Afadin

Overview
NameAfadin
Smed IDSMED30030845
Length (bp)5803
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Afadin (SMED30030845) t-SNE clustered cells

Violin plots show distribution of expression levels for Afadin (SMED30030845) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Afadin (SMED30030845) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Afadin (SMED30030845) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030845

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30030845h1SMcG0002326 Contig45547newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030845h1SMcG0002326 Contig45547uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30030845h1SMcG0002326 dd_Smed_v4_7215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030845h1SMcG0002326 dd_Smed_v4_7215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030845h1SMcG0002326 dd_Smed_v4_7215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030845h1SMcG0002326 dd_Smed_v4_7215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30030845h1SMcG0002326 dd_Smed_v4_7215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30030845h1SMcG0002326 dd_Smed_v4_7215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30030845h1SMcG0002326 dd_Smed_v4_7215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030845h1SMcG0002326 dd_Smed_v4_7215_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30030845h1SMcG0002326 dd_Smed_v4_7215_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Afadin vs. Ensembl Human
Match: AFDN (afadin, adherens junction formation factor [Source:HGNC Symbol;Acc:HGNC:7137])

HSP 1 Score: 286.189 bits (731), Expect = 3.946e-77
Identity = 193/547 (35.28%), Postives = 290/547 (53.02%), Query Frame = 3
Query:   51 GPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSG--AVEGSKFIKIGSQQSAVGSYP----NILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +R++  +E PL+VQLNW  DD++G+F+LKNE+      D        + G  K      + N       R+ S              L     +     + ++ +  R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  D A+  +AE L+KYGL +E+ + Y + +  +PP       +  +EIIL D +CPL I    P  +G     ++RR P D +P K +         L  K+P    R D S    Y + +  +  +P LV+LS     +               N   Y  G  + +  K  ++    + VG+      +I L   + P I+P HC ++        VV  T+TP ++D+ +        Y+  Q++ ++T L+    +Q G + +F+F
Sbjct:    4 GGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNEN------DAIPPKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPP-DHIPKKTKK-------HLEGKTPKGKERADGS---GYGSTLPPEK-LPYLVELSPGRRNHF-----------AYYNYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKLDDNSIQL---FGPGIQPHHCDLTN----MDGVV--TVTPRSMDAET--------YVEGQRISETTMLQSGMKVQFGASHVFKF 499          

HSP 2 Score: 157.532 bits (397), Expect = 1.305e-37
Identity = 106/316 (33.54%), Postives = 155/316 (49.05%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKR---DLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  L            +   V  ++N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+D    D  +N+       L R             I  +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++LG ++ W+E  GL++AA+CH+ ++ Q T L+  DK    D+      C +   LN  QL  LL N  C   E  +P   IE VV  +    D+
Sbjct:  630 FKLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLD----DPEENS-------LQRPK-----------IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFK---LNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADE 912          

HSP 3 Score: 76.2554 bits (186), Expect = 6.129e-13
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK  N +GLSI+AAK +  D   IY+K V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct: 1009 TVTLKK-QNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1112          
BLAST of Afadin vs. Ensembl Human
Match: AFDN (afadin, adherens junction formation factor [Source:HGNC Symbol;Acc:HGNC:7137])

HSP 1 Score: 286.189 bits (731), Expect = 4.390e-77
Identity = 193/547 (35.28%), Postives = 290/547 (53.02%), Query Frame = 3
Query:   51 GPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSG--AVEGSKFIKIGSQQSAVGSYP----NILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +R++  +E PL+VQLNW  DD++G+F+LKNE+      D        + G  K      + N       R+ S              L     +     + ++ +  R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  D A+  +AE L+KYGL +E+ + Y + +  +PP       +  +EIIL D +CPL I    P  +G     ++RR P D +P K +         L  K+P    R D S    Y + +  +  +P LV+LS     +               N   Y  G  + +  K  ++    + VG+      +I L   + P I+P HC ++        VV  T+TP ++D+ +        Y+  Q++ ++T L+    +Q G + +F+F
Sbjct:    4 GGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNEN------DAIPPKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPP-DHIPKKTKK-------HLEGKTPKGKERADGS---GYGSTLPPEK-LPYLVELSPGRRNHF-----------AYYNYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKLDDNSIQL---FGPGIQPHHCDLTN----MDGVV--TVTPRSMDAET--------YVEGQRISETTMLQSGMKVQFGASHVFKF 499          

HSP 2 Score: 157.147 bits (396), Expect = 1.399e-37
Identity = 106/316 (33.54%), Postives = 155/316 (49.05%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKR---DLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  L            +   V  ++N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+D    D  +N+       L R             I  +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++LG ++ W+E  GL++AA+CH+ ++ Q T L+  DK    D+      C +   LN  QL  LL N  C   E  +P   IE VV  +    D+
Sbjct:  630 FKLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLD----DPEENS-------LQRPK-----------IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFK---LNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADE 912          

HSP 3 Score: 76.2554 bits (186), Expect = 6.767e-13
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK  N +GLSI+AAK +  D   IY+K V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct: 1009 TVTLKK-QNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1112          
BLAST of Afadin vs. Ensembl Human
Match: AFDN (afadin, adherens junction formation factor [Source:HGNC Symbol;Acc:HGNC:7137])

HSP 1 Score: 285.804 bits (730), Expect = 6.723e-77
Identity = 193/547 (35.28%), Postives = 290/547 (53.02%), Query Frame = 3
Query:   51 GPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS---GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSG--AVEGSKFIKIGSQQSAVGSYP----NILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +R++  +E PL+VQLNW  DD++G+F+LKNE+      D        + G  K      + N       R+ S              L     +     + ++ +  R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  D A+  +AE L+KYGL +E+ + Y + +  +PP       +  +EIIL D +CPL I    P  +G     ++RR P D +P K +         L  K+P    R D S    Y + +  +  +P LV+LS     +               N   Y  G  + +  K  ++    + VG+      +I L   + P I+P HC ++        VV  T+TP ++D+ +        Y+  Q++ ++T L+    +Q G + +F+F
Sbjct:    4 GGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNEN------DAIPPKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPP-DHIPKKTKK-------HLEGKTPKGKERADGS---GYGSTLPPEK-LPYLVELSPGRRNHF-----------AYYNYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKLDDNSIQL---FGPGIQPHHCDLTN----MDGVV--TVTPRSMDAET--------YVEGQRISETTMLQSGMKVQFGASHVFKF 499          

HSP 2 Score: 152.525 bits (384), Expect = 4.118e-36
Identity = 107/324 (33.02%), Postives = 157/324 (48.46%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLGK-------------------DQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKR---DLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  L                     ++ VS +  +I Q ++QV Q  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+D    D  +N+       L R             I  +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++LG ++ W+E  GL++AA+CH+ ++ Q T L+  DK    D+      C +   LN  QL  LL N  C   E  +P   IE VV  +    D+
Sbjct:  630 FKLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVI-QEVDQVDQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLD----DPEENS-------LQRPK-----------IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFK---LNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADE 919          

HSP 3 Score: 76.2554 bits (186), Expect = 7.166e-13
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK  N +GLSI+AAK +  D   IY+K V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct: 1016 TVTLKK-QNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1119          
BLAST of Afadin vs. Ensembl Human
Match: AFDN (afadin, adherens junction formation factor [Source:HGNC Symbol;Acc:HGNC:7137])

HSP 1 Score: 285.804 bits (730), Expect = 7.968e-77
Identity = 193/547 (35.28%), Postives = 290/547 (53.02%), Query Frame = 3
Query:   51 GPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS---GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSG--AVEGSKFIKIGSQQSAVGSYP----NILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +R++  +E PL+VQLNW  DD++G+F+LKNE+      D        + G  K      + N       R+ S              L     +     + ++ +  R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  D A+  +AE L+KYGL +E+ + Y + +  +PP       +  +EIIL D +CPL I    P  +G     ++RR P D +P K +         L  K+P    R D S    Y + +  +  +P LV+LS     +               N   Y  G  + +  K  ++    + VG+      +I L   + P I+P HC ++        VV  T+TP ++D+ +        Y+  Q++ ++T L+    +Q G + +F+F
Sbjct:    4 GGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNEN------DAIPPKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPP-DHIPKKTKK-------HLEGKTPKGKERADGS---GYGSTLPPEK-LPYLVELSPGRRNHF-----------AYYNYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKLDDNSIQL---FGPGIQPHHCDLTN----MDGVV--TVTPRSMDAET--------YVEGQRISETTMLQSGMKVQFGASHVFKF 499          

HSP 2 Score: 157.532 bits (397), Expect = 1.204e-37
Identity = 106/316 (33.54%), Postives = 155/316 (49.05%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKR---DLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  L            +   V  ++N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+D    D  +N+       L R             I  +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++LG ++ W+E  GL++AA+CH+ ++ Q T L+  DK    D+      C +   LN  QL  LL N  C   E  +P   IE VV  +    D+
Sbjct:  630 FKLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLD----DPEENS-------LQRPK-----------IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFK---LNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADE 912          

HSP 3 Score: 76.2554 bits (186), Expect = 7.789e-13
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK  N +GLSI+AAK +  D   IY+K V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct: 1009 TVTLKK-QNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1112          
BLAST of Afadin vs. Ensembl Human
Match: AFDN (afadin, adherens junction formation factor [Source:HGNC Symbol;Acc:HGNC:7137])

