRYTNL---TLRDYSGQGVVKLDVQPKCVAVGPGGYTVVVCIGQIVLLKDQKKCFSIDNPGYEPEVVAVHPGGDTVAVGGSDGNVRVYSILG----ATLKDEGKLLEAKGPVTDLAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHH--------AKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETKVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTIT 605          
BLAST of WD repeat-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9W7F2|WDR1A_XENLA (WD repeat-containing protein 1-A OS=Xenopus laevis OX=8355 GN=wdr1-a PE=2 SV=2)

HSP 1 Score: 472.241 bits (1214), Expect = 6.060e-158
Identity = 257/620 (41.45%), Postives = 374/620 (60.32%), Query Frame = 3
Query:   93 ELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEEL-GNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSN-NEVFSVGVDDRLVITDLLSK--TMKDDLKLTSQPRKVSV-VDSLVAVACYKEI-MLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLL---NTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVTVK 1919
            EL +  A+LP+ ERG   +L  DPK  NFLYTNG SVIIRNID+   +DIYT+H+ +A VA+Y+PSGFYIASGD +GK+RIWDTTQKEH+LK EYQP +GKI DI+W+ D+ ++A+ G+GREKF +V   DTG++VGEI+G  K IN++D+K TRP+RL T S+D   AFLEGPPFKFK     HS F NC+R+SP+G    SAGAD +IF++DGKTGE++  L G+ AH GGIYA++++ DG+ L+SA GDK  K+W +      V  +  GS V D Q+GC W  D ++SVSLSG I+     D     +P  VI GH K I  ++   S G + + +   DG I  WD   G+ +      H+NQ+ S+ L   N++ +  +DD L  T L+SK  +  + +K+  QP+ V+V     V   C  +I +L +  +   +  + YEP  +A+     T+ VGG + K+ +Y I  +    +L  E   L       D  +S++G+ L   D+++ V++F V     G S    Y+  H      +   VA + D+   AS  +D  + +W++  P  +  + +AH + +++SL W D HTL +   D+ +KQW VT K
Sbjct:    4 ELKKVFASLPQMERGVAKILAGDPKGNNFLYTNGKSVIIRNIDNPAIADIYTEHAHQAVVARYAPSGFYIASGDTSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFASVFLWDTGSSVGEITGNIKVINSVDIKQTRPYRLVTGSDDNCCAFLEGPPFKFKFTMSDHSRFVNCVRFSPDGSKLASAGADGQIFLYDGKTGEKVCSLGGSKAHDGGIYAVSWSPDGTQLLSASGDKTTKIWDVAANSA-VTTFNLGSDVLDQQLGCLWQKDYLLSVSLSGYINYL---DKNNPARPLRVIKGHNKSIQCMTVNNSDGRSTIYTGSHDGHINYWDAETGENDTFTGKGHTNQVSSMDLDGCNQLITCSMDDTLRYTSLISKDYSSSESVKMDVQPKCVAVGSGGYVVTVCIGQIVLLKDKKKVFAIDSLDYEPEAVAIHKGSGTVAVGGADGKVHLYSIQGN----SLKDEGKTLPAKGAVTDLAYSHDGAFLAVTDANKVVTVFSVAD---GYSEKNSYYGHH-----AKALSVAWSPDNEHFASSGMDMMVYVWTLSDPDTRIKMPDAHRLHHVSSLAWLDEHTLATVSHDACVKQWTVTFK 607          
BLAST of WD repeat-containing protein 1 vs. UniProt/SwissProt
Match: sp|O75083|WDR1_HUMAN (WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1 PE=1 SV=4)

HSP 1 Score: 469.929 bits (1208), Expect = 4.285e-157
Identity = 250/618 (40.45%), Postives = 378/618 (61.17%), Query Frame = 3
Query:   93 ELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEEL-GNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIAL-SNNEVFSVGVDDRLVITDLLSKTMKDD--LKLTSQPRKVSV-VDSLVAVACYKEI-MLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTP---RDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVT 1913
            E+ +  A+LP+ ERG   ++G DPK  NFLYTNG  VI+RNID+   +DIYT+H+ +  VAKY+PSGFYIASGD++GK+RIWDTTQKEH+LK EYQP +GKI DI+W+ D+ ++A+ G+GREKFGAV   D+G++VGEI+G  K IN++D+K +RP+RLAT S+D   AF EGPPFKFK     HS F NC+R+SP+G+ F +A AD +I+++DGKTGE++  L G+ AH GGIYAI+++ D +HL+SA GDK  K+W ++     V  +  GSTV D Q+GC W  D ++SVSLSG I+     D     KP  VI GH K I  L+   + G + + S   DG I  WD   G+ +      H+NQ+  + +  + ++ S  +DD +  T L+ +       +KL  QP+ V+V       V C  +I +L +  +  ++    YEP  +A+ P   T+ +GG +  + +Y I       TL  E  LL       D  +S++G+ L   D+ + V++F V    S +++   +H         ++ C+A + D+   ASG +D  + +W++  P  +  I++AH + +++SL W D HTL +   D+++K+W +T
Sbjct:    4 EIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYTEHAHQVVVAKYAPSGFYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVS-VNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYL---DRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILG----TTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHH--------AKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTIT 605          
BLAST of WD repeat-containing protein 1 vs. TrEMBL
Match: A0A0C9RAF6 (Flr_0 protein OS=Fopius arisanus OX=64838 GN=flr_0 PE=4 SV=1)

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 288/612 (47.06%), Postives = 389/612 (63.56%), Query Frame = 3
Query:   84 LSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMK--DDLKLTSQPRKVSVVDSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGG-EEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKV 1910
            +S E     A LPRT+RG  +VLG DPK K+FLYTNGNSVIIRNID+   +DIYT+HS    VAKYSPSGFYIASGD +GKIRIWDT  KEHILK E+ PI G I DI+WS D+ ++ + G+GRE+FG V   DTGT+VGEISG +K IN+ D + TRPFRL T SED  VA  EGPPFKFK   Q HS F   ++YSP+G++F SAG D K+F++DG + E + E+G+PAH+GG+Y + +  DG+ L++A GDK  ++W + E +  + E+  GSTV+D QV C W GD ++SVSLSG I+    +D     KP  +I GH KPIT L+ S     + +   DG +  W+   G+ + +    H NQI  +  S N +++ G+DD L   D+ S +    D +KL SQPR + + + +V  A  ++I L  +   ++ LP+ YEPSC+ ++P    + +G   + K++VY ++    SLTL  E   L    D  +S +   LV  D++RKV L+ + ++          HN  W FH  RV+ VA ++DST+VASGSLD +IIIWSV  PA   IIKNAHP S IT LVW D  TL S GQD N K W+V
Sbjct:    1 MSYETKYIFAALPRTQRGTPLVLGGDPKGKSFLYTNGNSVIIRNIDNPAIADIYTEHSCAVNVAKYSPSGFYIASGDQSGKIRIWDTVNKEHILKNEFHPIGGPIKDIAWSPDSQRMVVVGEGRERFGHVFMADTGTSVGEISGQSKPINSCDFRPTRPFRLITGSEDNTVAIFEGPPFKFKMTKQEHSRFVQAVKYSPSGNLFASAGFDGKVFLYDGTSSELVSEIGSPAHQGGVYGVTWKPDGTQLLTASGDKTCRLWDV-ETKSLITEFNMGSTVEDQQVSCLWQGDHLLSVSLSGFINYLNVND---PSKPLRIIKGHNKPITVLTLSPDRGTIYTGSHDGHVTNWNASTGENDRVQGQGHGNQINGMKASGNLLYTAGIDDTLRAIDIASNSYNDADTIKLDSQPRGLDIYNDIVVTAAMRQIHLTQSGRKVSKLPIDYEPSCVGVNPETGDVAIGSTSDNKVYVYNLSG--TSLTLKLELEHLGPVTDVAYSPDNKYLVACDANRKVILYMLPEYKLA-------HNREWGFHNARVNTVAWSSDSTMVASGSLDTTIIIWSVTNPAKHTIIKNAHPQSQITRLVWLDEETLISVGQDCNTKIWRV 599          
BLAST of WD repeat-containing protein 1 vs. TrEMBL
Match: A0A1I9WL82 (Seminal fluid protein OS=Nilaparvata lugens OX=108931 PE=2 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 289/604 (47.85%), Postives = 389/604 (64.40%), Query Frame = 3
Query:  108 LATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKD-DLKLTSQPRKVSVVDSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSP-NKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVT 1913
             ATLPRT+RGQ IVLG DPK KNFLYTNGNSVIIRNI++   SDIYT+HS    VAKYSPSGFYIASGD++GK+RIWDT  KEH++K E+QPI G I DI+WS DN ++ I G+GRE+FG V   +TGT+VGEISG +K IN++D +  RPFR+ T SED  +A  EGPPFKFK   Q HS F   +RYSP+G  F S G D K+FV+DG + + + E+G+PAH GG+YA+A+  DG  L++A GDK  K+W + E +  + ++  G+ V+D QV C W GD +++VSLSG IS     D+   +KP  VI GH KPIT L+ S    ++ +   DG + +WD   G+ E +    H NQI  +    N ++S G+DD L   +L S      D+KL++QPR + + D LV VA  KE+ +      ++  P++YEPS ++++P + + L VGG++ KI +Y ++     ++   E   L    D  FS +G  LV  D++RKV L+ +  F          HN+ W FH+ RV+C+A + +S  VASGSLD +IIIWSV QPA   IIKNAHP S IT L W D  TL S GQD N K W +T
Sbjct:   82 FATLPRTQRGQPIVLGGDPKGKNFLYTNGNSVIIRNIENPAISDIYTEHSCAVNVAKYSPSGFYIASGDVSGKVRIWDTVNKEHLMKNEFQPIGGPIKDIAWSPDNQRMVIVGEGRERFGHVFMAETGTSVGEISGQSKPINSVDFRPARPFRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYSPSGSHFASGGFDGKVFVYDGTSADLVSEIGSPAHDGGVYAVAWKPDGKQLLTASGDKTCKLWDV-ETKSVISQFTMGTQVEDQQVSCLWQGDYLLTVSLSGFISYL---DVNNPDKPIRVIKGHNKPITVLTLSPDRKRIFTGSHDGYVTSWDAKTGETERVMGTGHGNQINGMRTVKNFLYSCGIDDSLKQVNLDSGWYSGVDIKLSAQPRGMDLKDDLVVVATVKELTVIKQDRKISGFPITYEPSSVSINPGDDSYLAVGGDDSKIHIYAMSGTV--ISPHKELQHLGPVTDVAFSPDGKYLVACDANRKVILYTLPDFQLA-------HNKEWGFHSARVNCIAWSPNSQQVASGSLDTTIIIWSVAQPAKHTIIKNAHPQSQITRLAWIDDETLTSVGQDCNTKIWNIT 672          
BLAST of WD repeat-containing protein 1 vs. TrEMBL
Match: A0A1A9WBM8 (WD_REPEATS_REGION domain-containing protein OS=Glossina brevipalpis OX=37001 PE=4 SV=1)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 287/603 (47.60%), Postives = 387/603 (64.18%), Query Frame = 3
Query:  111 ATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKDD-LKLTSQPRKVSVV--DSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKV 1910
            ATLPRT+RGQ IVLGSDPK KNFLYTNGNSVIIRNI++   +D+YT+HS    VAKYSPSGFYIASGD +GKIRIWDT  KEH+LK E+QPI+G I DISWS DN ++ + G+GRE+FG V   +TGT+VGEISG +K IN+ D +  RPFR+ T SED  +   EGPPFKFK   Q HS F   +RYSP+G  F SAG D K+F++DG T + + E GNPAHKGG+YA+A+  DG+ +++  GDK  ++W + E R  + E+V GS VDD QV C W G+ +++VSLSG+I+    +D     KP  V+ GH KPIT L  S   + + +   DG +++W+  NG  + +    H NQ+  IA   + V++ G+DD L    + S    D  +KL  QPR +S+   ++ +A+AC KE+ L  + + L  LP+ YE + ++ +P    + VGG++ K+++Y + N      +  E   L    D  +S +   LV  D+ RKV L+ V ++        P HN+ W FH  RV+ VA + +S LVASGSLD +IIIWSV  PA   IIKNAHP S IT LVW D +T+ S GQD N K W V
Sbjct:   17 ATLPRTQRGQPIVLGSDPKGKNFLYTNGNSVIIRNIENPAIADVYTEHSCAVNVAKYSPSGFYIASGDQSGKIRIWDTVNKEHLLKNEFQPIAGPIKDISWSQDNQRIVVAGEGRERFGHVFMAETGTSVGEISGQSKSINSCDFRPARPFRIVTGSEDNTIGVFEGPPFKFKMTKQDHSRFVQAVRYSPDGKYFASAGFDGKVFLYDGNTSDLVGEFGNPAHKGGVYAVAWKPDGTQVLTCSGDKTCRLWNV-ETRELLTEFVMGSNVDDQQVSCLWQGEHLLTVSLSGHITYLNVND---ASKPLRVVKGHNKPITVLGLSDDRSTIYTGSHDGIVISWNSGNGVNDRVAGTGHGNQMNGIAAWGDFVYTCGIDDSLRQFSVESNAYTDYVVKLNCQPRGLSIFRNENTIALACVKELTLVQDQKKLFSLPIKYEATSISANPETLDIAVGGDDQKLYIYSLKNTVLEPKI--ELEHLGAVTDCSYSPDNKYLVACDAHRKVVLYNVAEY-------KPAHNKEWGFHNARVNTVAWSPNSLLVASGSLDTNIIIWSVSNPAKHTIIKNAHPQSQITRLVWLDNNTVISTGQDCNTKIWHV 606          
BLAST of WD repeat-containing protein 1 vs. TrEMBL
Match: A0A1I8PCM9 (WD_REPEATS_REGION domain-containing protein OS=Stomoxys calcitrans OX=35570 GN=106094067 PE=4 SV=1)