HSP 1 Score: 284.263 bits (726), Expect = 2.103e-76
Identity = 194/547 (35.47%), Postives = 291/547 (53.20%), Query Frame = 3
Query:   51 GPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS---GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSG--AVEGSKFIKIGSQQSAVGSYP----NILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +R++  +E PL+VQLNW  DD++G+F+LKNE+      D       +N G  K      + N       R+ S              L     +     + ++ +  R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  D A+  +AE L+KYGL +E+ + Y + +  +PP       +  +EIIL D +CPL I    P  +G     ++RR P D +P K +         L  K+P    R D S    Y + +  +  +P LV+LS     +               N   Y  G  + +  K  ++    + VG+      +I L   + P I+P HC ++        VV  T+TP ++D+ +        Y+  Q++ ++T L+    +Q G + +F+F
Sbjct:    4 GGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNEN------DAIPPKAQSN-GPEKQEKEGVIQNFK-----RTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPP-DHIPKKTKK-------HLEGKTPKGKERADGS---GYGSTLPPEK-LPYLVELSPGRRNHF-----------AYYNYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKLDDNSIQL---FGPGIQPHHCDLTN----MDGVV--TVTPRSMDAET--------YVEGQRISETTMLQSGMKVQFGASHVFKF 498          

HSP 2 Score: 157.532 bits (397), Expect = 1.219e-37
Identity = 106/316 (33.54%), Postives = 155/316 (49.05%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKR---DLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  L            +   V  ++N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+D    D  +N+       L R             I  +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++LG ++ W+E  GL++AA+CH+ ++ Q T L+  DK    D+      C +   LN  QL  LL N  C   E  +P   IE VV  +    D+
Sbjct:  629 FKLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLD----DPEENS-------LQRPK-----------IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFK---LNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADE 911          

HSP 3 Score: 76.2554 bits (186), Expect = 7.290e-13
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK  N +GLSI+AAK +  D   IY+K V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct: 1008 TVTLKK-QNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1111          
BLAST of Afadin vs. Ensembl Celegans
Match: afd-1 (AFaDin (Actin filament binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:X5M8U5])

HSP 1 Score: 140.198 bits (352), Expect = 7.790e-33
Identity = 65/124 (52.42%), Postives = 92/124 (74.19%), Query Frame = 3
Query:   66 ERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNES 434
            ER +L   +++WN NRLDLF +S P E LE  GVMRF++Q    K  TKC+RVSSTATT+ +++A+  KF PD+KML+ND Y+L+E H N ++RK+ D E PL+VQL W  DD++G+F+LK ++
Sbjct:    4 EREQLACLVQQWNENRLDLFHLSYPTEDLEVEGVMRFYFQDGGEKVLTKCVRVSSTATTRAVVDALSEKFLPDLKMLSNDTYSLWEVHENGEERKLLDEEKPLVVQLQWHKDDREGRFLLKKDA 127          

HSP 2 Score: 99.7525 bits (247), Expect = 1.672e-20
Identity = 82/288 (28.47%), Postives = 135/288 (46.88%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLGKDQHVS-NLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAF----SILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCE--DVELP 2756
            FRL+PAY  YL LRS    ++  S    + I  N +Q+ Q+  +S +  +FWL+N+SE  HL++ D +L+    S    ++  IE+ F    ++LQ+       ++ PA     D  LND+                   D    + HLL T      +   C +N ALTIQ+   L H++N ++FNS++       S +L    ++   G+ L  R+  +  + E  G+++AA CH+ +  Q   L+   K D+   G  C +   LN  Q+  +L   E  D E+P
Sbjct:  584 FRLSPAYSLYLALRSFHTHNKPYSVQFFSRIESNFKQIAQE-CSSKDDLIFWLANASEFNHLVERDTELK---ASRYGKISVEIERIFRRLVAVLQS-------VIRPAARALLDIHLNDH-------------------DATGDVIHLLDTTMRQARI---CGLNAALTIQLCGHLLHMVNAFVFNSLV-------SVNLPAAQLNTRLGKCLQYRIESIHRFCERMGVEMAAECHLDRSRQAANLLATQKNDVAALGSTCYK---LNSLQVVHILSGFEPDDGEIP 828          

HSP 3 Score: 94.3597 bits (233), Expect = 8.789e-19
Identity = 96/343 (27.99%), Postives = 163/343 (47.52%), Query Frame = 3
Query:  690 PESSFTRTISNPDEVMKRRRQRKLESRLEQFSGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPE--EI---ILHDQDCPLGILVHNP--PKRGTATIAVRRRTPMD-KLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSS 1694
            P ++FTRTISNP+ VM++RR++KLE++L++       GG+LK+YG  I P  PY ++L  +N+ A+++L   L+KYGL      F +LV+ +    ND  R  M +  EI    +   +CPL  +       + G  +    +R P D ++PS   + P S+ + ++  + + P             +I N   +P L+ +  +N+G+            LS + +    G  E    +   SQ S    + NI L     PDIR  H  I+        VV  TLTP+        +   + +N  ++ ++  LRD D I+IG +  F+F     ++  ++S
Sbjct:  185 PFNTFTRTISNPEAVMRKRREKKLETKLKEMM----FGGSLKVYGGEIVPTRPYVSILAEINENADRILGAALEKYGLEHSKDDF-ILVEVS----NDDDRKSMSDLREIDGRPIPPTECPLFEMTARSGNGENGFDSFLAIKRKPHDYQVPSTSVVAPSSVTLPMSPLTSLPP-------------QIHN---LPVLIVM--NNDGH------------LSTHRITLHEGVTE----VGSDSQMSNFSQH-NIYLD---GPDIRGRHAAIAF----MEGVV--TLTPST-------RDAYLEVNGHQLMQTEILRDGDHIRIGADHSFKFSTSSSQANQINS 467          

HSP 4 Score: 64.3142 bits (155), Expect = 1.234e-9
Identity = 37/100 (37.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKS 3647
            V L+K    +GLSI+AA+   +    IY+K V+        G++ETGDQL++V+G  L  I+QE+A   M ++   V+  + K AA R+G + N L S++
Sbjct:  973 VTLRKNGGGIGLSIVAAQGVGDRQMGIYVKKVVEGTPAAHDGRLETGDQLLSVNGHSLIGISQEDAARLMTQSGNEVHFDVRKRAAHRNG-LSNWLGSQT 1071          
BLAST of Afadin vs. Ensembl Celegans
Match: afd-1 (AFaDin (Actin filament binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:X5M8U5])

HSP 1 Score: 140.198 bits (352), Expect = 8.542e-33
Identity = 65/124 (52.42%), Postives = 92/124 (74.19%), Query Frame = 3
Query:   66 ERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNES 434
            ER +L   +++WN NRLDLF +S P E LE  GVMRF++Q    K  TKC+RVSSTATT+ +++A+  KF PD+KML+ND Y+L+E H N ++RK+ D E PL+VQL W  DD++G+F+LK ++
Sbjct:    4 EREQLACLVQQWNENRLDLFHLSYPTEDLEVEGVMRFYFQDGGEKVLTKCVRVSSTATTRAVVDALSEKFLPDLKMLSNDTYSLWEVHENGEERKLLDEEKPLVVQLQWHKDDREGRFLLKKDA 127          

HSP 2 Score: 99.7525 bits (247), Expect = 1.865e-20
Identity = 82/288 (28.47%), Postives = 135/288 (46.88%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLGKDQHVS-NLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAF----SILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCE--DVELP 2756
            FRL+PAY  YL LRS    ++  S    + I  N +Q+ Q+  +S +  +FWL+N+SE  HL++ D +L+    S    ++  IE+ F    ++LQ+       ++ PA     D  LND+                   D    + HLL T      +   C +N ALTIQ+   L H++N ++FNS++       S +L    ++   G+ L  R+  +  + E  G+++AA CH+ +  Q   L+   K D+   G  C +   LN  Q+  +L   E  D E+P
Sbjct:  582 FRLSPAYSLYLALRSFHTHNKPYSVQFFSRIESNFKQIAQE-CSSKDDLIFWLANASEFNHLVERDTELK---ASRYGKISVEIERIFRRLVAVLQS-------VIRPAARALLDIHLNDH-------------------DATGDVIHLLDTTMRQARI---CGLNAALTIQLCGHLLHMVNAFVFNSLV-------SVNLPAAQLNTRLGKCLQYRIESIHRFCERMGVEMAAECHLDRSRQAANLLATQKNDVAALGSTCYK---LNSLQVVHILSGFEPDDGEIP 826          

HSP 3 Score: 93.9745 bits (232), Expect = 1.058e-18
Identity = 96/343 (27.99%), Postives = 163/343 (47.52%), Query Frame = 3
Query:  690 PESSFTRTISNPDEVMKRRRQRKLESRLEQFSGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPE--EI---ILHDQDCPLGILVHNP--PKRGTATIAVRRRTPMD-KLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSS 1694
            P ++FTRTISNP+ VM++RR++KLE++L++       GG+LK+YG  I P  PY ++L  +N+ A+++L   L+KYGL      F +LV+ +    ND  R  M +  EI    +   +CPL  +       + G  +    +R P D ++PS   + P S+ + ++  + + P             +I N   +P L+ +  +N+G+            LS + +    G  E    +   SQ S    + NI L     PDIR  H  I+        VV  TLTP+        +   + +N  ++ ++  LRD D I+IG +  F+F     ++  ++S
Sbjct:  183 PFNTFTRTISNPEAVMRKRREKKLETKLKEMM----FGGSLKVYGGEIVPTRPYVSILAEINENADRILGAALEKYGLEHSKDDF-ILVEVS----NDDDRKSMSDLREIDGRPIPPTECPLFEMTARSGNGENGFDSFLAIKRKPHDYQVPSTSVVAPSSVTLPMSPLTSLPP-------------QIHN---LPVLIVM--NNDGH------------LSTHRITLHEGVTE----VGSDSQMSNFSQH-NIYLD---GPDIRGRHAAIAF----MEGVV--TLTPST-------RDAYLEVNGHQLMQTEILRDGDHIRIGADHSFKFSTSSSQANQINS 465          