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 289/603 (47.93%), Postives = 388/603 (64.34%), Query Frame = 3
Query:  111 ATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKDD-LKLTSQPRKVSVV--DSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKV 1910
            ATLPRT+RGQ IVLGSDPK KNFLYTNGNSVIIRNI++   +D+YT+HS    VAKYSPSGFYIASGD +GKIRIWDT  KEHILKCEYQPI G I DI+WS DN ++ I G+GRE+FG V   +TGT+VGEISG +K IN+ D +  RPFR+ T SED  +   EGPPFKFK   Q HS F   +RYSP+G  F SAG D K+F++DG T E + E+GNPAHKGG+YA+A+  DG+ L++  GDK  ++W + E R  + E+  G+TVDD QV C W G+ +++VSLSG+I+    +D     KP   I GH KPIT L  S   + + +   DG +  W+  +G  + +    H NQ+  IA   + V++ G+DD L   ++ S    D  +KL  QPR +++   ++++AVAC K+I L  + + +  LP+ YE S ++++P    + VGG++ K+ +Y +     +L   +E   L    D  +S +   LV  D+ RKV L+ V ++        P HN+ W FH  RV+ VA + +S LVASGSLD +IIIWSV  PA   IIKNAHP S IT L+W D +T+ S GQD N K W V
Sbjct:   17 ATLPRTQRGQPIVLGSDPKGKNFLYTNGNSVIIRNIENPAIADVYTEHSCAVNVAKYSPSGFYIASGDQSGKIRIWDTVNKEHILKCEYQPIGGPIKDIAWSQDNQRIVIVGEGRERFGHVFMTETGTSVGEISGQSKPINSCDFRPARPFRIVTGSEDNTIGVFEGPPFKFKMTKQEHSRFVQAVRYSPDGKFFASAGFDGKVFIYDGATSELVGEVGNPAHKGGVYAVAWKPDGTQLLTCSGDKTCRLWNV-ETREMITEFPMGNTVDDQQVSCLWQGEHLLTVSLSGHITYLNVND---PSKPLRTIKGHNKPITVLGLSDDRSTIYTGSHDGVVTKWNSGSGVNDRVAGTGHGNQMNGIAAWGDFVYTCGIDDSLRQFNIESNAFTDYVVKLNCQPRGLAIFRNENIIAVACVKDITLVQDQKKVFSLPIKYESSSISVNPETLDVAVGGDDQKLHIYSLKG--TTLESKTELDHLGAVTDCSYSPDNKYLVACDAHRKVVLYSVEEYK-------PAHNKEWGFHNARVNTVAWSPNSQLVASGSLDTTIIIWSVTNPAKHTIIKNAHPQSQITRLLWLDNNTVISTGQDCNTKIWHV 606          
BLAST of WD repeat-containing protein 1 vs. TrEMBL
Match: A0A0L0CQH9 (Actin-interacting protein 1 OS=Lucilia cuprina OX=7375 GN=FF38_09667 PE=4 SV=1)

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 291/603 (48.26%), Postives = 387/603 (64.18%), Query Frame = 3
Query:  111 ATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKDD-LKLTSQPRKVSVV--DSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKV 1910
            ATLPRT+RGQ IVLGSDPK KNFLYTNGNSVIIRNI++   +D+YT+HS    VAKYSPSGFYIASGD +GKIRIWDT  KEHILK E+QPI G I DI+WS DN ++ + G+GRE+FG V   +TGT+VGEISG +K IN+ D +  RPFR+ T SED  +   EGPPFKFK   Q HS F   +RYSP+G  F SAG D K+F++DG T E + E G+PAHKGG+YA+A+  DG+ L++  GDK  ++W + E R  + E+V G+TVDD QV C W G+ +++VSLSGNIS    +D     KP  VI GH KPIT L  S   + + +   DG + +W+  +G  + +    H NQ+  IA   + V++ G+DD L    + S    D  +KL  QPR ++++  ++++A+AC KEI L  + + +  LP+ YE S +  +P    + VGG++ K+ VY +     SL L  E   L    D  +S +   LV  D+ RKV L+ V ++        P HN+ W FH  +V+ VA + +S LVASGSLD +IIIWSV  P+   IIKNAHP S IT LVW D +T+ S GQD N K W V
Sbjct:   16 ATLPRTQRGQPIVLGSDPKGKNFLYTNGNSVIIRNIENPAIADVYTEHSCAVNVAKYSPSGFYIASGDQSGKIRIWDTVNKEHILKNEFQPIGGPIKDIAWSPDNQRIVVVGEGRERFGHVFMTETGTSVGEISGQSKPINSCDFRPARPFRIVTGSEDNTIGIFEGPPFKFKMTKQEHSRFVQAVRYSPDGKYFASAGFDGKVFMYDGATSELIGEFGSPAHKGGVYAVAWKPDGTQLLTCSGDKTCRLWNV-ETRELISEFVMGTTVDDQQVSCLWQGEHLLTVSLSGNISYLDVND---PSKPLRVIKGHNKPITVLGLSDDRSTIYTGSHDGVVTSWNSGSGVNDRVQGAGHGNQMNGIAAWGDFVYTCGIDDSLRQFSIESNAFTDYVVKLNCQPRGLAILRNENIIALACVKEITLVQDQKKIFSLPIKYEASSITANPETLEIAVGGDDQKLRVYSLKG--TSLELKCELEHLGAVTDCSYSPDNKYLVACDAHRKVVLYSVEEYK-------PAHNKEWGFHNAKVNTVAWSPNSLLVASGSLDTTIIIWSVSNPSKHTIIKNAHPQSQITRLVWLDNNTVISTGQDCNTKVWHV 605          
BLAST of WD repeat-containing protein 1 vs. Ensembl Cavefish
Match: WDR1 (WD repeat domain 1 [Source:NCBI gene;Acc:103036333])

HSP 1 Score: 459.914 bits (1182), Expect = 4.369e-154
Identity = 258/622 (41.48%), Postives = 373/622 (59.97%), Query Frame = 3
Query:   84 LSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNP-AHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIAL-SNNEVFSVGVDDRLVITDLLSK--TMKDDLKLTSQPRKVSVVDSLVAVA-CYKE-IMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTP---RDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVTV 1916
            +S EL +  A+LP+ ERG   VLG DPK  NFLYTNG SVIIRNID+   +DIYT+H  +  VAKY+PSGFYIASGD++GKIRIWDTTQKEH+LK EYQP  GKI DISW+ D+ ++A+ G+GREKFGAV   D+G++VGEI G +K IN++D+K TRP+RL T S+D    FLEGPPFKFK     HS F NC+R+SP+G  + SAGAD +IF++DGKT ++   LG   AH+GGIYA+ ++ D + LISA GDK +K+W +      V  +  GS V D Q+GC W  D ++SVSLSG I+     D     +P  VI GH K I  L+     G + + S   DG I  WD   G+ E +    HSN +  + +  +N + +  +DD +  TDL  K  +  D +K+  QP+ VS+    +AVA C  + ++L +  +  TL  + YEP   A+ P   T+ VGG + K+ +Y +  +    TL  +  +L       D  FS +G+ L   D  + +++F V       +I   ++  H      +V C++ + D+   ASG +D  + +W+V     +  I ++H + +++ L W D HTL +   D+++KQW + +
Sbjct:    1 MSHELKRVFASLPQMERGVAKVLGGDPKGNNFLYTNGKSVIIRNIDNPAIADIYTEHPHQVIVAKYAPSGFYIASGDVSGKIRIWDTTQKEHLLKYEYQPFGGKIKDISWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEIVGHSKIINSVDIKQTRPYRLVTGSDDNCTTFLEGPPFKFKCTLSDHSRFVNCVRFSPDGSRYASAGADGQIFLYDGKTADKQGTLGGAKAHEGGIYAVCWSPDSTQLISASGDKTVKLWDVATGTA-VTTFNLGSDVLDQQLGCLWQKDHLLSVSLSGYINYL---DKNSPNRPLRVIKGHSKSIQCLTVHKEDGRSVIYSGSHDGHINYWDAETGENEEISGKGHSNLVARMTVDESNRLVTCSMDDTVRYTDLSKKEYSASDLVKMEVQPKTVSIGPGGLAVAVCIGQVVLLKDKRKVFTLDNLGYEPEAGAVHPGGGTVAVGGADGKVRMYSVQGN----TLKDDGKVLEVKGPVTDMEFSRDGAFLAVSDEKKVITVFTVAD---DYAIKNDFYGHH-----AKVVCLSWSPDNEHFASGGMDMMVYVWTVNDADKRIKIPDSHRLHHVSGLAWLDEHTLVTTSHDASVKQWTLKI 606          
BLAST of WD repeat-containing protein 1 vs. Ensembl Cavefish
Match: poc1a (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 75.485 bits (184), Expect = 2.993e-14
Identity = 73/307 (23.78%), Postives = 129/307 (42.02%), Query Frame = 3
Query:  243 YTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTT----------QKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTW 1133
            +  H    T   ++ +   I +G M+  + IW+             K+ ++  ++ P SG++   +      +L + G   E    V    TGT         + IN     S+    L T+S+D  V        KF  +   H N+  C ++SP+G + VSA  D  + ++D  + E +       H G +    F+  G+ + + G D  +KVW I   +      V  + V+ +    +  G+ +I+ S   N S  K  DL++G   Y  + GHQ P T ++FS   +   S  SD +++ W
Sbjct:    9 FKGHRDTVTSIDFNCNMKQIVTGAMDSCVMIWNLKPQMRAYRFVGHKDAVMSVQFSP-SGRLVASASRDKTVRLWVPGVKGE--STVFRAHTGT--------VRSINF----SSDGQSLVTASDDKTVKVWTVHRQKFLFSLCQHINWVRCAKFSPDGRLIVSASDDRTVKIWDKNSRECIHSFCE--HSGFVNCADFHPSGTCIAAGGTDNTVKVWDIRTNKLLQHYQVHSAVVNSLSFHSS--GNYLITAS---NDSTLKILDLVEGRLLY-TLHGHQGPATCVAFSRTGDHFASGGSDEQVMLW 292          