HSP 4 Score: 63.929 bits (154), Expect = 1.343e-9
Identity = 37/100 (37.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKS 3647
            V L+K    +GLSI+AA+   +    IY+K V+        G++ETGDQL++V+G  L  I+QE+A   M ++   V+  + K AA R+G + N L S++
Sbjct:  971 VTLRKNGGGIGLSIVAAQGVGDRQMGIYVKKVVEGTPAAHDGRLETGDQLLSVNGHSLIGISQEDAARLMTQSGNEVHFDVRKRAAHRNG-LSNWLGSQT 1069          
BLAST of Afadin vs. Ensembl Celegans
Match: afd-1 (AFaDin (Actin filament binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:X5M8U5])

HSP 1 Score: 140.198 bits (352), Expect = 9.182e-33
Identity = 65/124 (52.42%), Postives = 92/124 (74.19%), Query Frame = 3
Query:   66 ERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNES 434
            ER +L   +++WN NRLDLF +S P E LE  GVMRF++Q    K  TKC+RVSSTATT+ +++A+  KF PD+KML+ND Y+L+E H N ++RK+ D E PL+VQL W  DD++G+F+LK ++
Sbjct:    4 EREQLACLVQQWNENRLDLFHLSYPTEDLEVEGVMRFYFQDGGEKVLTKCVRVSSTATTRAVVDALSEKFLPDLKMLSNDTYSLWEVHENGEERKLLDEEKPLVVQLQWHKDDREGRFLLKKDA 127          

HSP 2 Score: 99.7525 bits (247), Expect = 2.002e-20
Identity = 82/288 (28.47%), Postives = 135/288 (46.88%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLGKDQHVS-NLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAF----SILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCE--DVELP 2756
            FRL+PAY  YL LRS    ++  S    + I  N +Q+ Q+  +S +  +FWL+N+SE  HL++ D +L+    S    ++  IE+ F    ++LQ+       ++ PA     D  LND+                   D    + HLL T      +   C +N ALTIQ+   L H++N ++FNS++       S +L    ++   G+ L  R+  +  + E  G+++AA CH+ +  Q   L+   K D+   G  C +   LN  Q+  +L   E  D E+P
Sbjct:  584 FRLSPAYSLYLALRSFHTHNKPYSVQFFSRIESNFKQIAQE-CSSKDDLIFWLANASEFNHLVERDTELK---ASRYGKISVEIERIFRRLVAVLQS-------VIRPAARALLDIHLNDH-------------------DATGDVIHLLDTTMRQARI---CGLNAALTIQLCGHLLHMVNAFVFNSLV-------SVNLPAAQLNTRLGKCLQYRIESIHRFCERMGVEMAAECHLDRSRQAANLLATQKNDVAALGSTCYK---LNSLQVVHILSGFEPDDGEIP 828          

HSP 3 Score: 94.3597 bits (233), Expect = 7.399e-19
Identity = 96/343 (27.99%), Postives = 163/343 (47.52%), Query Frame = 3
Query:  690 PESSFTRTISNPDEVMKRRRQRKLESRLEQFSGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPE--EI---ILHDQDCPLGILVHNP--PKRGTATIAVRRRTPMD-KLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSS 1694
            P ++FTRTISNP+ VM++RR++KLE++L++       GG+LK+YG  I P  PY ++L  +N+ A+++L   L+KYGL      F +LV+ +    ND  R  M +  EI    +   +CPL  +       + G  +    +R P D ++PS   + P S+ + ++  + + P             +I N   +P L+ +  +N+G+            LS + +    G  E    +   SQ S    + NI L     PDIR  H  I+        VV  TLTP+        +   + +N  ++ ++  LRD D I+IG +  F+F     ++  ++S
Sbjct:  185 PFNTFTRTISNPEAVMRKRREKKLETKLKEMM----FGGSLKVYGGEIVPTRPYVSILAEINENADRILGAALEKYGLEHSKDDF-ILVEVS----NDDDRKSMSDLREIDGRPIPPTECPLFEMTARSGNGENGFDSFLAIKRKPHDYQVPSTSVVAPSSVTLPMSPLTSLPP-------------QIHN---LPVLIVM--NNDGH------------LSTHRITLHEGVTE----VGSDSQMSNFSQH-NIYLD---GPDIRGRHAAIAF----MEGVV--TLTPST-------RDAYLEVNGHQLMQTEILRDGDHIRIGADHSFKFSTSSSQANQINS 467          

HSP 4 Score: 64.3142 bits (155), Expect = 1.190e-9
Identity = 37/100 (37.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKS 3647
            V L+K    +GLSI+AA+   +    IY+K V+        G++ETGDQL++V+G  L  I+QE+A   M ++   V+  + K AA R+G + N L S++
Sbjct:  973 VTLRKNGGGIGLSIVAAQGVGDRQMGIYVKKVVEGTPAAHDGRLETGDQLLSVNGHSLIGISQEDAARLMTQSGNEVHFDVRKRAAHRNG-LSNWLGSQT 1071          
BLAST of Afadin vs. Ensembl Celegans
Match: afd-1 (AFaDin (Actin filament binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:X5M8U5])

HSP 1 Score: 140.198 bits (352), Expect = 9.331e-33
Identity = 65/124 (52.42%), Postives = 92/124 (74.19%), Query Frame = 3
Query:   66 ERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNES 434
            ER +L   +++WN NRLDLF +S P E LE  GVMRF++Q    K  TKC+RVSSTATT+ +++A+  KF PD+KML+ND Y+L+E H N ++RK+ D E PL+VQL W  DD++G+F+LK ++
Sbjct:    4 EREQLACLVQQWNENRLDLFHLSYPTEDLEVEGVMRFYFQDGGEKVLTKCVRVSSTATTRAVVDALSEKFLPDLKMLSNDTYSLWEVHENGEERKLLDEEKPLVVQLQWHKDDREGRFLLKKDA 127          

HSP 2 Score: 99.7525 bits (247), Expect = 1.886e-20
Identity = 82/288 (28.47%), Postives = 135/288 (46.88%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLGKDQHVS-NLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAF----SILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCE--DVELP 2756
            FRL+PAY  YL LRS    ++  S    + I  N +Q+ Q+  +S +  +FWL+N+SE  HL++ D +L+    S    ++  IE+ F    ++LQ+       ++ PA     D  LND+                   D    + HLL T      +   C +N ALTIQ+   L H++N ++FNS++       S +L    ++   G+ L  R+  +  + E  G+++AA CH+ +  Q   L+   K D+   G  C +   LN  Q+  +L   E  D E+P
Sbjct:  582 FRLSPAYSLYLALRSFHTHNKPYSVQFFSRIESNFKQIAQE-CSSKDDLIFWLANASEFNHLVERDTELK---ASRYGKISVEIERIFRRLVAVLQS-------VIRPAARALLDIHLNDH-------------------DATGDVIHLLDTTMRQARI---CGLNAALTIQLCGHLLHMVNAFVFNSLV-------SVNLPAAQLNTRLGKCLQYRIESIHRFCERMGVEMAAECHLDRSRQAANLLATQKNDVAALGSTCYK---LNSLQVVHILSGFEPDDGEIP 826          

HSP 3 Score: 94.7449 bits (234), Expect = 6.798e-19
Identity = 96/343 (27.99%), Postives = 163/343 (47.52%), Query Frame = 3
Query:  690 PESSFTRTISNPDEVMKRRRQRKLESRLEQFSGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPE--EI---ILHDQDCPLGILVHNP--PKRGTATIAVRRRTPMD-KLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSS 1694
            P ++FTRTISNP+ VM++RR++KLE++L++       GG+LK+YG  I P  PY ++L  +N+ A+++L   L+KYGL      F +LV+ +    ND  R  M +  EI    +   +CPL  +       + G  +    +R P D ++PS   + P S+ + ++  + + P             +I N   +P L+ +  +N+G+            LS + +    G  E    +   SQ S    + NI L     PDIR  H  I+        VV  TLTP+        +   + +N  ++ ++  LRD D I+IG +  F+F     ++  ++S
Sbjct:  183 PFNTFTRTISNPEAVMRKRREKKLETKLKEMM----FGGSLKVYGGEIVPTRPYVSILAEINENADRILGAALEKYGLEHSKDDF-ILVEVS----NDDDRKSMSDLREIDGRPIPPTECPLFEMTARSGNGENGFDSFLAIKRKPHDYQVPSTSVVAPSSVTLPMSPLTSLPP-------------QIHN---LPVLIVM--NNDGH------------LSTHRITLHEGVTE----VGSDSQMSNFSQH-NIYLD---GPDIRGRHAAIAF----MEGVV--TLTPST-------RDAYLEVNGHQLMQTEILRDGDHIRIGADHSFKFSTSSSQANQINS 465          

HSP 4 Score: 64.3142 bits (155), Expect = 1.210e-9
Identity = 37/100 (37.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKS 3647
            V L+K    +GLSI+AA+   +    IY+K V+        G++ETGDQL++V+G  L  I+QE+A   M ++   V+  + K AA R+G + N L S++
Sbjct:  971 VTLRKNGGGIGLSIVAAQGVGDRQMGIYVKKVVEGTPAAHDGRLETGDQLLSVNGHSLIGISQEDAARLMTQSGNEVHFDVRKRAAHRNG-LSNWLGSQT 1069          
BLAST of Afadin vs. Ensembl Celegans
Match: afd-1 (AFaDin (Actin filament binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:X5M8U5])