HSP 2 Score: 53.1434 bits (126), Expect = 5.081e-7
Identity = 46/177 (25.99%), Postives = 77/177 (43.50%), Query Frame = 3
Query:  249 QHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILK-CEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFV----FDGKTGEQLEEL 764
            QH +    AK+SP G  I S   +  ++IWD   +E I   CE+   SG +    +    T +A GG   +    V ++ T   +      +  +N+L   S+  + L T+S D  +  L+    +       H   A C+ +S  GD F S G+D ++ +    FDG    ++  L
Sbjct:  137 QHINWVRCAKFSPDGRLIVSASDDRTVKIWDKNSRECIHSFCEH---SGFVNCADFHPSGTCIAAGGT--DNTVKVWDIRTNKLLQHYQVHSAVVNSLSFHSSGNY-LITASNDSTLKILDLVEGRLLYTLHGHQGPATCVAFSRTGDHFASGGSDEQVMLWRTNFDGTDYREVLRL 307          
BLAST of WD repeat-containing protein 1 vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 75.485 bits (184), Expect = 4.239e-14
Identity = 67/306 (21.90%), Postives = 128/306 (41.83%), Query Frame = 3
Query:  216 IDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTW 1133
            I+D      +  H      A +SPS   +A+G  +  + +W+   K    + E           S S D     +    R+K   +   +   +    +     + +++  S    RL T+S+D  +        KF  +   H+N+  C R+SP+G +  S G D  + ++D  + + +    +  + G    + FN  G+ + S+G D  LK+W I   +      V  ++V+      +  G+ +IS S    + +    DL++G   Y  + GH+ P+ A+ FS   +   S  +D ++L W
Sbjct:    5 IEDPTLERCFKGHRDAVPCADFSPSKKQLATGSSDKTVMVWNLNPKARAFRFEGHKDVVTAVHFSPSGD----LLASASRDKTVRLWTPNIKGDSTVFTAHTATVRSVNFSSDGQ-RLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTD--YGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPS--GNYLISGSSDSTVKIL---DLLEGRLIY-TLYGHKGPVLAVVFSREGDLFASGGADLQVLMW 297          

HSP 2 Score: 56.6102 bits (135), Expect = 4.049e-8
Identity = 48/215 (22.33%), Postives = 83/215 (38.60%), Query Frame = 3
Query:  228 RDSDIYT--QHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQ 866
            R   IY+  QH++    A++SP G  +AS   +  +R+WDT+ ++ I                    NT    GG                   + +    CI             A+S  D  +   +    K   ++Q HS   NC  + P+G+  +S  +D+ + + D   G  +  L    HKG + A+ F+ +G    S G D  + +W+
Sbjct:  133 RQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCI--------------------NTFTDYGGPA--------------TFVDFNASGTCI-------------ASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNYLISGSSDSTVKILDLLEGRLIYTLY--GHKGPVLAVVFSREGDLFASGGADLQVLMWK 298          

HSP 3 Score: 54.6842 bits (130), Expect = 1.643e-7
Identity = 55/238 (23.11%), Postives = 93/238 (39.08%), Query Frame = 3
Query:  564 RLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGK--AEYLCKNVHSNQIQSIAL--SNNEVFSVGVDDRLVITDLL 1265
            +LAT S D  V      P       + H +    + +SP+GD+  SA  D  + ++      + +     AH   + ++ F+ DG  LI+A  DK LK+W +   +     +++        V C         V+  G+    +  D     +       +  P T + F++    + SS +D  +  WDI   K    Y    VHS  +   +   S N + S   D  + I DLL
Sbjct:   32 QLATGSSDKTVMVWNLNPKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWTPNI--KGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQK-----FIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWD-TSSRQCINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHY---QVHSASVNCFSFHPSGNYLISGSSDSTVKILDLL 258          
BLAST of WD repeat-containing protein 1 vs. Ensembl Cavefish
Match: poc1a (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 75.0998 bits (183), Expect = 4.373e-14
Identity = 75/316 (23.73%), Postives = 132/316 (41.77%), Query Frame = 3
Query:  216 IDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTT----------QKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTW 1133
            +DD      +  H    T   ++ +   I +G M+  + IW+             K+ ++  ++ P SG++   +      +L + G   E    V    TGT         + IN     S+    L T+S+D  V        KF  +   H N+  C ++SP+G + VSA  D  + ++D  + E +       H G +    F+  G+ + + G D  +KVW I   +      V  + V+ +    +  G+ +I+ S   N S  K  DL++G   Y  + GHQ P T ++FS   +   S  SD +++ W
Sbjct:    1 MDDPSLQRNFKGHRDTVTSIDFNCNMKQIVTGAMDSCVMIWNLKPQMRAYRFVGHKDAVMSVQFSP-SGRLVASASRDKTVRLWVPGVKGE--STVFRAHTGT--------VRSIN----FSSDGQSLVTASDDKTVKVWTVHRQKFLFSLCQHINWVRCAKFSPDGRLIVSASDDRTVKIWDKNSRECIHSFCE--HSGFVNCADFHPSGTCIAAGGTDNTVKVWDIRTNKLLQHYQVHSAVVNSLSFHSS--GNYLITAS---NDSTLKILDLVEGRLLY-TLHGHQGPATCVAFSRTGDHFASGGSDEQVMLW 293          

HSP 2 Score: 51.9878 bits (123), Expect = 1.225e-6
Identity = 46/177 (25.99%), Postives = 77/177 (43.50%), Query Frame = 3
Query:  249 QHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILK-CEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFV----FDGKTGEQLEEL 764
            QH +    AK+SP G  I S   +  ++IWD   +E I   CE+   SG +    +    T +A GG   +    V ++ T   +      +  +N+L   S+  + L T+S D  +  L+    +       H   A C+ +S  GD F S G+D ++ +    FDG    ++  L
Sbjct:  138 QHINWVRCAKFSPDGRLIVSASDDRTVKIWDKNSRECIHSFCEH---SGFVNCADFHPSGTCIAAGGT--DNTVKVWDIRTNKLLQHYQVHSAVVNSLSFHSSGNY-LITASNDSTLKILDLVEGRLLYTLHGHQGPATCVAFSRTGDHFASGGSDEQVMLWRTNFDGTDYREVLRL 308          
BLAST of WD repeat-containing protein 1 vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 75.8702 bits (185), Expect = 5.215e-14
Identity = 69/310 (22.26%), Postives = 133/310 (42.90%), Query Frame = 3
Query:  213 NIDDLRDSDI---YTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTW 1133
            N+ DL D  +   +  H      A +SPS   +A+G  +  + +W+   K    + E       +  + +S     LA   + +       N+   + V   +     + +++  S    RL T+S+D  +        KF  +   H+N+  C R+SP+G +  S G D  + ++D  + + +    +  + G    + FN  G+ + S+G D  LK+W I   +      V  ++V+      +  G+ +IS S    + +    DL++G   Y  + GH+ P+ A+ FS   +   S  +D ++L W
Sbjct:   14 NLYDLEDPTLERCFKGHRDAVPCADFSPSKKQLATGSSDKTVMVWNLNPKARAFRFEGH--KDVVTAVHFSPSGDLLASASRDKTVRLWTPNIKGDSTV--FTAHTATVRSVNFSSDGQ-RLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTD--YGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPS--GNYLISGSSDSTVKIL---DLLEGRLIY-TLYGHKGPVLAVVFSREGDLFASGGADLQVLMW 310          

HSP 2 Score: 56.225 bits (134), Expect = 7.409e-8
Identity = 48/215 (22.33%), Postives = 83/215 (38.60%), Query Frame = 3
Query:  228 RDSDIYT--QHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQ 866
            R   IY+  QH++    A++SP G  +AS   +  +R+WDT+ ++ I                    NT    GG                   + +    CI             A+S  D  +   +    K   ++Q HS   NC  + P+G+  +S  +D+ + + D   G  +  L    HKG + A+ F+ +G    S G D  + +W+
Sbjct:  146 RQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCI--------------------NTFTDYGGPA--------------TFVDFNASGTCI-------------ASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNYLISGSSDSTVKILDLLEGRLIYTLY--GHKGPVLAVVFSREGDLFASGGADLQVLMWK 311          

HSP 3 Score: 53.9138 bits (128), Expect = 4.373e-7
Identity = 55/238 (23.11%), Postives = 93/238 (39.08%), Query Frame = 3
Query:  564 RLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGK--AEYLCKNVHSNQIQSIAL--SNNEVFSVGVDDRLVITDLL 1265
            +LAT S D  V      P       + H +    + +SP+GD+  SA  D  + ++      + +     AH   + ++ F+ DG  LI+A  DK LK+W +   +     +++        V C         V+  G+    +  D     +       +  P T + F++    + SS +D  +  WDI   K    Y    VHS  +   +   S N + S   D  + I DLL
Sbjct:   45 QLATGSSDKTVMVWNLNPKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWTPNI--KGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQK-----FIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWD-TSSRQCINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHY---QVHSASVNCFSFHPSGNYLISGSSDSTVKILDLL 271          
BLAST of WD repeat-containing protein 1 vs. Ensembl Sea Lamprey
Match: WDR1 (WD repeat domain 1 [Source:HGNC Symbol;Acc:HGNC:12754])

HSP 1 Score: 477.633 bits (1228), Expect = 1.110e-161
Identity = 256/623 (41.09%), Postives = 378/623 (60.67%), Query Frame = 3
Query:   90 CELLQTL-ATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEEL-GNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFS-----SGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIAL-SNNEVFSVGVDDRLVITDLLSK--TMKDDLKLTSQPRKVSV-VDSLVAVACYKEIMLANNTEPLTLLPV-SYEPSCLALSPNKTTLVVGGEEFKIFVYKI-ANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKF--HTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVT 1913
            C  L++L A+LP+ ERG   V+G DPK  NFLYTNG SVIIRNI++   SD+YT+HS +  VAKY+PSGFYIASGD++GK+RIWD+TQKEHILK EYQP  GKI DISWS D+ ++AI G+GREK+GAVI  D+G++VGEI+G  K IN++D++ +RP+RL T+S+D   AF  GPPFKF+     H+ F NC+R+SP+G  F +AGAD +IFV+DG +G+++  L G+ AH GGIYAI+++ D S LISA GD+ +++W +         +  G  V D Q+GC W G  ++S+SLSG+I+     D     KP  VI GH KP+ AL+ +      G   + +   DG I  WD  +G  +      H+NQ+  +A+  +N + S  +DD L  T L SK  + +D LKL  QP+ V+V     + V C  +I+L  + +   ++    + P  +++ P+   + VGG + K+ +Y I  N  +    +S         D  FS NG+ L   DS++ VS+F               + EH  F  H  +V+C+A + D    A+G +D  + +W+VE P N+  I ++H M +++ + W D HTL +   D+ ++QW +T
Sbjct:    4 CVPLESLYASLPQVERGVAKVIGGDPKGNNFLYTNGKSVIIRNIENPAISDVYTEHSHQVLVAKYAPSGFYIASGDVSGKLRIWDSTQKEHILKYEYQPFGGKIKDISWSEDSKRIAIVGEGREKYGAVILWDSGSSVGEIAGHTKTINSVDIRPSRPYRLVTASDDNCGAFYHGPPFKFQFTLMDHTRFVNCIRFSPDGARFATAGADGQIFVYDGTSGQKICALGGDKAHDGGIYAISWSADSSQLISASGDRTVRLWDVAT-STATTTFSMGPDVSDQQLGCLWQGSHMLSISLSGHINYL---DANNPSKPIRVIKGHSKPVQALALNIPKDKDGQATIYTGSIDGHINIWDAKSGINDGFAGKGHTNQVSHMAVDESNSLVSCSMDDTLRFTSLDSKEYSAQDTLKLNEQPKSVAVGPGGCIVVICIGQILLLKDRKKAFVIEAPGFGPEAVSIHPSNGIVAVGGVDGKVHMYDIDGNTLKKHATVSALQAHGPVTDVAFSPNGAFLAVCDSNKVVSVFNT----------VDDYKEHGTFYGHHAKVTCLAWSPDCQHFATGGMDMMVYVWTVEDPNNRIRIPDSHRMHHVSGIAWLDTHTLVTTSHDATVRQWAIT 612          
BLAST of WD repeat-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003168.1 (pep scaffold:Pmarinus_7.0:GL476396:632759:655100:1 gene:ENSPMAG00000002868.1 transcript:ENSPMAT00000003168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 468.774 bits (1205), Expect = 3.780e-158
Identity = 252/628 (40.13%), Postives = 376/628 (59.87%), Query Frame = 3
Query:   84 LSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEEL-GNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALS--FSSGLNKLVSSDSDGKI-------LTWDIINGKAEYLCKNVHSNQIQSIALS--NNEVFSVGVDDRLVITDLLSKTMK--DDLKLTSQPRKVSVVDSLVAVA-CYKE-IMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVTVK 1919
            +  EL    A LP+ ERG   VLG DPK  NFLYTNG SVIIRNI++   +D+YT+H+   +VAKY+PSGFYIASGD +GK+RIWDTTQKEH+LK EYQP +G+I DI+W+ D+ ++A+ G+GRE FGAV   D+G++VGEI G +K IN++D+K TRP+RL T S+D   AFL+GPPFKF+     HS F N +R+SPNG+ F +AGAD +IF++DG +G+++  L G  AH GGIYA+ ++ D + L+SA GD+ +++W +   R     +  G+ V+D Q+GC W G  ++S+ LSG I      D     KP  VI GH K I +L+    SG   + S   DG I         WD   G  +    + H+NQ+  + +   +N + S  +DD L  TDL  K     + +KL SQP+ V+V    + VA C ++ ++L +    + L    YEP  +A+  +  T+ VGG++ K+ +YK+  +  +   +   ++     D  FS +G+ L  GD+++ VS+F V     G  +   Y+  H      +V C+A + DS  +AS  +D  + +W++ Q  NK  + + H M++++ L W D HTL +   D+ IKQW +T K
Sbjct:    1 MPYELNSVFACLPQVERGVPKVLGGDPKGVNFLYTNGRSVIIRNIENPAIADVYTEHAHFTSVAKYAPSGFYIASGDTSGKVRIWDTTQKEHLLKYEYQPFAGRIKDIAWTEDSKRIAVVGEGRENFGAVFLWDSGSSVGEIVGHSKVINSVDIKQTRPYRLVTGSDDNNAAFLQGPPFKFQFTTSDHSRFVNSVRFSPNGNFFATAGADGQIFIYDGASGQKVSSLGGEKAHDGGIYAVCWSPDSTQLMSASGDRTVRLWDVAAGRATT-TFTMGAEVNDQQLGCLWQGQHLLSIGLSGYIHYL---DRNNPSKPIRVIKGHSKSIQSLTTHTGSGSPTIYSGSYDGHINILLGSTHYWDAKTGVNDGFSGHGHTNQVSKLVVEPKSNTLVSCSMDDTLRFTDLNKKLYSPGEAVKLDSQPKCVAVGPGGITVATCIEQVVLLKDKKRGIGLENPGYEPEVVAIHRDGVTVAVGGQDSKVHLYKVQGNTLADAGVEPLSVHGAVMDVAFSPDGTFLAVGDANKVVSIFSVAD---GYKLENSYYGHH-----AKVVCLAWSPDSHHLASSGMDMMVYVWTIGQMDNKVRMADCHRMNHVSGLSWLDEHTLVTTSHDACIKQWTITFK 616          
BLAST of WD repeat-containing protein 1 vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 78.1814 bits (191), Expect = 1.640e-15
Identity = 81/305 (26.56%), Postives = 136/305 (44.59%), Query Frame = 3
Query:  252 HSSKATVAKYSPSGFYIASGDMNGKIRIWD----------TTQKEHILKCEYQPISGKICDISWSSDNT-KLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTW 1133
            H    T   ++P+   +ASG M+  + +W+             K+ ++  ++ P SG +  +S S D T +L +     E    V    T T V  +S  A      D +S     L T+S+D  +        KF  +   HSN+    ++SP+G + VS   D  + V+D  + E +       H G +  + F+  G+ + +AG D  +KVW I   +      V G+ V+ +    T  G+ +I+ S   N S  K  DL++G   Y  + GHQ P TA++FS   +   S  SD +++ W
Sbjct:   17 HRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSP-SGHLV-VSASRDKTVRLWVPSVKGE--STVFKAHTAT-VRSVSFSA------DGQS-----LVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYE--HGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPT--GNYLITAS---NDSTLKVLDLVEGRLFY-TLHGHQGPATAVAFSRAGDFFASGGSDEQVMVW 297          

HSP 2 Score: 50.8322 bits (120), Expect = 7.614e-7
Identity = 47/206 (22.82%), Postives = 76/206 (36.89%), Query Frame = 3
Query:  249 QHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQ 866
            QHS+    AK+SP G  I SG  +  +R+WD+  +E +                    +T    GG                           +N +D   +    +A +  D  V   +    K   ++Q H    N L + P G+  ++A  D+ + V D   G     L    H+G   A+AF+  G    S G D+ + VW+
Sbjct:  142 QHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECV--------------------HTFYEHGG--------------------------FVNQVDFHPSGTC-IAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLH--GHQGPATAVAFSRAGDFFASGGSDEQVMVWK 298          
BLAST of WD repeat-containing protein 1 vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 58.5362 bits (140), Expect = 1.806e-9
Identity = 50/218 (22.94%), Postives = 94/218 (43.12%), Query Frame = 3
Query:  240 IYTQHSSKATVAKYSPSGFYIASGDMNGKIRIW----DTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLE----GPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQI 869
            + T H  +    K+ P+G  +AS   +  I +W    D     H+     +  +G I DI +S+D +   I     +K   + + +TG  +  + G    +N        P  + T+S+DG V   +    G    F+  +QC S     + ++   D  +S G D  I V+D +  + +  +    H   +  ++ + DGS+L+S   D  +++W I
Sbjct:   52 LLTGHEGEVYCCKFHPNGNTLASAGFDRTILMWNVYGDCDNYAHL-----KGHTGAILDIHYSTDGS--TIFTSSTDKTVGLWDSETGERIKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSVHSFQNTYQCLS-----VTFNDTSDQILSGGIDNVIKVWDLRQNKLIYTM--KGHNDSVTGLSLSPDGSYLLSNAMDNSVRIWDI 255          
BLAST of WD repeat-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004242.1 (pep scaffold:Pmarinus_7.0:GL482741:5889:16850:1 gene:ENSPMAG00000003878.1 transcript:ENSPMAT00000004242.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 2.543e-9
Identity = 80/341 (23.46%), Postives = 131/341 (38.42%), Query Frame = 3
Query:  243 YTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHIL-------KCEYQPISGKICDISWSSDNTKLAIG-GQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLE-------GPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVF---DGKTGEQLEELGNPA-----HKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTW--IGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQI 1190
            Y  H       +++P G Y+ +G  + K+R+W       +              +   +C +S S D ++LA+G   G  +   V +V     V        C+  + L       LA+ SE G V           G       N       +  +R     D F++A +D  + V        G Q E    P+     H+G +    F+ DGS L++   D+ L  W++   R         S+  D   G  W   G+TV+S S   N    K  D   G    E + GHQ  +  +S + G+  ++S  SDG++  W   +G+ E  C   H+ +I
Sbjct:  172 YLGHKGPVNCVQFTPDGRYLLTGGDDNKVRVWTGGLGRPVAVLGGPGRDAVPVAVVAALC-VSGSPDGSQLAVGLHSGSVRVHGVHSVGVTVEVQAHPHAVHCV--VWLLGAGGTALASGSEGGSVKVWRLSGEEALGDAAALTLNRTLQ-GLSGAVRALACSDRFLAAASDDAMVVLWPIGEALGGQGEATSAPSGVLWGHEGAVTCCCFSPDGSQLLTGSKDRSLVFWEVQASR---ARLRVPSSHGDWVTGVHWDRDGETVVSCS---NDCTVKVWDASTGHLQRE-LRGHQSSVNCVSVTDGV--ILSGSSDGELRAWR-CSGQ-EVACIPAHAQRI 497          
BLAST of WD repeat-containing protein 1 vs. Ensembl Yeast
Match: AIP1 (Actin cortical patch component; interacts with the actin depolymerizing factor cofilin; inhibits elongation of aged ADP-actin filaments decorated with cofilin to maintain a high level of assembly-competent actin species; required to restrict cofilin localization to cortical patches; putative regulator of cytokinesis; contains WD repeats; protein increases in abundance and relocalizes from cytoplasm to plasma membrane upon DNA replication stress [Source:SGD;Acc:S000004698])

HSP 1 Score: 233.802 bits (595), Expect = 1.893e-68
Identity = 195/652 (29.91%), Postives = 319/652 (48.93%), Query Frame = 3
Query:   81 MLSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDI-----YTQH-SSKATVAKYSP--SGFYIASGDMNGKIRIW------DTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCH---SNFANCLRYSPN-GDVFVSAGADAKIFVFDGKTGEQLEELGNPAH--KGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGD-TVISVSLSGNISLFKF--DDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSN-NEVFSVGVDDRLVITDLLSKTMKDDLKLTSQPRKVSVV-DSLVAVACYKE---IMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFK-IFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAI----------NTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVTVK 1919
            M S  L + +   P T+R     L  DP      Y  G S  +R +DD  DS +     +T H SS  T  K+SP     Y+ SGD +GK+ +W      ++   E  +K E+Q ++G I DISW  +  +L + G+GR+ FG  I+ D+G ++GE+SG ++ IN   LK +RP R  T  +DG V F +GPPFKF  + + H    +F   + +SP+ G+  ++ G+D KI  FDGK+GE L+ + +     +GGI+A+++  D     + G D  ++VW +T  +      +    + + QVG    G+  +IS+SL G ++ ++   D+++K       I GH K ITAL+    +N L+S   DG+I+ W      +       HSN I S+  S   E  S+  DD L +  +         +  SQP+  S   D   AV    +   I+ +   + +  + ++   S ++LS N   + VG EE   I V+K+++   S  L +   L   P     S + + +  GD   K+ L+ +   +   S         W FHT +++ ++             +  LVA+GSLD +I I+SV++P       NAH    + +L+W    TL S+G D+ IK+W V ++
Sbjct:    1 MSSISLKEIIPPQPSTQRNFTTHLSYDPTTNAIAYPCGKSAFVRCLDD-GDSKVPPVVQFTGHGSSVVTTVKFSPIKGSQYLCSGDESGKVIVWGWTFDKESNSVEVNVKSEFQVLAGPISDISWDFEGRRLCVVGEGRDNFGVFISWDSGNSLGEVSGHSQRINACHLKQSRPMRSMTVGDDGSVVFYQGPPFKFSASDRTHHKQGSFVRDVEFSPDSGEFVITVGSDRKISCFDGKSGEFLKYIEDDQEPVQGGIFALSWL-DSQKFATVGADATIRVWDVTTSKCVQKWTLDKQQLGNQQVGVVATGNGRIISLSLDGTLNFYELGHDEVLK------TISGHNKGITALT----VNPLISGSYDGRIMEW------SSSSMHQDHSNLIVSLDNSKAQEYSSISWDDTLKVNGITKH------EFGSQPKVASANNDGFTAVLTNDDDLLILQSFTGDIIKSVRLNSPGSAVSLSQN--YVAVGLEEGNTIQVFKLSDLEVSFDLKTP--LRAKPSYISISPSETYIAAGDVMGKILLYDLQSREVKTS--------RWAFHTSKINAISWKPAEKGANEEEIEEDLVATGSLDTNIFIYSVKRPMKIIKALNAH-KDGVNNLLWETPSTLVSSGADACIKRWNVVLE 615          
BLAST of WD repeat-containing protein 1 vs. Ensembl Yeast
Match: PWP2 (Conserved 90S pre-ribosomal component; essential for proper endonucleolytic cleavage of the 35 S rRNA precursor at A0, A1, and A2 sites; contains eight WD-repeats; PWP2 deletion leads to defects in cell cycle and bud morphogenesis [Source:SGD;Acc:S000000653])

HSP 1 Score: 62.3882 bits (150), Expect = 1.710e-10
Identity = 59/235 (25.11%), Postives = 101/235 (42.98%), Query Frame = 3
Query:  492 TNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWI---GDTVISVSLSG-NISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSN 1184
            T + ++S     +N + +  T  +    SS+ G +   E     +    Q H +  N L YSP+G   V+A  D KI V+D  +G  L       H   + A+ F   G  + S+  D  ++ W +   R F     F  T + IQ  C  +   G+ V + SL   +I ++     ++  +  + + GH+ P++ LSFS   + L S+  D  I  W I     +     V+S+
Sbjct:  293 TLIQQLSMGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATF--EEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNF---RTFTGT-ERIQFNCLAVDPSGEVVCAGSLDNFDIHVWS----VQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPIEVYSD 517          