HSP 1 Score: 100.523 bits (249), Expect = 8.383e-21
Identity = 82/288 (28.47%), Postives = 135/288 (46.88%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLGKDQHVS-NLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAF----SILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCE--DVELP 2756
            FRL+PAY  YL LRS    ++  S    + I  N +Q+ Q+  +S +  +FWL+N+SE  HL++ D +L+    S    ++  IE+ F    ++LQ+       ++ PA     D  LND+                   D    + HLL T      +   C +N ALTIQ+   L H++N ++FNS++       S +L    ++   G+ L  R+  +  + E  G+++AA CH+ +  Q   L+   K D+   G  C +   LN  Q+  +L   E  D E+P
Sbjct:  176 FRLSPAYSLYLALRSFHTHNKPYSVQFFSRIESNFKQIAQE-CSSKDDLIFWLANASEFNHLVERDTELK---ASRYGKISVEIERIFRRLVAVLQS-------VIRPAARALLDIHLNDH-------------------DATGDVIHLLDTTMRQARI---CGLNAALTIQLCGHLLHMVNAFVFNSLV-------SVNLPAAQLNTRLGKCLQYRIESIHRFCERMGVEMAAECHLDRSRQAANLLATQKNDVAALGSTCYK---LNSLQVVHILSGFEPDDGEIP 420          

HSP 2 Score: 64.3142 bits (155), Expect = 8.919e-10
Identity = 37/100 (37.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKS 3647
            V L+K    +GLSI+AA+   +    IY+K V+        G++ETGDQL++V+G  L  I+QE+A   M ++   V+  + K AA R+G + N L S++
Sbjct:  565 VTLRKNGGGIGLSIVAAQGVGDRQMGIYVKKVVEGTPAAHDGRLETGDQLLSVNGHSLIGISQEDAARLMTQSGNEVHFDVRKRAAHRNG-LSNWLGSQT 663          
BLAST of Afadin vs. Ensembl Fly
Match: cno (gene:FBgn0259212 transcript:FBtr0334911)

HSP 1 Score: 393.275 bits (1009), Expect = 1.189e-110
Identity = 314/1007 (31.18%), Postives = 465/1007 (46.18%), Query Frame = 3
Query:   66 ERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGT--SSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS---GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSEL----------------------FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCEDVELPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCD--RGIVSCPKDLKTMLNAL 2963
            +R  + + I++WNANRLDLF +SEP+E L F+GVMRF++Q    K  TKC+RV+S AT  D+I+ ++ KF PDM+ML+   YALYE H N ++R++  +E PL+VQLNW  DD++G+F+LKN  ++    + T+   LN                     L S      G+     N     S       +      + +  +A +L  + PE+SFTR+ISNP+ VM+RRRQ+KLE +L+QF    G  +TGGTLKIYG+S+  D+PYKTLLLS+ D A+ V+ E L KYGL + D   Y LVQ N              E IL D +CPL IL+++P  RG+    VRRR P D  P +             KK P+              N I  D + P LV+++                           SG  +G + IK+GS    VGS     L + + P I+P HC IS             L   + + + +    L ++N   + + T L +  V+  G    +RF +     R    N+ L    S+  ++S  L              Y  S ++       S   A GGS    +   +P  P + E                       F+LAP Y  YL  R               +   ++  ++ +A  +  V+Q+         FW++NSSE LH L+ D  +  FS  AQ+VLA A++ AF  L   F  +L   L  F       L++N   D    L                  +L  L  A  L   C+VN ALTIQ+FSQLFH +N   FN+++ +S     D          WG+ +T RL  +++W+E  GL++AA+CH+ K++Q  + + A K  +    +       LN  Q+  LL   +  +LPR     +V+T+I++ +   +     + + + L E  +L L LLLP DG+SCD  RGI   P  L   LN L
Sbjct:    9 DREAVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIRVASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHIDDREGRFLLKNIDQKTTPIEQTD---LNFKRKLSKREKKEQKKKEKMAKLSSDPPTSNGSHLGLGNGVGASSGSAHMNGNAGGTGGDSSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKLEKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLEKADPLHYCLVQVN----------SDGTEYILDDDECPLSILMNHPTSRGSIMFHVRRR-PADSQPRR------------RKKKPLGAANG--------ANHISGDREGPVLVEVT--------------------------HSG--DGGRRIKLGSDPVEVGSANTNCLQL-FGPSIQPRHCLIS-------------LLEGVCTVTPLHTDALTFVNGHHISQPTILHNGSVVMFGRVASYRFLDSPTDGR---YNLAL----SQSQLDSACL--------------YERSPKMTG-----SGILAGGGSGSGDTQGQEPILPAVLEFPETHQELFLRHIISELDVNVPHFKLAPVYSLYLCARYRASTHYRPELQPTERAHKLTMFLHHVANLVYSVVQEQYTDPRILAFWMANSSEFLHFLKSDRHISAFSVQAQEVLAEAVQTAFRNLVNCFRLELSQTLNQF-------LSENIDHDSAAGL------------------VLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQMCTGD----------WGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACSCFRLNSLQMAALL---QQEKLPRN----LVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDDGFSCDVVRGI---PTGLVDFLNPL 868          

HSP 2 Score: 81.2629 bits (199), Expect = 9.970e-15
Identity = 39/91 (42.86%), Postives = 58/91 (63.74%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            ++L K +N +GLSI+AAK +  +   IYIK V+P GA    G+++ GDQL+ VDG  L  I QE A +++ +T P V+L + K  A  HG+
Sbjct:  913 IKLHKNSNGMGLSIVAAKGAGQEKLGIYIKSVVPGGAADADGRLQAGDQLLRVDGQSLIGITQERAADYLVRTGPVVSLEVAKQGAIYHGL 1003          
BLAST of Afadin vs. Ensembl Fly
Match: cno (gene:FBgn0259212 transcript:FBtr0299709)

HSP 1 Score: 381.719 bits (979), Expect = 5.295e-107
Identity = 303/974 (31.11%), Postives = 447/974 (45.89%), Query Frame = 3
Query:   66 ERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGT--SSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS---GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSELFRLAPAYMFYLLLRSSLGKDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCEDVELPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCD--RGIVSCPKDLKTMLNAL 2963
            +R  + + I++WNANRLDLF +SEP+E L F+GVMRF++Q    K  TKC+RV+S AT  D+I+ ++ KF PDM+ML+   YALYE H N ++R++  +E PL+VQLNW  DD++G+F+LKN  ++    + T+   LN                     L S      G+     N     S       +      + +  +A +L  + PE+SFTR+ISNP+ VM+RRRQ+KLE +L+QF    G  +TGGTLKIYG+S+  D+PYKTLLLS+ D A+ V+ E L KYGL + D   Y LVQ N              E IL D +CPL IL+++P  RG+    VRRR P D  P +             KK P+              N I  D + P LV+++                           SG  +G + IK+GS    VGS     L + + P I+P HC IS             L   + + + +    L ++N   + + T L +  V+  G    +RF                                   D P   +++  +S+  +D+     +  A    +           P L    R     MF            HV+NL       +  V+Q+         FW++NSSE LH L+ D  +  FS  AQ+VLA A++ AF  L   F  +L   L  F       L++N   D    L                  +L  L  A  L   C+VN ALTIQ+FSQLFH +N   FN+++ +S     D          WG+ +T RL  +++W+E  GL++AA+CH+ K++Q  + + A K  +    +       LN  Q+  LL   +  +LPR     +V+T+I++ +   +     + + + L E  +L L LLLP DG+SCD  RGI   P  L   LN L
Sbjct:    9 DREAVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIRVASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHIDDREGRFLLKNIDQKTTPIEQTD---LNFKRKLSKREKKEQKKKEKMAKLSSDPPTSNGSHLGLGNGVGASSGSAHMNGNAGGTGGDSSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKLEKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLEKADPLHYCLVQVN----------SDGTEYILDDDECPLSILMNHPTSRGSIMFHVRRR-PADSQPRR------------RKKKPLGAANG--------ANHISGDREGPVLVEVT--------------------------HSG--DGGRRIKLGSDPVEVGSANTNCLQL-FGPSIQPRHCLIS-------------LLEGVCTVTPLHTDALTFVNGHHISQPTILHNGSVVMFGRVASYRF----------------------------------LDSPTDGRYNLALSQSQLDSACLYERYRASTHYR-----------PELQPTERAHKLTMFL----------HHVANL-------VYSVVQEQYTDPRILAFWMANSSEFLHFLKSDRHISAFSVQAQEVLAEAVQTAFRNLVNCFRLELSQTLNQF-------LSENIDHDSAAGL------------------VLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQMCTGD----------WGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACSCFRLNSLQMAALL---QQEKLPRN----LVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDDGFSCDVVRGI---PTGLVDFLNPL 799          

HSP 2 Score: 81.2629 bits (199), Expect = 9.325e-15
Identity = 39/91 (42.86%), Postives = 58/91 (63.74%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            ++L K +N +GLSI+AAK +  +   IYIK V+P GA    G+++ GDQL+ VDG  L  I QE A +++ +T P V+L + K  A  HG+
Sbjct:  844 IKLHKNSNGMGLSIVAAKGAGQEKLGIYIKSVVPGGAADADGRLQAGDQLLRVDGQSLIGITQERAADYLVRTGPVVSLEVAKQGAIYHGL 934          
BLAST of Afadin vs. Ensembl Fly
Match: cno (gene:FBgn0259212 transcript:FBtr0300525)

HSP 1 Score: 278.1 bits (710), Expect = 1.086e-74
Identity = 189/537 (35.20%), Postives = 269/537 (50.09%), Query Frame = 3
Query:   66 ERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGT--SSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS---GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            +R  + + I++WNANRLDLF +SEP+E L F+GVMRF++Q    K  TKC+RV+S AT  D+I+ ++ KF PDM+ML+   YALYE H N ++R++  +E PL+VQLNW  DD++G+F+LKN  ++    + T+   LN                     L S      G+     N     S       +      + +  +A +L  + PE+SFTR+ISNP+ VM+RRRQ+KLE +L+QF    G  +TGGTLKIYG+S+  D+PYKTLLLS+ D A+ V+ E L KYGL + D   Y LVQ N              E IL D +CPL IL+++P  RG+    VRRR P D  P +             KK P+              N I  D + P LV+++                           SG  +G + IK+GS    VGS     L + + P I+P HC IS        V   T+TP       +    L ++N   + + T L +  V+  G    +RF
Sbjct:    9 DREAVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIRVASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHIDDREGRFLLKNIDQKTTPIEQTD---LNFKRKLSKREKKEQKKKEKMAKLSSDPPTSNGSHLGLGNGVGASSGSAHMNGNAGGTGGDSSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKLEKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLEKADPLHYCLVQVN----------SDGTEYILDDDECPLSILMNHPTSRGSIMFHVRRR-PADSQPRR------------RKKKPLGAANG--------ANHISGDREGPVLVEVT--------------------------HSG--DGGRRIKLGSDPVEVGSANTNCLQL-FGPSIQPRHCLISLL----EGVC--TVTP-------LHTDALTFVNGHHISQPTILHNGSVVMFGRVASYRF 469          