HSP 2 Score: 53.1434 bits (126), Expect = 1.063e-7
Identity = 60/250 (24.00%), Postives = 95/250 (38.00%), Query Frame = 3
Query:  279 YSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADA-KIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQI------TEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDD 1007
            YSP G  + +   +GKI++WD T    +   E             +S  T +    +G+  F               S +   +   DL   R FR  T +E   + F                   NCL   P+G+V  +   D   I V+  +TG+ L+ L    H+G +  ++F+ + S L SA  DK +++W I       EP     + +  S   D        G  V   +L G IS+F  +D
Sbjct:  353 YSPDGSRVVTASEDGKIKVWDITSGFCLATFEEH-----------TSSVTAVQFAKRGQVMFS--------------SSLDGTVRAWDLIRYRNFRTFTGTER--IQF-------------------NCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALS--GHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPIEVYSDVLALSMRPD--------GKEVAVSTLKGQISIFNIED 546          
BLAST of WD repeat-containing protein 1 vs. Ensembl Yeast
Match: PRP4 (Splicing factor; component of the U4/U6-U5 snRNP complex [Source:SGD;Acc:S000006382])

HSP 1 Score: 60.8474 bits (146), Expect = 3.422e-10
Identity = 60/246 (24.39%), Postives = 106/246 (43.09%), Query Frame = 3
Query:  138 QFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQ--CHSNFANCLRYSPN--GDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVW 863
            Q I    D   KNF Y+N    + R + DL        H  + +  KY PSG +I S   +   R+WD +  + +L  E       +  +S+  D + +  GG   +    + ++ +G+ V  ++G +K I  +   S   +++AT   DG++   +         +Q   H N    +R+S    G   VS G D  I V+   T  ++  L    H   I ++  + +   L+S G D+ +K+W
Sbjct:  233 QMISCAEDGLIKNFQYSNEEGGL-RLLGDL------VGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGH--DKGVFSLSFQCDGSLVCSGGM--DSLSMLWDIRSGSKVMTLAGHSKPIYTVAW-SPNGYQVATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYSSDTWLKMGSLA--GHTDKIISLDISNNSHFLVSGGWDRSIKLW 464          

HSP 2 Score: 49.2914 bits (116), Expect = 1.219e-6
Identity = 61/295 (20.68%), Postives = 123/295 (41.69%), Query Frame = 3
Query:  267 TVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSD--NTKLAIGGQGREKFGAVINVDTGTNV-GEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEP-RGFVGEYV-FGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWD 1136
            +    S     +A+G   G +++ ++ Q    L  +     GKI  I W  D  N  ++    G  K     N + G  + G++ G  + I+++    +  F + ++S D      +    +     + H      L +  +G +  S G D+   ++D ++G ++  L    H   IY +A++ +G  + + GGD ++ VW I +   G + + +   + V  ++      G  ++S      I+++  D  +K       + GH   I +L  S+  + LVS   D  I  W+
Sbjct:  179 SAVSLSTDDMVVATGSWAGDLQVLNS-QTLQPLTQKLDSHVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSNEEGGLRLLGDLVGHERRISDVKYHPSGKF-IGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLA--GHSKPIYTVAWSPNGYQVATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYSSDTWLK----MGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLWN 465          
BLAST of WD repeat-containing protein 1 vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 59.6918 bits (143), Expect = 9.134e-10
Identity = 85/368 (23.10%), Postives = 159/368 (43.21%), Query Frame = 3
Query:  228 RDSDIYTQHSSKATVAKYSP-SGFYIASGDMNGKIRIWD--TTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGE-ISGMAKCINNLD------LKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFD-GKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTV-ISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNN--EVFSVGVDDRLVITDLLSKTMKDDL 1289
            R S     H S    + ++P +   + +G  +   RIWD  T    H LK  Y  +   +C +SWS D   +A G    +    + +  +G  +G+ + G +K I +L       +K     RLA+SS+DG +   +      +     H+N  +C+++   G +  S   D  + V+D    G  +  L + AH   +  ++ + D +  I A        +  T  +    E      +++ +  C   G++  + V+ S + ++F ++ L K  KP   + GHQK +  ++FS     +VS+  D  I  WD  +GK     +  H   +  +A S++   + S   D  L + D+ ++ +  DL
Sbjct:  134 RSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWV---LC-VSWSPDGEVIATGSM--DNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQG-LLYSGSHDRTVRVWDINSQGRCINILKSHAH--WVNHLSLSTDYALRIGA--------FDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPL-KSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRG-HVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDL 482          

HSP 2 Score: 46.595 bits (109), Expect = 8.970e-6
Identity = 28/122 (22.95%), Postives = 60/122 (49.18%), Query Frame = 3
Query:  498 VGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVW 863
            +  ++G  K +N++       + + ++S D  +   +G   KF +  + H      + +S +  + VS   D  + V+D +T +   +L  P HK  +Y + ++ DG  + S G DK++++W
Sbjct:  395 IARMTGHQKLVNHVAFSPDGRY-IVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDL--PGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513          
BLAST of WD repeat-containing protein 1 vs. Ensembl Yeast
Match: SIF2 (WD40 repeat-containing subunit of Set3C histone deacetylase complex; complex represses early/middle sporulation genes; antagonizes telomeric silencing; binds specifically to the Sir4p N-terminus [Source:SGD;Acc:S000000307])

HSP 1 Score: 58.9214 bits (141), Expect = 1.427e-9
Identity = 57/234 (24.36%), Postives = 108/234 (46.15%), Query Frame = 3
Query:  615 PFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQI---TEPRGFVGEYVFGSTVD--------DIQVGCTWIGDTVISV-SLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIA-LSNNEVFSVGVDDRLVITDLLSKTM 1277
            PF    +    +N   CL +S +G+  V+   + ++ +++ KTG  L  L    H+  I ++ +N DG+H+IS   + V  +W +   T  + F  +   GS+++         + V   W+ D    +    G I +++    I  + P   ++GH  PI+ L F+     L+S+  DG +  W   NG ++  C   HS  I S + + +++V S  +D  + +  L   T+
Sbjct:  209 PFALSASSGKTTNQVTCLAWSHDGNSIVTGVENGELRLWN-KTGALLNVLN--FHRAPIVSVKWNKDGTHIISMDVENVTILWNVISGTVMQHFELKETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGPKGAIFVYQ----ITEKTPTGKLIGHHGPISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQN-CFYGHSQSIVSASWVGDDKVISCSMDGSVRLWSLKQNTL 434          
BLAST of WD repeat-containing protein 1 vs. Ensembl Nematostella
Match: EDO43209 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZB4])

HSP 1 Score: 414.846 bits (1065), Expect = 5.069e-137
Identity = 232/623 (37.24%), Postives = 355/623 (56.98%), Query Frame = 3
Query:   84 LSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISG-MAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNP----AHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKDD-LKLTSQPRKVSV-VDSLVAVACYKE--IMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPR----DFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVT 1913
            +S  L  T  +LP+  RG+F VL  DPK K FLYTN  SV IR+++D    D+YT H+   TVA Y+PSG YI SGD+ G +RIWDTTQK+H+LK EY  I G I DI+WS D+ ++ + G+GRE F  V   D+G+ VG ++G  +  IN +D K TRPFR+ T SED  V F EGPPFKFK  +   +NF NC+ Y+P+GD F++  AD K+ ++DGK G  + E+ +P    AH GGIY ++++ D   +++A GDK  K+W I E +     +  GS ++D Q+GC W+GD ++SVSLSGNI+     D      P  +I GH K I+A++ SS   K+ S+  DG+I++W   NG+  Y     H N I  + +  +E+ +  + D +  T L ++   DD +   SQP++     D L+ VA  ++  +++  N + +  + V YEP+  ++   +  + VG +   +++YK+  D      L E T ++  +    D  +S +G  L    SDRK+  F+   +            + W  H  +++ +A + DS  +AS SLD +I I     P  K +I+ AHP S++TS+ W D  TL S G D  ++ W ++
Sbjct:    1 MSATLKATYGSLPKVTRGKFTVLKGDPKGKTFLYTNNKSVFIRDVEDFAKCDVYTDHAKDTTVAAYAPSGNYICSGDITGNVRIWDTTQKDHLLKYEYPCIGGAIKDIAWSPDSKRIVVVGEGRESFAKVFLWDSGSTVGNLNGSHSATINCVDYKPTRPFRICTGSEDRTVGFHEGPPFKFKHLNSEPTNFVNCIGYAPSGDFFIAGSADGKLCLYDGKEGNLVAEIVDPALKKAHSGGIYGLSWSDDSKFILTASGDKSCKIWNI-EDKSLQTVFEMGSNLEDQQLGCLWMGDNLLSVSLSGNINYL---DRNNPSTPSRIIKGHYKNISAVAASSSHKKIYSASFDGRIVSW-AENGQGSYFKGKGHENHIPFMQVVGDELVTCSLQDEMRFTPLDTEEYGDDKISFDSQPKRFGAGKDGLLIVAFEQQHHVVIVRNKKVVHTVKVPYEPTSASVHIGQDEVAVGSKRGDVYIYKLDQD-----TLEEKTQISGEKQEVIDLAYSPDGGWLAVA-SDRKIFCFQKIDYKE-------ITKDFWT-HNAKITSIAWSQDSKHIASSSLDTNIRISCPNNPKAKNLIEAAHPKSSVTSVAWYDNDTLVSVGHDCCVRLWNIS 604          
BLAST of WD repeat-containing protein 1 vs. Ensembl Nematostella
Match: EDO29288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T426])

HSP 1 Score: 70.8626 bits (172), Expect = 7.554e-14
Identity = 53/192 (27.60%), Postives = 83/192 (43.23%), Query Frame = 3
Query:  723 FVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNN--EVFSVGVDDRLVITDLLSKTMKDDLK 1292
            F FD    E    +G   H G ++A++ + D   L+S   DK +++W +      V        V D+Q  C   G    S S      L+  D     ++P  +  GH   +  ++F    N + +  SD  +  WDI  G +  L    H   +QS+A S N   + S GVD RL++ DL   T+  +LK
Sbjct:    5 FCFDRTASESRRLVG---HSGPVFAVSIDHDNKFLLSCSEDKTIRLWSLFTFTTLVAYRGHNYPVWDVQF-CP-RGHYFASTSHDRTARLWSTDH----QQPLRIFAGHVSDVNKVAFHPNCNYIATGSSDRTVRLWDIQTGSSVRLFTG-HKAAVQSLAFSRNGRHLISSGVDTRLLVWDLAEGTLVAELK 186          

HSP 2 Score: 50.447 bits (119), Expect = 6.223e-7
Identity = 32/102 (31.37%), Postives = 50/102 (49.02%), Query Frame = 3
Query:  567 LATSSEDGVVAFLE---GPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVW 863
            +AT S D  V   +   G   +  T H+        L +S NG   +S+G D ++ V+D   G  + EL    H   +Y++ F+ DG+ L SAG D  +K+W
Sbjct:  120 IATGSSDRTVRLWDIQTGSSVRLFTGHKAA---VQSLAFSRNGRHLISSGVDTRLLVWDLAEGTLVAEL--KGHTDTVYSLCFSRDGTILASAGLDNCIKLW 216          
BLAST of WD repeat-containing protein 1 vs. Ensembl Nematostella
Match: EDO45346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA6])

HSP 1 Score: 67.781 bits (164), Expect = 4.898e-12
Identity = 65/303 (21.45%), Postives = 125/303 (41.25%), Query Frame = 3
Query:  252 HSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEY 1160
            H    T   ++P+   + +G M+  + IW    K H+    +      I  + +S     +A   + +     V +V   + V         + ++D  S     L T+S+D  +        KF  +   H N+  C ++SP+G + VS   D  I ++D  + + +    +P   G + ++ F+  G+ + + G D  +KVW I   +           V+ +    +  G+ ++S S    + +    DL++G   Y  + GHQ P T++ FS       S  SD +++ W     K +Y
Sbjct:   17 HRDTVTSVDFNPNMKQLVTGSMDSSLMIWHF--KPHMRAYRFVGHKDAILSVKFSPSGHLIASASRDKTVRLWVPSVKGESTV--FKAHTATVRSVDF-SGDGQSLLTASDDKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVHTFYDPG--GFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQAHTGAVNSVSFHPS--GNYLVSASSDTTLKIL---DLMEGRLFY-TLHGHQGPATSVVFSRNGEYFASGSSDEQVMVWKTNFDKVDY 306          
BLAST of WD repeat-containing protein 1 vs. Ensembl Nematostella
Match: EDO33060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST98])

HSP 1 Score: 67.781 bits (164), Expect = 7.025e-12
Identity = 51/191 (26.70%), Postives = 83/191 (43.46%), Query Frame = 3
Query:  726 VFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNN--EVFSVGVDDRLVITDLLSKTMKDDLK 1292
            + D +T  +   L    H G ++A++ + D   L+S   DK +++W +      V        V D+Q  C   G    S S      L+  D     ++P  +  GH   +  ++F    N + +  SD  +  WDI  G +  L    H   +QS+A S N   + S GVD RL++ DL   T+  +LK
Sbjct:  331 IMDDRTASESRRL--VGHSGPVFAVSIDHDNKFLLSCSEDKTIRLWSLFTFTTLVAYRGHNYPVWDVQF-CPR-GHYFASTSHDRTARLWSTDH----QQPLRIFAGHVSDVNVIAFHPNCNYIATGSSDRTVRLWDIQTGSSVRLFTG-HKAAVQSLAFSRNGRHLISSGVDTRLLVWDLAEGTLVAELK 512          
BLAST of WD repeat-containing protein 1 vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 65.4698 bits (158), Expect = 2.341e-11
Identity = 62/250 (24.80%), Postives = 114/250 (45.60%), Query Frame = 3
Query:  549 STRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWI-----GDTVISVSLSGNISLFKFDDLIKGEKPYEVILGH--QKPITALSFS-SGLNKLVSSDSDGKILTWDI--------INGKAE-YLCKNVH--SNQIQSIALSNNEVFSVGVDD 1241
            ST    L ++S+D  +   +    K     + HSN+  C  ++P  ++ VS   D  + ++D KTG+ L+ L  PAH   + A+ FN DG+ ++S+  D + ++W     +         + +DD     +++     G  +++ +L   + L+   D  KG K  +   GH  +K     +FS +G   +VS   D K+  W++        ++G ++  LC   H   N I S AL N++   +   D
Sbjct:  116 STDSRHLVSASDDKTLKIWDFATGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL--PAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQ------CLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLW---DYSKG-KCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIWNLQSKEVVQKLDGHSDVVLCCACHPTENIIASGALENDKTIKIWKSD 353          

HSP 2 Score: 62.7734 bits (151), Expect = 1.769e-10
Identity = 50/185 (27.03%), Postives = 85/185 (45.95%), Query Frame = 3
Query:  612 PPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFV-----GEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGK 1151
            P ++ K     H+   + +++S NG+   S+ AD  I ++    G+  + +    HK GI  +A++ D  HL+SA  DK LK+W     +          YVF          C +   + + VS S + S+  +D  +K  K  + +  H  P+TA+ F+     +VSS  DG    WD  +G+
Sbjct:   53 PNYQLKYTLTGHNKAVSSVKFSHNGEWLASSSADKVIKIWGAYDGKFEKTI--TGHKLGISDVAWSTDSRHLVSASDDKTLKIWDFATGKCLKTLKGHSNYVF---------CCNFNPQSNLIVSGSFDESVRIWD--VKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQ 224          
BLAST of WD repeat-containing protein 1 vs. Ensembl Medaka
Match: WDR1 (WD repeat domain 1 [Source:NCBI gene;Acc:101166294])

HSP 1 Score: 465.692 bits (1197), Expect = 2.189e-156
Identity = 260/620 (41.94%), Postives = 370/620 (59.68%), Query Frame = 3
Query:   84 LSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEEL-GNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSF--SSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIAL-SNNEVFSVGVDDRLVITDLLSK--TMKDDLKLTSQPRKVSVVDSLVAVACYKEIMLANNTEPL-TLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTP---RDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVT 1913
            +  EL    A+LP+ ERG   V+G DPK  NFLYTNG  VIIRNID+   +DIYT+H+ +  VAKY+PSGFYIASGD +GKIRIWDTTQKEH+LK EY PISGKI DI+W+ D+ ++A+ G GREKFGAV   D+G++VGE+SG +K IN++D++  RP+RLA +S+D   +F EGPPFKFK   + HS F NC+R+SP+G+ F +AGAD +IF++DG TGE +  L G  AH GGIYA++++ D S LISA GDK +K+W +      V  +  GS V D Q+GC W  D ++S+SLSG I+     D     +P   + GH K I  L+     G + + S   DG I  WD   G+ +      HSNQ+  +   + NE+ S  +DD L  T L  K  +  D +K+  QP+ VSV   +    C  +++L  + + L TL  + YE    AL P+ TT  VGG + KI +Y I  +    TL  E   L       D  +SN+G+ L   D  + ++ + V     G S+     NE +  H   VS +A + D+   A+G +D  + +W++  P  +  + +AH + +++SL W D HTL +   D++IK W +T
Sbjct:    1 MPYELKHVFASLPQMERGVAKVIGGDPKGNNFLYTNGKCVIIRNIDNPAIADIYTEHAHQVGVAKYAPSGFYIASGDASGKIRIWDTTQKEHMLKYEYTPISGKIKDIAWTEDSKRIAVVGDGREKFGAVFLWDSGSSVGELSGHSKLINSVDIRQKRPYRLAAASDDTCGSFFEGPPFKFKFTLRDHSQFVNCVRFSPDGNRFATAGADGQIFLYDGTTGESVGTLGGEKAHGGGIYALSWSPDSSQLISASGDKTVKLWDVGAGTA-VTTFNLGSDVTDQQLGCLWQKDHLLSISLSGYINYL---DKNNPNRPIRTVKGHSKSIQCLTVHKKDGRSFVYSGSHDGHINYWDAETGQNDCFSGKGHSNQVSKMVTNAANELVSCSMDDTLRYTKLDKKEYSASDVVKMDFQPKSVSVAGGISLAVCIGQVVLLKDKKKLFTLDNLGYEAEVGALHPSGTTAAVGGTDGKIRLYSIQGN----TLKDEGKTLEAKGPITDMAYSNDGAYLAVIDEKKAITAYSV---PDGYSV----KNEFYGHHAKPVS-LAWSPDNEHFATGGMDMMVYVWTLSDPDRRIKLADAHRLHHVSSLAWIDEHTLATTSHDASIKLWTIT 604          
BLAST of WD repeat-containing protein 1 vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 69.3218 bits (168), Expect = 2.499e-12
Identity = 60/245 (24.49%), Postives = 102/245 (41.63%), Query Frame = 3
Query:  252 HSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGK---ICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITE-------------PRGFV-----GEYVFGSTVDD 923
            H+   +  K+SPSG ++AS   +  I+IW     +       + ISG    I D++WSSD+  L       +K   + +V++G          KC+  L                                 + HSN+  C  ++P  ++ VS   D  + ++D KTG+ L+ L  PAH   + A+ FN DGS ++S+  D + ++W                 P  FV     G+Y+  +T+D+
Sbjct:   44 HTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKF-----EKTISGHKLGISDVAWSSDSNLLV--SASDDKTLKIWDVNSG----------KCLKTL---------------------------------KGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL--PAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDN 236          

HSP 2 Score: 61.6178 bits (148), Expect = 8.434e-10
Identity = 50/189 (26.46%), Postives = 88/189 (46.56%), Query Frame = 3
Query:  612 PPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFV---FDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFV-----GEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKA 1154
            P +  K     H+   + +++SP+G+   S+ AD  I +   +DGK  + +       HK GI  +A++ D + L+SA  DK LK+W +   +          YVF          C +   + + VS S + S+  +D  +K  K  + +  H  P++A+ F+   + +VSS  DG    WD  +G+ 
Sbjct:   33 PNYSLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTIS-----GHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVF---------CCNFNPQSNLIVSGSFDESVRIWD--VKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQC 205          
BLAST of WD repeat-containing protein 1 vs. Ensembl Medaka
Match: nle1 (notchless homolog 1 [Source:NCBI gene;Acc:101155788])

HSP 1 Score: 68.9366 bits (167), Expect = 6.363e-12
Identity = 83/383 (21.67%), Postives = 154/383 (40.21%), Query Frame = 3
Query:  777 HKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSS-GLNK----LVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKDDLKLTSQPRKVSVVDSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWT-DAHTLFSAGQDSNIKQWK 1907
            H   + + AF+  G +L S  GD  ++ W ++           G T   + +  +  G  + S   +  I L+   D + G +  + + GH K IT L +    LN     L S+  DG +  WD   G+ + +    H+  +  +    + +      DR V         KD ++  +       V++L     Y  ++     EP            +    N   LV G ++F +F++  A D + L  ++  + L    + +FS +  LL     D+ V   K+    +G  +++       + H G V  VA + DS L+ SGS D ++ +W V+    K  I        + ++ W+ D   + S G+D  ++ W+
Sbjct:  105 HTEAVISTAFSPTGKYLASGSGDTTVRFWDLSTETPH--HTARGHTHWVLSIAWSPDGKKLASGCKNSQICLW---DPVTGAQIGKTLTGHTKWITWLCWEPLHLNPECRYLASTSKDGSVRIWDTALGRCDKILTG-HTQSVTCVKWGGDGLLYTSSHDRTVKV----WRAKDGVQCRTLQGHAHWVNTLALSTDY--VLRTGAFEPSPARTPLQHSGFVPQGSNPERLVSGSDDFTLFLWNPAADKKPLARMTGHSALVN--EVLFSPDTRLLASASFDKSV---KIWDGRTGKYLMSL------RGHVGSVYQVAWSADSRLLVSGSSDSTLKVWDVK--TGKLSIDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIWR 462          

HSP 2 Score: 66.6254 bits (161), Expect = 3.548e-11
Identity = 58/226 (25.66%), Postives = 91/226 (40.27%), Query Frame = 3
Query:  285 PSGFYIASGDMNGKIRIWDTT--QKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDL---------------------------KSTRPFRLATSSEDGVVAFLEGPPFKFK--TNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQI 869
            P   Y+AS   +G +RIWDT   + + IL    Q ++   C + W  D     +     ++   V     G     + G A  +N L L                           + + P RL + S+D  + FL  P    K       HS   N + +SP+  +  SA  D  + ++DG+TG+ L  L    H G +Y +A++ D   L+S   D  LKVW +
Sbjct:  206 PECRYLASTSKDGSVRIWDTALGRCDKILTGHTQSVT---C-VKWGGDGL---LYTSSHDRTVKVWRAKDGVQCRTLQGHAHWVNTLALSTDYVLRTGAFEPSPARTPLQHSGFVPQGSNPERLVSGSDDFTL-FLWNPAADKKPLARMTGHSALVNEVLFSPDTRLLASASFDKSVKIWDGRTGKYLMSLRG--HVGSVYQVAWSADSRLLVSGSSDSTLKVWDV 421          

HSP 3 Score: 62.7734 bits (151), Expect = 6.943e-10
Identity = 89/370 (24.05%), Postives = 151/370 (40.81%), Query Frame = 3
Query:  252 HSSKATVAKYSPSGFYIASGDMNGKIRIWD--TTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGE-ISGMAK-----CINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCK-NVHSNQIQSIALSNNE--VFSVGVDDRLVITDLLSKTMKDDLKLTSQPRKVSVVD 1328
            H+       +SP+G Y+ASG  +  +R WD  T    H  +         +  I+WS D  KLA G +  +    + +  TG  +G+ ++G  K     C   L L     + LA++S+DG V   +    +       H+    C+++  +G ++ S+  D  + V+  K G Q   L   AH   +  +A + D  +++  G  +        +  GFV +   GS  + +             VS S + +LF ++     +KP   + GH   +  + FS     L S+  D  +  WD   GK  YL     H   +  +A S +   + S   D  L + D+  KT K  + L     +V  VD
Sbjct:  105 HTEAVISTAFSPTGKYLASGSGDTTVRFWDLSTETPHHTARGHTH----WVLSIAWSPDGKKLASGCKNSQI--CLWDPVTGAQIGKTLTGHTKWITWLCWEPLHLNPECRY-LASTSKDGSVRIWDTALGRCDKILTGHTQSVTCVKWGGDGLLYTSS-HDRTVKVWRAKDGVQCRTLQGHAH--WVNTLALSTD--YVLRTGAFEPSPARTPLQHSGFVPQ---GSNPERL-------------VSGSDDFTLFLWNPAAD-KKPLARMTGHSALVNEVLFSPDTRLLASASFDKSVKIWDGRTGK--YLMSLRGHVGSVYQVAWSADSRLLVSGSSDSTLKVWDV--KTGKLSIDLPGHADEVYAVD 441          
BLAST of WD repeat-containing protein 1 vs. Ensembl Medaka
Match: prpf4 (pre-mRNA processing factor 4 [Source:NCBI gene;Acc:101174721])