HSP 2 Score: 139.813 bits (351), Expect = 1.756e-32
Identity = 112/363 (30.85%), Postives = 171/363 (47.11%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCEDVELPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCD--RGIVSCPKDLKTMLNAL 2963
            F+LAP Y  YL  R               +   ++  ++ +A  +  V+Q+         FW++NSSE LH L+ D  +  FS  AQ+VLA A++ AF  L   F  +L   L  F       L++N   D    L                  +L  L  A  L   C+VN ALTIQ+FSQLFH +N   FN+++ +S     D          WG+ +T RL  +++W+E  GL++AA+CH+ K++Q  + + A K  +    +       LN  Q+  LL   +  +LPR     +V+T+I++ +   +     + + + L E  +L L LLLP DG+SCD  RGI   P  L   LN L
Sbjct:  651 FKLAPVYSLYLCARYRASTHYRPELQPTERAHKLTMFLHHVANLVYSVVQEQYTDPRILAFWMANSSEFLHFLKSDRHISAFSVQAQEVLAEAVQTAFRNLVNCFRLELSQTLNQF-------LSENIDHDSAAGL------------------VLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQMCTGD----------WGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACSCFRLNSLQMAALL---QQEKLPRN----LVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDDGFSCDVVRGI---PTGLVDFLNPL 968          

HSP 3 Score: 81.2629 bits (199), Expect = 9.107e-15
Identity = 39/91 (42.86%), Postives = 58/91 (63.74%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            ++L K +N +GLSI+AAK +  +   IYIK V+P GA    G+++ GDQL+ VDG  L  I QE A +++ +T P V+L + K  A  HG+
Sbjct: 1013 IKLHKNSNGMGLSIVAAKGAGQEKLGIYIKSVVPGGAADADGRLQAGDQLLRVDGQSLIGITQERAADYLVRTGPVVSLEVAKQGAIYHGL 1103          
BLAST of Afadin vs. Ensembl Fly
Match: cno (gene:FBgn0259212 transcript:FBtr0347363)

HSP 1 Score: 278.1 bits (710), Expect = 1.086e-74
Identity = 189/537 (35.20%), Postives = 269/537 (50.09%), Query Frame = 3
Query:   66 ERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGT--SSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS---GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            +R  + + I++WNANRLDLF +SEP+E L F+GVMRF++Q    K  TKC+RV+S AT  D+I+ ++ KF PDM+ML+   YALYE H N ++R++  +E PL+VQLNW  DD++G+F+LKN  ++    + T+   LN                     L S      G+     N     S       +      + +  +A +L  + PE+SFTR+ISNP+ VM+RRRQ+KLE +L+QF    G  +TGGTLKIYG+S+  D+PYKTLLLS+ D A+ V+ E L KYGL + D   Y LVQ N              E IL D +CPL IL+++P  RG+    VRRR P D  P +             KK P+              N I  D + P LV+++                           SG  +G + IK+GS    VGS     L + + P I+P HC IS        V   T+TP       +    L ++N   + + T L +  V+  G    +RF
Sbjct:    9 DREAVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIRVASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHIDDREGRFLLKNIDQKTTPIEQTD---LNFKRKLSKREKKEQKKKEKMAKLSSDPPTSNGSHLGLGNGVGASSGSAHMNGNAGGTGGDSSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKLEKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLEKADPLHYCLVQVN----------SDGTEYILDDDECPLSILMNHPTSRGSIMFHVRRR-PADSQPRR------------RKKKPLGAANG--------ANHISGDREGPVLVEVT--------------------------HSG--DGGRRIKLGSDPVEVGSANTNCLQL-FGPSIQPRHCLISLL----EGVC--TVTP-------LHTDALTFVNGHHISQPTILHNGSVVMFGRVASYRF 469          

HSP 2 Score: 139.813 bits (351), Expect = 1.756e-32
Identity = 112/363 (30.85%), Postives = 171/363 (47.11%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCEDVELPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCD--RGIVSCPKDLKTMLNAL 2963
            F+LAP Y  YL  R               +   ++  ++ +A  +  V+Q+         FW++NSSE LH L+ D  +  FS  AQ+VLA A++ AF  L   F  +L   L  F       L++N   D    L                  +L  L  A  L   C+VN ALTIQ+FSQLFH +N   FN+++ +S     D          WG+ +T RL  +++W+E  GL++AA+CH+ K++Q  + + A K  +    +       LN  Q+  LL   +  +LPR     +V+T+I++ +   +     + + + L E  +L L LLLP DG+SCD  RGI   P  L   LN L
Sbjct:  651 FKLAPVYSLYLCARYRASTHYRPELQPTERAHKLTMFLHHVANLVYSVVQEQYTDPRILAFWMANSSEFLHFLKSDRHISAFSVQAQEVLAEAVQTAFRNLVNCFRLELSQTLNQF-------LSENIDHDSAAGL------------------VLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQMCTGD----------WGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACSCFRLNSLQMAALL---QQEKLPRN----LVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDDGFSCDVVRGI---PTGLVDFLNPL 968          

HSP 3 Score: 81.2629 bits (199), Expect = 9.107e-15
Identity = 39/91 (42.86%), Postives = 58/91 (63.74%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            ++L K +N +GLSI+AAK +  +   IYIK V+P GA    G+++ GDQL+ VDG  L  I QE A +++ +T P V+L + K  A  HG+
Sbjct: 1013 IKLHKNSNGMGLSIVAAKGAGQEKLGIYIKSVVPGGAADADGRLQAGDQLLRVDGQSLIGITQERAADYLVRTGPVVSLEVAKQGAIYHGL 1103          
BLAST of Afadin vs. Ensembl Fly
Match: cno (gene:FBgn0259212 transcript:FBtr0299710)

HSP 1 Score: 277.715 bits (709), Expect = 1.186e-74
Identity = 189/537 (35.20%), Postives = 269/537 (50.09%), Query Frame = 3
Query:   66 ERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGT--SSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS---GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            +R  + + I++WNANRLDLF +SEP+E L F+GVMRF++Q    K  TKC+RV+S AT  D+I+ ++ KF PDM+ML+   YALYE H N ++R++  +E PL+VQLNW  DD++G+F+LKN  ++    + T+   LN                     L S      G+     N     S       +      + +  +A +L  + PE+SFTR+ISNP+ VM+RRRQ+KLE +L+QF    G  +TGGTLKIYG+S+  D+PYKTLLLS+ D A+ V+ E L KYGL + D   Y LVQ N              E IL D +CPL IL+++P  RG+    VRRR P D  P +             KK P+              N I  D + P LV+++                           SG  +G + IK+GS    VGS     L + + P I+P HC IS        V   T+TP       +    L ++N   + + T L +  V+  G    +RF
Sbjct:    9 DREAVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIRVASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHIDDREGRFLLKNIDQKTTPIEQTD---LNFKRKLSKREKKEQKKKEKMAKLSSDPPTSNGSHLGLGNGVGASSGSAHMNGNAGGTGGDSSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKLEKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLEKADPLHYCLVQVN----------SDGTEYILDDDECPLSILMNHPTSRGSIMFHVRRR-PADSQPRR------------RKKKPLGAANG--------ANHISGDREGPVLVEVT--------------------------HSG--DGGRRIKLGSDPVEVGSANTNCLQL-FGPSIQPRHCLISLL----EGVC--TVTP-------LHTDALTFVNGHHISQPTILHNGSVVMFGRVASYRF 469          

HSP 2 Score: 140.198 bits (352), Expect = 1.068e-32
Identity = 116/392 (29.59%), Postives = 179/392 (45.66%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCEDVELPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCD--RGIVSCPKDLKTMLNAL--HGLLSYKLNPPILNDVDTRWKSYLGSY 3044
            F+LAP Y  YL  R               +   ++  ++ +A  +  V+Q+         FW++NSSE LH L+ D  +  FS  AQ+VLA A++ AF  L   F  +L   L  F       L++N   D    L                  +L  L  A  L   C+VN ALTIQ+FSQLFH +N   FN+++ +S     D          WG+ +T RL  +++W+E  GL++AA+CH+ K++Q  + + A K  +    +       LN  Q+  LL   +  +LPR     +V+T+I++ +   +     + + + L E  +L L LLLP DG+SCD  RGI   P  L   LN L   G+      P  +      W  Y+  +
Sbjct:  651 FKLAPVYSLYLCARYRASTHYRPELQPTERAHKLTMFLHHVANLVYSVVQEQYTDPRILAFWMANSSEFLHFLKSDRHISAFSVQAQEVLAEAVQTAFRNLVNCFRLELSQTLNQF-------LSENIDHDSAAGL------------------VLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQMCTGD----------WGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACSCFRLNSLQMAALL---QQEKLPRN----LVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDDGFSCDVVRGI---PTGLVDFLNPLQQQGMCRLAAQPTSIG----LWTVYMHQF 993          

HSP 3 Score: 80.4925 bits (197), Expect = 1.520e-14
Identity = 39/91 (42.86%), Postives = 58/91 (63.74%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            ++L K +N +GLSI+AAK +  +   IYIK V+P GA    G+++ GDQL+ VDG  L  I QE A +++ +T P V+L + K  A  HG+
Sbjct: 1013 IKLHKNSNGMGLSIVAAKGAGQEKLGIYIKSVVPGGAADADGRLQAGDQLLRVDGQSLIGITQERAADYLVRTGPVVSLEVAKQGAIYHGL 1103          
BLAST of Afadin vs. Ensembl Zebrafish
Match: afdna (afadin, adherens junction formation factor a [Source:ZFIN;Acc:ZDB-GENE-050419-52])

HSP 1 Score: 395.586 bits (1015), Expect = 3.056e-111
Identity = 313/966 (32.40%), Postives = 479/966 (49.59%), Query Frame = 3
Query:   42 KMYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLK--YQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS---GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKP-----RMGPY--SIPID-LTKKSPVTPNRDDE-SFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPT-LDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEEC---EEKSRNLSSNVVLDHMKS----EDTIESIQLNYLTADLPVT-------IKHSYNVSEE-LIDTIFQLSKE---YADGGSKD----------LFSCNADPRFPNLSEL----------FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDN 2735
            +M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q D +   + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H + ++RK+  +E PL+VQLNW  DD++G+F+LKNE+       +TN       G+ ++            +TL  +            FSR+        ++ + +N    R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  D A+  +AE L+KYGL +E+ R Y + Q  +   ND+      +E IL D DCPL IL      +      +++R P D  P K      RMGP   SIP + L     ++P R    ++   +  +  +  D P+L +L                                      ++GS +S  G   NI L   + P I P HC +         +V  T+TP  +D+ +        +++ Q++  +T LR    +Q G   +F+F +    +  S+     ++    KS    E T +     +  + LP +       ++ S N SE  L+  + +  ++     DG S+D           F  N++  F  LS +          F+L+P Y+ Y+  R  +            +   V  ++N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      DL   +PAF+  +D D  +  R                      I+ +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ ++ +     L     S  WG  L ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  DK   +D+      C +   LN  QL+ LL N
Sbjct:   80 RMSGSREEERRKLADIINHWNANRLDLFEISQPTEDLEFHGVMRFYFQ-DRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERKLDLDEKPLVVQLNWNKDDREGRFVLKNENDIMPKRTLTNGPEKEKEGVIQNF----------KRTLSKKEKKKEKKREKEAFSRIPDGDDHVLNREDGEN---SRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSEDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDMADFAVAEALEKYGLEKENPRDYCIAQ--VIHANDK----AVKETILDDTDCPLQILRDWTSDKEALVFQLKKRPP-DYAPRKGRKPDNRMGPQHGSIPPEKLPYLVELSPGRGSHYAYYYRHHEDGSDSRDKPKLYRLQ---------------------------------HSVTEVGSDRSEDG---NIQL---FGPGILPHHCDLMHA----DGLV--TITPANMDAET--------FVDGQRIADTTVLRSGVTVQFGATHVFKFVDPSYDQSMSKRDPGPMMKGRHKSGSVPETTFDLHGDIHSGSALPTSKSSGKLEMERSGNSSERGLVKPMIRGEQQDFSKHDGRSQDGPELTLPASIEFRENSEDAF--LSAIINYTNSSTVHFKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDKDLSRITLDAQDVLAHLVQMAFKYLVHCLQSDLNNYMPAFL--EDPDEQNPQRPK--------------------IEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFVNMWLFNKLVTEADS----GL----CSHYWGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSMQDVQNINNTCFK---LNSLQLNALLSN 936          

HSP 2 Score: 76.6406 bits (187), Expect = 3.860e-13
Identity = 42/92 (45.65%), Postives = 56/92 (60.87%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            TV LKK +N +GLSI+AAK +  D   IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG+
Sbjct: 1059 TVTLKK-HNGMGLSIVAAKGAGQDKLGIYIKSVVKGGAADMDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVVTLEVAKQGAIYHGL 1149          
BLAST of Afadin vs. Ensembl Zebrafish
Match: afdna (afadin, adherens junction formation factor a [Source:ZFIN;Acc:ZDB-GENE-050419-52])

HSP 1 Score: 395.586 bits (1015), Expect = 3.555e-111
Identity = 320/994 (32.19%), Postives = 490/994 (49.30%), Query Frame = 3
Query:   42 KMYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLK--YQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS---GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKP-----RMGPY--SIPID-LTKKSPVTPNRDDE-SFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPT-LDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEEC---EEKSRNLSSNVVLDHMKS----EDTIESIQLNYLTADLPVT-------IKHSYNVSEE-LIDTIFQLSKE---YADGGSKD----------LFSCNADPRFPNLSEL----------FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            +M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q D +   + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H + ++RK+  +E PL+VQLNW  DD++G+F+LKNE+       +TN       G+ ++            +TL  +            FSR+        ++ + +N    R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  D A+  +AE L+KYGL +E+ R Y + Q  +   ND+      +E IL D DCPL IL      +      +++R P D  P K      RMGP   SIP + L     ++P R    ++   +  +  +  D P+L +L                                      ++GS +S  G   NI L   + P I P HC +         +V  T+TP  +D+ +        +++ Q++  +T LR    +Q G   +F+F +    +  S+     ++    KS    E T +     +  + LP +       ++ S N SE  L+  + +  ++     DG S+D           F  N++  F  LS +          F+L+P Y+ Y+  R  +            +   V  ++N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      DL   +PAF+  +D D  +  R                      I+ +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ ++ +     L     S  WG  L ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  DK   +D+      C +   LN  QL+ LL N  C   E  +P   I+ VV  +    D+
Sbjct:   64 RMSGSREEERRKLADIINHWNANRLDLFEISQPTEDLEFHGVMRFYFQ-DRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERKLDLDEKPLVVQLNWNKDDREGRFVLKNENDIMPKRTLTNGPEKEKEGVIQNF----------KRTLSKKEKKKEKKREKEAFSRIPDGDDHVLNREDGENS---RLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSEDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDMADFAVAEALEKYGLEKENPRDYCIAQ--VIHANDK----AVKETILDDTDCPLQILRDWTSDKEALVFQLKKRPP-DYAPRKGRKPDNRMGPQHGSIPPEKLPYLVELSPGRGSHYAYYYRHHEDGSDSRDKPKLYRLQ---------------------------------HSVTEVGSDRSEDG---NIQL---FGPGILPHHCDLMHA----DGLV--TITPANMDAET--------FVDGQRIADTTVLRSGVTVQFGATHVFKFVDPSYDQSMSKRDPGPMMKGRHKSGSVPETTFDLHGDIHSGSALPTSKSSGKLEMERSGNSSERGLVKPMIRGEQQDFSKHDGRSQDGPELTLPASIEFRENSEDAF--LSAIINYTNSSTVHFKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDKDLSRITLDAQDVLAHLVQMAFKYLVHCLQSDLNNYMPAFL--EDPDEQNPQRPK--------------------IEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFVNMWLFNKLVTEADS----GL----CSHYWGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSMQDVQNINNTCFK---LNSLQLNALLSNYHCAPDEPYIPPELIDHVVAVAENTADE 948          

HSP 2 Score: 76.6406 bits (187), Expect = 3.783e-13
Identity = 42/92 (45.65%), Postives = 56/92 (60.87%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            TV LKK +N +GLSI+AAK +  D   IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG+
Sbjct: 1043 TVTLKK-HNGMGLSIVAAKGAGQDKLGIYIKSVVKGGAADMDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVVTLEVAKQGAIYHGL 1133          
BLAST of Afadin vs. Ensembl Zebrafish
Match: ptpn13 (protein tyrosine phosphatase non-receptor type 13 [Source:ZFIN;Acc:ZDB-GENE-070410-72])

HSP 1 Score: 73.559 bits (179), Expect = 3.085e-12
Identity = 50/139 (35.97%), Postives = 73/139 (52.52%), Query Frame = 3
Query: 3183 DSQFDSGQYKKSLQTKNTKTYERPQTLPLDNKPVDSSDDSNATEVFKADLKNRYTVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKG 3599
            DS  D   Y  S     TK    P T+        SS D N+  +   DL   + + L KI++SLG+S+     +      IY+K VIP GA  + G+I+ GD++VAV+G  LE    ++AVE ++ T   V+LLME+G
Sbjct: 1275 DSDMDEDTYSNSQDKLKTKKGVSPITI--TETLSASSPDVNS--LHPGDL---FDIELSKIDSSLGISVTGGSNTSLKHGGIYVKGVIPKGAAEQDGRIKKGDRVVAVNGKSLEGATHKQAVEMLRDTGQVVHLLMERG 1406          
BLAST of Afadin vs. Ensembl Zebrafish
Match: si:dkey-92j12.5 (si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-354])

HSP 1 Score: 64.3142 bits (155), Expect = 2.641e-10
Identity = 30/80 (37.50%), Postives = 48/80 (60.00%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNL 3584
            T+ L++ +  LG SI+    S +    IY+K++ P GA  + G++  GDQL+ V+G  LE +   EAVE +++T  TV L
Sbjct:  181 TITLERGSAGLGFSIVGGFGSSHGDLPIYVKNIFPKGAAVEDGRLRRGDQLLTVNGQSLEGVTHSEAVEILRQTSGTVIL 260          
BLAST of Afadin vs. Ensembl Zebrafish
Match: si:dkey-92j12.5 (si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-354])

HSP 1 Score: 65.0846 bits (157), Expect = 1.187e-9
Identity = 30/80 (37.50%), Postives = 48/80 (60.00%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNL 3584
            T+ L++ +  LG SI+    S +    IY+K++ P GA  + G++  GDQL+ V+G  LE +   EAVE +++T  TV L
Sbjct: 1771 TITLERGSAGLGFSIVGGFGSSHGDLPIYVKNIFPKGAAVEDGRLRRGDQLLTVNGQSLEGVTHSEAVEILRQTSGTVIL 1850          
BLAST of Afadin vs. Ensembl Xenopus
Match: AFDN (afadin, adherens junction formation factor [Source:NCBI gene;Acc:100493083])