HSP 1 Score: 65.855 bits (159), Expect = 8.121e-11
Identity = 57/207 (27.54%), Postives = 93/207 (44.93%), Query Frame = 3
Query:  252 HSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGA---DAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVW 863
            HS + +   + PSG ++ +   +   R+WD   +E IL  E    S  + D+S+  D + +A GG   + FG V ++ TG  V  + G  K I +L   S     LAT S D      E    K       H N  + +R+ P    F+  GA    AK++   G T   L+ L    H+G + ++  + DG  + ++  D+  K+W
Sbjct:  305 HSDRVSRVAWHPSGRFLGTTCYDNSWRLWDLEVQEEILHQEGH--SKGVHDLSFHPDGSLVATGGL--DSFGRVWDLRTGRCVVFLEGHLKEIYSLHF-SPNGHHLATGSGDNTCKVWELRNRKCLYTVPAHQNLLSTVRFQPTDGHFLLTGAYDNTAKVWSHPGWT--PLKTLA--GHEGKVMSVDVSPDGKLIATSSYDRTFKLW 502          
BLAST of WD repeat-containing protein 1 vs. Ensembl Medaka
Match: prpf4 (pre-mRNA processing factor 4 [Source:NCBI gene;Acc:101174721])

HSP 1 Score: 65.855 bits (159), Expect = 8.121e-11
Identity = 57/207 (27.54%), Postives = 93/207 (44.93%), Query Frame = 3
Query:  252 HSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGA---DAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVW 863
            HS + +   + PSG ++ +   +   R+WD   +E IL  E    S  + D+S+  D + +A GG   + FG V ++ TG  V  + G  K I +L   S     LAT S D      E    K       H N  + +R+ P    F+  GA    AK++   G T   L+ L    H+G + ++  + DG  + ++  D+  K+W
Sbjct:  305 HSDRVSRVAWHPSGRFLGTTCYDNSWRLWDLEVQEEILHQEGH--SKGVHDLSFHPDGSLVATGGL--DSFGRVWDLRTGRCVVFLEGHLKEIYSLHF-SPNGHHLATGSGDNTCKVWELRNRKCLYTVPAHQNLLSTVRFQPTDGHFLLTGAYDNTAKVWSHPGWT--PLKTLA--GHEGKVMSVDVSPDGKLIATSSYDRTFKLW 502          
BLAST of WD repeat-containing protein 1 vs. Planmine SMEST
Match: SMESG000001249.1 (SMESG000001249.1)

HSP 1 Score: 1257.66 bits (3253), Expect = 0.000e+0
Identity = 610/613 (99.51%), Postives = 612/613 (99.84%), Query Frame = 3
Query:   81 MLSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKDDLKLTSQPRKVSVVDSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAGQDSNIKQWKVTVK 1919
            MLSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCH+NFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDI+NGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKDDLKLTSQPRKVSVVDSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTD HTLFSAGQDSNIKQWKVTVK
Sbjct:    1 MLSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHTNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIVNGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMKDDLKLTSQPRKVSVVDSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLALSPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGSLLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDSTLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDVHTLFSAGQDSNIKQWKVTVK 613          
BLAST of WD repeat-containing protein 1 vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.032e-11
Identity = 68/304 (22.37%), Postives = 128/304 (42.11%), Query Frame = 3
Query:  252 HSSKATVAKYSPSGFYIASGDMNGKIRIWD----------TTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTW 1133
            H  K T   ++P+   +ASG ++  + IW+             ++ IL  ++ P +G++   +      +L +     E    V    T T           + ++D+ S     + T S+D  +   +    KF  +   H N+  C+R+S +G +  S+  D  I ++D    E +       H G + ++AF+ +GS++ S G D  + +W I   +         S V+ +    +  G+ +IS   S + S  K  DL++G   Y  + GH+ PI   +FS       S  +D ++  W
Sbjct:   13 HKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSP-TGQLVASASRDKTVRLWVPSIKGESL--VFRAHTAT-----------VRSVDI-SCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQE--HGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPS--GNFLIS---SSDDSSMKIYDLLEGRLLY-TVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 293          
BLAST of WD repeat-containing protein 1 vs. Planmine SMEST
Match: SMESG000006229.1 (SMESG000006229.1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.888e-10
Identity = 72/285 (25.26%), Postives = 113/285 (39.65%), Query Frame = 3
Query:  360 ILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCI-NNLDLKSTRPFRLATSSEDGVVAFLE---GPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLV---SSDSDGKIL---TWDIINGKAEYLCKNVHSN 1184
            I+ C++ P +  +   SWS D     + G  ++              G  + M+  + N L   S     LATS  DG V         P  F   H+ H    + L + P+G    +  +D    ++D   GE++  L    H   +Y I F+ DGS ++S G D   +VW +   R     Y      D I +   W  D    ++     +  K  DL   +  Y  I  HQ  ++A+ F  GL++ +   S D   KI    TW  I    E+  K +HS+
Sbjct:  168 IVHCQFSPNNKYLATASWSGDCKIFDVPGMEQKIVFK----------GHKTKMSAVVWNPLSTISDTSIDLATSDHDGCVKLWSLSSQEPVGFVEGHEPHR--VSKLDFHPSGRFLATTCSDYSWRLWDLTVGEEI--LHQEGHSKEVYDINFHPDGSLILSGGFDSFGRVWDLRSGRCI---YFLEGHSDKI-LSAVW-SDNGCHMATGSADNTAKIWDLRYKQCIY-TIPAHQSSVSAVKFQPGLSQFILTTSYDHKTKIWAHPTWTPIKEMTEHTEKIMHSD 432          
BLAST of WD repeat-containing protein 1 vs. Planmine SMEST
Match: SMESG000008519.1 (SMESG000008519.1)

HSP 1 Score: 56.225 bits (134), Expect = 1.379e-8
Identity = 46/196 (23.47%), Postives = 89/196 (45.41%), Query Frame = 3
Query:  630 TNHQCHSNFANCLRY--SPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDI-QVGCTWIGDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDIINGKAEYLCKNVHSNQIQSIALS 1208
            +N Q H+     L++  + NG   ++   D  + ++D   G ++ +L    H   I A  FN DG+++ +A  DK +K+W +    G    +      D++  V    +G  V S      + L+   D     KP  +  GH+  ++ ++F+     L+S+ +D    TW+   GK   + +  H+++I S A +
Sbjct:   17 SNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQL--IGHDAEISAAVFNFDGTYVATASMDKSIKIWDL--RMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDF---SKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEG-HTDEIFSCAFN 204          