HSP 1 Score: 411.764 bits (1057), Expect = 1.111e-117
Identity = 307/948 (32.38%), Postives = 471/948 (49.68%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYY-PDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSE--ELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSEL-FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ RY+LYE H   +RK+   E PL+VQLNW  DD++G+F+LKNE+      D+       + G  K      + N       R+ S              L            +D+ +  ++A E+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS NDTA+  + E L+KYG+ +E+ + Y + +  +PP   +H  +  +E IL D++CPL I    P ++G     ++RR P D L  + R            KS  +  R D      Y   +  D  +P LV+LS D                         S + +  K  ++    + VG+       I  + P I+  HC ++        VV  T+TP ++D+ +        Y++  ++ ++T L     +Q G + +F+F +             LDH+  +   ++ Q+           + S   S+  +  + +   + E+ +  S+D F  +A   + N S + F+L+P Y+ Y+  R  L            +   V  ++N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+  DD + ND+ R                      I+ +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  DK   +D+      C +   LN  QL  LL N  C   E  +P   I+ VV+ +    D+
Sbjct:    1 MSGSREEERRKLADIINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPRYSLYEVHVSGERKLDFEEKPLVVQLNWNKDDREGRFVLKNEN------DIFPAKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKRRERDILKQSTDNEDRPQVRDDSENLQLAMEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTNDTADFAVIEALEKYGMEKENPKEYCIAKVVLPP-GAQHSDKGMKEFILDDEECPLHIFRDWPSEKGELVFQLKRR-PTDSLLKQNRKH--------ESKSGKSKERGDH-----YSLSLSPDK-LPYLVELSAD------------------------GSDSRDKPKLYRLQPSVTEVGTEKFQDNSIQLFGPGIQHHHCDLNN----MDGVV--TVTPRSIDADT--------YVDGHRISETTMLHSGVTVQFGSSHVFKFVDPN-----------LDHLLGKRLSDAGQIG--------KNQRSKQGSQDSQGPENVLPANIEFRE-NSEDAF-LSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSNKYRPDTSPAERTHKVIAVVNKMVGMMESVIQKQKNIAGALAFWMANASELLNFIKQDRDLNRITLDAQDVLAHLVQMAFKYLVHCLQSELTSSMPAFI--DDPEENDSQRPK--------------------IEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLAHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSHQDIPNINNTCFK---LNSLQLQALLQNYHCAPDEPYIPTELIDSVVSVAENTADE 829          

HSP 2 Score: 81.6481 bits (200), Expect = 1.300e-14
Identity = 55/160 (34.38%), Postives = 83/160 (51.88%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQKEYSASPKFTSPQSKSLSNKPVSHAQSHRQP--PLKKAPQYEQENK 3818
            TV LKK  N +GLSI+AAK +  +   IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q++   S K   P+ KS   +  ++A  +  P  P  + P+Y +  K
Sbjct:  924 TVTLKK-QNGMGLSIVAAKGAGQEKLGIYIKSVVKGGAAEVDGRLAAGDQLISVDGQSLVGLSQERAAELMTRTGAVVTLEVAKQGAIYHG----------LATLLNQPSPLMQRDRRGSGK---PRPKSEGFELYNNASQNGSPDSPQTQWPEYTEPKK 1069          
BLAST of Afadin vs. Ensembl Xenopus
Match: AFDN (afadin, adherens junction formation factor [Source:NCBI gene;Acc:100493083])

HSP 1 Score: 409.453 bits (1051), Expect = 8.907e-116
Identity = 309/952 (32.46%), Postives = 476/952 (50.00%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYP----NILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSE--ELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSEL-FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ RY+LYE H + ++RK+   E PL+VQLNW  DD++G+F+LKNE+      D+       + G  K      + N       R+ S              L            +D+ +  ++A E+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS NDTA+  + E L+KYG+ +E+ + Y + +  +PP   +H  +  +E IL D++CPL I    P ++G     ++RR P D L  + R            KS  +  R D      Y   +  D  +P LV+LS D                         S + +  K  ++    + VG+      +I L   + P I+  HC ++        VV  T+TP ++D+ +        Y++  ++ ++T L     +Q G + +F+F +             LDH+  +   ++ Q+           + S   S+  +  + +   + E+ +  S+D F  +A   + N S + F+L+P Y+ Y+  R  L            +   V  ++N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+  DD + ND+ R    P +D                 +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  DK   +D+      C +   LN  QL  LL N  C   E  +P   I+ VV+ +    D+
Sbjct:    1 MSGSREEERRKLADIINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPRYSLYEVHVSGEERKLDFEEKPLVVQLNWNKDDREGRFVLKNEN------DIFPAKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKRRERDILKQSTDNEDRPQVRDDSENLQLAMEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTNDTADFAVIEALEKYGMEKENPKEYCIAKVVLPP-GAQHSDKGMKEFILDDEECPLHIFRDWPSEKGELVFQLKRR-PTDSLLKQNRKH--------ESKSGKSKERGDH-----YSLSLSPDK-LPYLVELSAD------------------------GSDSRDKPKLYRLQPSVTEVGTEKFQDNSIQL---FGPGIQHHHCDLNN----MDGVV--TVTPRSIDADT--------YVDGHRISETTMLHSGVTVQFGSSHVFKFVDPN-----------LDHLLGKRLSDAGQIG--------KNQRSKQGSQDSQGPENVLPANIEFRE-NSEDAF-LSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSNKYRPDTSPAERTHKVIAVVNKMVGMMESVIQKQKNIAGALAFWMANASELLNFIKQDRDLNRITLDAQDVLAHLVQMAFKYLVHCLQSELTSSMPAFI--DDPEENDSQR----PKID-----------------VLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLAHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSHQDIPNINNTCFK---LNSLQLQALLQNYHCAPDEPYIPTELIDSVVSVAENTADE 829          

HSP 2 Score: 80.8777 bits (198), Expect = 2.180e-14
Identity = 55/160 (34.38%), Postives = 83/160 (51.88%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQKEYSASPKFTSPQSKSLSNKPVSHAQSHRQP--PLKKAPQYEQENK 3818
            TV LKK  N +GLSI+AAK +  +   IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q++   S K   P+ KS   +  ++A  +  P  P  + P+Y +  K
Sbjct:  924 TVTLKK-QNGMGLSIVAAKGAGQEKLGIYIKSVVKGGAAEVDGRLAAGDQLISVDGQSLVGLSQERAAELMTRTGAVVTLEVAKQGAIYHG----------LATLLNQPSPLMQRDRRGSGK---PRPKSEGFELYNNASQNGSPDSPQTQWPEYTEPKK 1069          
BLAST of Afadin vs. Ensembl Xenopus
Match: AFDN (afadin, adherens junction formation factor [Source:NCBI gene;Acc:100493083])

HSP 1 Score: 404.06 bits (1037), Expect = 4.913e-115
Identity = 308/955 (32.25%), Postives = 474/955 (49.63%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYY-PDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSE--ELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSEL-FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQ--DDKNSIEKEV-----FWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ RY+LYE H   +RK+   E PL+VQLNW  DD++G+F+LKNE+    +   +N       G  K      + N       R+ S              L            +D+ +  ++A E+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS NDTA+  + E L+KYG+ +E+ + Y + +  +PP   +H  +  +E IL D++CPL I    P ++G     ++RR P D L  + R            KS  +  R D      Y   +  D  +P LV+LS D                         S + +  K  ++    + VG+       I  + P I+  HC ++        VV  T+TP ++D+ +        Y++  ++ ++T L     +Q G + +F+F +             LDH+  +   ++ Q+           + S   S+  +  + +   + E+ +  S+D F  +A   + N S + F+L+P Y+ Y+  R  L            +   V  ++N +   +E VIQ  D  N  +K +     FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+  DD + ND+ R                      I+ +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  DK   +D+      C +   LN  QL  LL N  C   E  +P   I+ VV+ +    D+
Sbjct:    1 MSGSREEERRKLADIINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPRYSLYEVHVSGERKLDFEEKPLVVQLNWNKDDREGRFVLKNENDIFPAKAQSN-------GPEKQEKEGVIQNFK-----RTLSKKEKKEKKRRERDILKQSTDNEDRPQVRDDSENLQLAMEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTNDTADFAVIEALEKYGMEKENPKEYCIAKVVLPP-GAQHSDKGMKEFILDDEECPLHIFRDWPSEKGELVFQLKRR-PTDSLLKQNRKH--------ESKSGKSKERGDH-----YSLSLSPDK-LPYLVELSAD------------------------GSDSRDKPKLYRLQPSVTEVGTEKFQDNSIQLFGPGIQHHHCDLNN----MDGVV--TVTPRSIDADT--------YVDGHRISETTMLHSGVTVQFGSSHVFKFVDPN-----------LDHLLGKRLSDAGQIG--------KNQRSKQGSQDSQGPENVLPANIEFRE-NSEDAF-LSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSNKYRPDTSPAERTHKVIAVVNKMVGMMESVIQEIDKGNQKQKNIAGALAFWMANASELLNFIKQDRDLNRITLDAQDVLAHLVQMAFKYLVHCLQSELTSSMPAFI--DDPEENDSQRPK--------------------IEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLAHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSHQDIPNINNTCFK---LNSLQLQALLQNYHCAPDEPYIPTELIDSVVSVAENTADE 835          

HSP 2 Score: 81.6481 bits (200), Expect = 1.467e-14
Identity = 55/160 (34.38%), Postives = 83/160 (51.88%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQKEYSASPKFTSPQSKSLSNKPVSHAQSHRQP--PLKKAPQYEQENK 3818
            TV LKK  N +GLSI+AAK +  +   IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q++   S K   P+ KS   +  ++A  +  P  P  + P+Y +  K
Sbjct:  930 TVTLKK-QNGMGLSIVAAKGAGQEKLGIYIKSVVKGGAAEVDGRLAAGDQLISVDGQSLVGLSQERAAELMTRTGAVVTLEVAKQGAIYHG----------LATLLNQPSPLMQRDRRGSGK---PRPKSEGFELYNNASQNGSPDSPQTQWPEYTEPKK 1075          
BLAST of Afadin vs. Ensembl Xenopus
Match: AFDN (afadin, adherens junction formation factor [Source:NCBI gene;Acc:100493083])