HSP 2 Score: 55.0694 bits (131), Expect = 3.016e-8
Identity = 53/224 (23.66%), Postives = 90/224 (40.18%), Query Frame = 3
Query:  195 NSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQ 866
            ++VI+ ++ + R       H ++ + A ++  G Y+A+  M+  I+IWD       L                        + G   E    V++V T  NVG+    A   N + L   + F                P F FK     H    + + ++P G V +SA AD     ++  TG+ ++ L    H   I++ AFN DGS +I+   D   ++WQ
Sbjct:   47 HTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDL----------------------FTLAGHTDE----VLDV-TFDNVGKQVASAGADNTVRLWDVKDF--------------SKPSFIFK----GHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVL--EGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 223          
BLAST of WD repeat-containing protein 1 vs. Planmine SMEST
Match: SMESG000045329.1 (SMESG000045329.1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.844e-8
Identity = 85/367 (23.16%), Postives = 144/367 (39.24%), Query Frame = 3
Query:  108 LATLPRT-----ERGQFIVLG---SDPKNKNFLYTNGNSVIIRNIDDLRDSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQPISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCINNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFK-TNHQCHSNFANC-LRYSPNGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLISAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVG-----------CTWI--GDTVISVSLSGNISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILTWDI 1139
            +A  PRT     ER +F   G   S P+  N L  N                + + H  +    K++P G ++AS   + +I +W+T      L       +G I D+ +SSD+  +       +K   + +   G  V +  G    +N++   S       + S+D  +   +    + K T H   +  +   + YSP GD   S G +  I  +D +  + ++      H   I ++A + DG+ L+S   D  L+VW  T P      +V G     + VG           C W   G  V   S   N+ ++   D+  G+  Y+ + GH   +   +F      L+S  SD KI   +I
Sbjct:   18 MAKRPRTDVVVTERREFYSAGDISSIPRTSNLLAPNL---------------LLSGHKGEVFCGKFAPEGSFLASAGHDREIILWNTYGDIKDLAV-LSGHNGAILDLQFSSDSDWIYTAST--DKTVMIWDTRVGERVKKFKGHTSIVNSVSAVSHTRELFCSGSDDCKIRLWDK---RVKNTTHTIDAKHSVLDVAYSPFGDYIFSGGIENVINQWDVREMKIIQTFA--GHTDSITSVAVSNDGNFLLSNSVDNTLRVWD-TRP------FVRGERCTKLMVGHLHNFEKNLLRCAWSVDGKRVTCGSADKNVYVW---DMYTGQIMYK-LPGHVGSVNETAFHPHEPILLSVSSDTKIFMGEI 350          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR18.923e-15840.45WD repeat domain 1 [Source:HGNC Symbol;Acc:HGNC:12... [more]
WDR18.923e-15840.45WD repeat domain 1 [Source:HGNC Symbol;Acc:HGNC:12... [more]
WDR11.664e-9656.38WD repeat domain 1 [Source:HGNC Symbol;Acc:HGNC:12... [more]
WDR12.553e-7032.19WD repeat domain 1 [Source:HGNC Symbol;Acc:HGNC:12... [more]
WDR12.553e-7032.19WD repeat domain 1 [Source:HGNC Symbol;Acc:HGNC:12... [more]
back to top
BLAST of WD repeat-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aipl-15.689e-14240.29AIP1 (Actin Interacting Protein 1) Like [Source:U... [more]
aipl-15.689e-14240.29AIP1 (Actin Interacting Protein 1) Like [Source:U... [more]
unc-789.477e-14139.21Actin-interacting protein 1 [Source:UniProtKB/Swi... [more]
unc-789.477e-14139.21Actin-interacting protein 1 [Source:UniProtKB/Swi... [more]
snrp-40.21.554e-1228.19Small Nuclear RibonucleoProtein homolog [Source:U... [more]
back to top
BLAST of WD repeat-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flr0.000e+047.60gene:FBgn0260049 transcript:FBtr0075845[more]
flr0.000e+047.60gene:FBgn0260049 transcript:FBtr0075846[more]
Poc12.011e-1321.55gene:FBgn0036354 transcript:FBtr0321318[more]
Poc14.266e-1321.55gene:FBgn0036354 transcript:FBtr0075863[more]
wds3.056e-1223.01gene:FBgn0040066 transcript:FBtr0308566[more]
back to top
BLAST of WD repeat-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR19.772e-11134.23WD repeat domain 1 [Source:HGNC Symbol;Acc:HGNC:12... [more]
wdr55.448e-1224.49WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
apaf18.787e-1221.60apoptotic peptidase activating factor 1 [Source:NC... [more]
poc1b1.671e-1122.10POC1 centriolar protein B [Source:NCBI gene;Acc:38... [more]
poc1b3.079e-1126.42POC1 centriolar protein B [Source:NCBI gene;Acc:38... [more]
back to top
BLAST of WD repeat-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr12.752e-15240.00WD repeat domain 1 [Source:NCBI gene;Acc:448473][more]
wdr13.494e-15139.94WD repeat domain 1 [Source:NCBI gene;Acc:448473][more]
wdr16.942e-15140.06WD repeat domain 1 [Source:NCBI gene;Acc:448473][more]
wdr11.004e-13537.70WD repeat domain 1 [Source:NCBI gene;Acc:448473][more]
ngfr5.720e-1322.03nerve growth factor receptor [Source:Xenbase;Acc:X... [more]
back to top
BLAST of WD repeat-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr13.692e-15941.19WD repeat domain 1 [Source:MGI Symbol;Acc:MGI:1337... [more]
Wdr17.269e-4130.00WD repeat domain 1 [Source:MGI Symbol;Acc:MGI:1337... [more]
Poc1b2.631e-1422.22POC1 centriolar protein B [Source:MGI Symbol;Acc:M... [more]
Poc1b5.878e-1422.45POC1 centriolar protein B [Source:MGI Symbol;Acc:M... [more]
Poc1b6.186e-1422.45POC1 centriolar protein B [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of WD repeat-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VU68|WDR1_DROME0.000e+047.60Actin-interacting protein 1 OS=Drosophila melanoga... [more]
sp|O88342|WDR1_MOUSE2.582e-15841.19WD repeat-containing protein 1 OS=Mus musculus OX=... [more]
sp|Q5RKI0|WDR1_RAT3.004e-15841.19WD repeat-containing protein 1 OS=Rattus norvegicu... [more]
sp|Q9W7F2|WDR1A_XENLA6.060e-15841.45WD repeat-containing protein 1-A OS=Xenopus laevis... [more]
sp|O75083|WDR1_HUMAN4.285e-15740.45WD repeat-containing protein 1 OS=Homo sapiens OX=... [more]
back to top
BLAST of WD repeat-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0C9RAF60.000e+047.06Flr_0 protein OS=Fopius arisanus OX=64838 GN=flr_0... [more]
A0A1I9WL820.000e+047.85Seminal fluid protein OS=Nilaparvata lugens OX=108... [more]
A0A1A9WBM80.000e+047.60WD_REPEATS_REGION domain-containing protein OS=Glo... [more]
A0A1I8PCM90.000e+047.93WD_REPEATS_REGION domain-containing protein OS=Sto... [more]
A0A0L0CQH90.000e+048.26Actin-interacting protein 1 OS=Lucilia cuprina OX=... [more]
back to top
BLAST of WD repeat-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR14.369e-15441.48WD repeat domain 1 [Source:NCBI gene;Acc:103036333... [more]
poc1a2.993e-1423.78POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
POC1B4.239e-1421.90POC1 centriolar protein homolog B [Source:NCBI gen... [more]
poc1a4.373e-1423.73POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
POC1B5.215e-1422.26POC1 centriolar protein homolog B [Source:NCBI gen... [more]
back to top
BLAST of WD repeat-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR11.110e-16141.09WD repeat domain 1 [Source:HGNC Symbol;Acc:HGNC:12... [more]
ENSPMAT00000003168.13.780e-15840.13pep scaffold:Pmarinus_7.0:GL476396:632759:655100:1... [more]
POC1A1.640e-1526.56POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
snrnp401.806e-922.94small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
ENSPMAT00000004242.12.543e-923.46pep scaffold:Pmarinus_7.0:GL482741:5889:16850:1 ge... [more]
back to top
BLAST of WD repeat-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AIP11.893e-6829.91Actin cortical patch component; interacts with the... [more]
PWP21.710e-1025.11Conserved 90S pre-ribosomal component; essential f... [more]
PRP43.422e-1024.39Splicing factor; component of the U4/U6-U5 snRNP c... [more]
RSA49.134e-1023.10WD-repeat protein involved in ribosome biogenesis;... [more]
SIF21.427e-924.36WD40 repeat-containing subunit of Set3C histone de... [more]
back to top
BLAST of WD repeat-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO432095.069e-13737.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292887.554e-1427.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453464.898e-1221.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330607.025e-1226.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332972.341e-1124.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR12.189e-15641.94WD repeat domain 1 [Source:NCBI gene;Acc:101166294... [more]
wdr52.499e-1224.49WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
nle16.363e-1221.67notchless homolog 1 [Source:NCBI gene;Acc:10115578... [more]
prpf48.121e-1127.54pre-mRNA processing factor 4 [Source:NCBI gene;Acc... [more]
prpf48.121e-1127.54pre-mRNA processing factor 4 [Source:NCBI gene;Acc... [more]
back to top
BLAST of WD repeat-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001249.10.000e+099.51SMESG000001249.1[more]
SMESG000024482.11.032e-1122.37SMESG000024482.1[more]
SMESG000006229.12.888e-1025.26SMESG000006229.1[more]
SMESG000008519.11.379e-823.47SMESG000008519.1[more]
SMESG000045329.11.844e-823.16SMESG000045329.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030860 ID=SMED30030860|Name=WD repeat-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2058bp
ATTTTCATAATAGTCATATCCTAATACTTTTATTTGAATTATTAATTAAA
TTTAAAATTTTAATACGGAATTAAGTAAGAATGCTTTCCTGTGAATTGTT
ACAAACTTTAGCTACTTTACCTCGAACTGAAAGAGGTCAATTTATTGTTT
TAGGATCTGATCCTAAAAATAAGAATTTTCTCTATACAAACGGAAATAGT
GTTATAATAAGAAATATTGATGATTTAAGAGATAGTGATATTTATACTCA
ACATAGTTCTAAAGCCACGGTCGCCAAATATTCACCATCTGGATTTTATA
TTGCATCTGGAGATATGAATGGTAAAATTAGAATTTGGGATACAACTCAA
AAGGAGCACATATTAAAATGCGAATATCAACCAATTTCGGGAAAAATTTG
TGACATATCATGGTCGTCGGACAACACAAAGTTAGCAATAGGTGGCCAAG
GACGGGAAAAATTCGGGGCTGTAATTAATGTCGATACCGGCACAAATGTT
GGTGAAATTAGTGGAATGGCAAAATGCATCAATAATCTTGATTTGAAATC
CACTCGACCTTTTCGCTTGGCTACAAGTTCCGAGGACGGAGTGGTTGCGT
TCTTAGAAGGACCTCCGTTTAAATTTAAAACCAATCATCAATGTCACTCA
AACTTTGCTAACTGTTTAAGATATTCACCGAATGGTGATGTGTTTGTGTC
TGCAGGCGCTGATGCGAAGATATTTGTGTTTGATGGGAAAACTGGTGAAC
AACTAGAAGAATTGGGTAATCCCGCTCATAAAGGTGGAATTTATGCTATT
GCATTTAATGGTGATGGTAGTCACTTAATTTCCGCCGGTGGCGACAAAGT
TCTGAAAGTTTGGCAAATTACTGAACCCCGAGGTTTTGTCGGTGAATATG
TCTTTGGTTCAACTGTCGATGATATTCAAGTTGGATGCACCTGGATTGGG
GACACGGTTATATCGGTTTCTCTTAGTGGAAATATATCTCTTTTTAAATT
TGATGATTTGATAAAGGGTGAAAAACCTTATGAAGTCATTTTGGGTCATC
AAAAGCCAATTACAGCTTTGTCGTTTTCATCAGGATTGAATAAGTTAGTC
TCGAGTGATTCTGACGGCAAAATACTAACGTGGGACATTATAAATGGAAA
AGCTGAGTATCTATGCAAAAACGTTCACTCGAATCAAATTCAAAGTATAG
CACTATCAAACAATGAAGTTTTCAGTGTTGGAGTTGATGATCGATTGGTT
ATCACGGATTTACTGTCCAAAACTATGAAGGATGATCTGAAATTAACTTC
TCAGCCACGAAAAGTCTCAGTTGTAGATTCATTGGTAGCGGTTGCCTGCT
ATAAAGAGATAATGTTGGCCAATAATACTGAACCATTGACTTTGCTGCCC
GTCTCATATGAACCTTCGTGTTTAGCTCTTAGTCCGAACAAAACGACTCT
AGTTGTTGGCGGAGAGGAGTTCAAGATCTTTGTTTATAAAATAGCCAATG
ATTATCGTTCTTTGACTTTGTTGTCTGAATTCACTCTTCTCAATACTCCA
CGTGATTTCATGTTCTCTAACAACGGTTCATTACTGGTTTGCGGAGATTC
TGATAGAAAAGTTTCTCTTTTCAAAGTTGGCCAATTCGATAGCGGGGATT
CAATCTTGACGCCCTATCATAATGAGCATTGGAAATTTCACACTGGGAGA
GTCAGTTGTGTTGCAATTAATACCGATTCAACTTTAGTGGCTTCTGGATC
ACTGGACTGTTCAATTATTATCTGGAGCGTGGAGCAACCGGCTAATAAAT
TTATTATTAAAAATGCTCACCCAATGAGTAATATTACTAGCCTTGTATGG
ACTGACGCTCATACTCTGTTTTCTGCTGGCCAGGATTCGAATATTAAGCA
ATGGAAAGTCACGGTCAAATAAGAATGATTTTGTTTATTCAAACTCCTTC
ACCTTGATTTCCGTTTTATCAATTAATAAATTTAGATAACTTTTCAATTT
ATAATGGGCTTTTCATTTATTAATTTTCTATCCGAAATATATGTTATGAG
AAAAAAAA
back to top

protein sequence of SMED30030860-orf-1

>SMED30030860-orf-1 ID=SMED30030860-orf-1|Name=SMED30030860-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=614bp
MLSCELLQTLATLPRTERGQFIVLGSDPKNKNFLYTNGNSVIIRNIDDLR
DSDIYTQHSSKATVAKYSPSGFYIASGDMNGKIRIWDTTQKEHILKCEYQ
PISGKICDISWSSDNTKLAIGGQGREKFGAVINVDTGTNVGEISGMAKCI
NNLDLKSTRPFRLATSSEDGVVAFLEGPPFKFKTNHQCHSNFANCLRYSP
NGDVFVSAGADAKIFVFDGKTGEQLEELGNPAHKGGIYAIAFNGDGSHLI
SAGGDKVLKVWQITEPRGFVGEYVFGSTVDDIQVGCTWIGDTVISVSLSG
NISLFKFDDLIKGEKPYEVILGHQKPITALSFSSGLNKLVSSDSDGKILT
WDIINGKAEYLCKNVHSNQIQSIALSNNEVFSVGVDDRLVITDLLSKTMK
DDLKLTSQPRKVSVVDSLVAVACYKEIMLANNTEPLTLLPVSYEPSCLAL
SPNKTTLVVGGEEFKIFVYKIANDYRSLTLLSEFTLLNTPRDFMFSNNGS
LLVCGDSDRKVSLFKVGQFDSGDSILTPYHNEHWKFHTGRVSCVAINTDS
TLVASGSLDCSIIIWSVEQPANKFIIKNAHPMSNITSLVWTDAHTLFSAG
QDSNIKQWKVTVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005884actin filament
GO:0005886plasma membrane
GO:0016020membrane
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0030864cortical actin cytoskeleton
GO:0042643actomyosin, actin portion
Vocabulary: biological process
TermDefinition
GO:0030043actin filament fragmentation
GO:0001736establishment of planar polarity
GO:0006909phagocytosis
GO:0007275multicellular organism development
GO:0007298border follicle cell migration
GO:0030042actin filament depolymerization
GO:0030833regulation of actin filament polymerization
GO:0030834regulation of actin filament depolymerization
GO:0030836positive regulation of actin filament depolymerization
GO:0034316negative regulation of Arp2/3 complex-mediated actin nucleation
GO:0035317imaginal disc-derived wing hair organization
GO:0045214sarcomere organization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
IPR011047Quinoprotein_ADH-like_supfam
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
GO:0003779actin binding
GO:0051015actin filament binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 477..515
e-value: 4.6
score: 12.8
coord: 136..176
e-value: 19.0
score: 8.9
coord: 313..352
e-value: 6.3E-5
score: 32.4
coord: 432..470
e-value: 5.5
score: 12.3
coord: 48..87
e-value: 3.1E-4
score: 30.1
coord: 179..218
e-value: 2.8E-5
score: 33.5
coord: 527..566
e-value: 1.6E-5
score: 34.4
coord: 221..262
e-value: 2.8E-7
score: 40.2
coord: 569..609
e-value: 1.7
score: 15.6
coord: 355..393
e-value: 76.0
score: 5.1
IPR001680WD40 repeatPFAMPF00400WD40coord: 533..566
e-value: 3.5E-4
score: 21.3
coord: 54..87
e-value: 0.0038
score: 18.0
coord: 232..261
e-value: 5.5E-4
score: 20.7
coord: 321..352
e-value: 0.012
score: 16.5
coord: 187..218
e-value: 0.081
score: 13.8
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 55..96
score: 12.714
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 186..227
score: 10.007
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 534..568
score: 11.077
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 230..263
score: 12.547
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 320..361
score: 12.681
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 12..323
e-value: 5.5E-203
score: 677.8
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 11..609
e-value: 5.5E-203
score: 677.8
NoneNo IPR availablePANTHERPTHR19856WD-REPEATCONTAINING PROTEIN WDR1coord: 3..611
NoneNo IPR availableCDDcd00200WD40coord: 58..352
e-value: 1.05062E-41
score: 150.563
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 339..353
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 74..88
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 55..613
score: 32.087
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 443..611
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 52..475