HSP 1 Score: 400.979 bits (1029), Expect = 3.160e-114
Identity = 311/957 (32.50%), Postives = 477/957 (49.84%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYY-PDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSE--ELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSEL-FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQ--------DDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ RY+LYE H + ++RK+   E PL+VQLNW  DD++G+F+LKNE+      D+       + G  K      + N    +TL  +          +   + ST    R      D E+ Q +A E+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS NDTA+  + E L+KYG+ +E+ + Y + +  +PP   +H  +  +E IL D++CPL I    P ++G     ++RR P D L  + R            KS  +  R D      Y   +  D  +P LV+LS D                         S + +  K  ++    + VG+       I  + P I+  HC ++        VV  T+TP ++D+ +        Y++  ++ ++T L     +Q G + +F+F +             LDH+  +   ++ Q+           + S   S+  +  + +   + E+ +  S+D F  +A   + N S + F+L+P Y+ Y+  R  L            +   V  ++N +   +E VIQ          KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+  DD + ND+ R                      I+ +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  DK   +D+      C +   LN  QL  LL N  C   E  +P   I+ VV+ +    D+
Sbjct:    1 MSGSREEERRKLADIINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPRYSLYEVHVSGEERKLDFEEKPLVVQLNWNKDDREGRFVLKNEN------DIFPAKKAQSNGPEKQEKEGVIQNF--KRTLSKKEKKEKKRRERDIL-KQSTDNEDRALAHGGDYENLQ-LAMEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTNDTADFAVIEALEKYGMEKENPKEYCIAKVVLPP-GAQHSDKGMKEFILDDEECPLHIFRDWPSEKGELVFQLKRR-PTDSLLKQNRKH--------ESKSGKSKERGDH-----YSLSLSPDK-LPYLVELSAD------------------------GSDSRDKPKLYRLQPSVTEVGTEKFQDNSIQLFGPGIQHHHCDLNN----MDGVV--TVTPRSIDADT--------YVDGHRISETTMLHSGVTVQFGSSHVFKFVDPN-----------LDHLLGKRLSDAGQIG--------KNQRSKQGSQDSQGPENVLPANIEFRE-NSEDAF-LSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSNKYRPDTSPAERTHKVIAVVNKMVGMMESVIQVSNQVGHEKQKNIAGALAFWMANASELLNFIKQDRDLNRITLDAQDVLAHLVQMAFKYLVHCLQSELTSSMPAFI--DDPEENDSQRPK--------------------IEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLAHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSHQDIPNINNTCFK---LNSLQLQALLQNYHCAPDEPYIPTELIDSVVSVAENTADE 839          

HSP 2 Score: 81.6481 bits (200), Expect = 1.257e-14
Identity = 55/160 (34.38%), Postives = 83/160 (51.88%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQKEYSASPKFTSPQSKSLSNKPVSHAQSHRQP--PLKKAPQYEQENK 3818
            TV LKK  N +GLSI+AAK +  +   IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q++   S K   P+ KS   +  ++A  +  P  P  + P+Y +  K
Sbjct:  934 TVTLKK-QNGMGLSIVAAKGAGQEKLGIYIKSVVKGGAAEVDGRLAAGDQLISVDGQSLVGLSQERAAELMTRTGAVVTLEVAKQGAIYHG----------LATLLNQPSPLMQRDRRGSGK---PRPKSEGFELYNNASQNGSPDSPQTQWPEYTEPKK 1079          
BLAST of Afadin vs. Ensembl Xenopus
Match: AFDN (afadin, adherens junction formation factor [Source:NCBI gene;Acc:100493083])

HSP 1 Score: 401.749 bits (1031), Expect = 2.257e-113
Identity = 311/969 (32.09%), Postives = 479/969 (49.43%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYY-PDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF-------------EECEEKSRN-LSSNVVLDHMKSEDTIESIQLN-YLTADLPVTIKHSYNVSEELID-TIFQLSKEYADGGSKDLFSCNADPRFPNLSEL-FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQ--DDKNSIEKEV-----FWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ RY+LYE H   +RK+   E PL+VQLNW  DD++G+F+LKNE+      D+       + G  K      + N       R+ S              L            +D+ +  ++A E+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS NDTA+  + E L+KYG+ +E+ + Y + +  +PP   +H  +  +E IL D++CPL I    P ++G     ++RR P D L  + R            KS  +  R D      Y   +  D  +P LV+LS D                         S + +  K  ++    + VG+       I  + P I+  HC ++        VV  T+TP ++D+ +        Y++  ++ ++T L     +Q G + +F+F              +  +  +N  S    LD+ ++    E   +   +  D    I +   ++  L +  +F L   ++   ++D F  +A   + N S + F+L+P Y+ Y+  R  L            +   V  ++N +   +E VIQ  D  N  +K +     FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+  DD + ND+ R    P +D                 +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  DK   +D+      C +   LN  QL  LL N  C   E  +P   I+ VV+ +    D+
Sbjct:    1 MSGSREEERRKLADIINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPRYSLYEVHVSGERKLDFEEKPLVVQLNWNKDDREGRFVLKNEN------DIFPAKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKRRERDILKQSTDNEDRPQVRDDSENLQLAMEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTNDTADFAVIEALEKYGMEKENPKEYCIAKVVLPP-GAQHSDKGMKEFILDDEECPLHIFRDWPSEKGELVFQLKRR-PTDSLLKQNRKH--------ESKSGKSKERGDH-----YSLSLSPDK-LPYLVELSAD------------------------GSDSRDKPKLYRLQPSVTEVGTEKFQDNSIQLFGPGIQHHHCDLNN----MDGVV--TVTPRSIDADT--------YVDGHRISETTMLHSGVTVQFGSSHVFKFVDPNLDHLLGKRLSDAGQIGKNQRSKQGKLDNDRTPGMTERGMVKPIIRMDNNHFIMYCICIAIFLQNLKLFSLLCFFSPSLAEDAF-LSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSNKYRPDTSPAERTHKVIAVVNKMVGMMESVIQEIDKGNQKQKNIAGALAFWMANASELLNFIKQDRDLNRITLDAQDVLAHLVQMAFKYLVHCLQSELTSSMPAFI--DDPEENDSQR----PKID-----------------VLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLAHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSHQDIPNINNTCFK---LNSLQLQALLQNYHCAPDEPYIPTELIDSVVSVAENTADE 869          

HSP 2 Score: 81.6481 bits (200), Expect = 1.536e-14
Identity = 55/160 (34.38%), Postives = 83/160 (51.88%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQKEYSASPKFTSPQSKSLSNKPVSHAQSHRQP--PLKKAPQYEQENK 3818
            TV LKK  N +GLSI+AAK +  +   IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q++   S K   P+ KS   +  ++A  +  P  P  + P+Y +  K
Sbjct:  964 TVTLKK-QNGMGLSIVAAKGAGQEKLGIYIKSVVKGGAAEVDGRLAAGDQLISVDGQSLVGLSQERAAELMTRTGAVVTLEVAKQGAIYHG----------LATLLNQPSPLMQRDRRGSGK---PRPKSEGFELYNNASQNGSPDSPQTQWPEYTEPKK 1109          
BLAST of Afadin vs. Ensembl Mouse
Match: Afdn (afadin, adherens junction formation factor [Source:MGI Symbol;Acc:MGI:1314653])

HSP 1 Score: 287.345 bits (734), Expect = 1.113e-77
Identity = 194/545 (35.60%), Postives = 294/545 (53.94%), Query Frame = 3
Query:   51 GPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS---GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYP----NILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +R++  +E PL+VQLNW  DD++G+F+LKNE+      D        + G  K      + N       R+ S              L     + +  S+ D+ +  R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  DTA+  +AE+L+KYGL +E+ + Y + +  +PP          +EIIL D +CPL I    P  +G     ++RR P D +P K       +   +  KS    +R D S    Y + +  +  +P LV+LS     +             S +     S + +  K  ++    + VG+      +I L   + P I+P HC ++        VV  T+TP ++D+ +        Y++ Q++ ++T L+    +Q G + +F+F
Sbjct:    4 GGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNEN------DAIPAKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKKKEKEALRQASDKEERPSQGDDSENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPP-DYIPKK-------MKKHVEGKSLKGKDRADGS---GYGSALPPEK-LPYLVELSPGRRNH---------FAYYSYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKFDDNSIQL---FGPGIQPHHCDLTN----MDGVV--TVTPRSMDAET--------YVDGQRISETTMLQSGMRLQFGTSHVFKF 499          

HSP 2 Score: 155.221 bits (391), Expect = 4.614e-37
Identity = 107/317 (33.75%), Postives = 156/317 (49.21%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLGKDQHVSNL------------INIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKR---DLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  L   QH  ++            +N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+D    D  +N+       L R             I  +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++LG ++ W+E  GL++AA+CH+ ++ Q T L+  DK    D+      C +   LN  QL  LL N  C   E  +P   IE VV  +    D+
Sbjct:  630 FKLSPTYVLYMACRYVLS-SQHRPDISPTERTHKAIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLD----DPEENS-------LQRPK-----------IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFK---LNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADE 912          

HSP 3 Score: 76.2554 bits (186), Expect = 4.462e-13
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK  N +GLSI+AAK +  D   IY+K V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct: 1009 TVTLKK-QNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1112          
BLAST of Afadin vs. Ensembl Mouse
Match: Afdn (afadin, adherens junction formation factor [Source:MGI Symbol;Acc:MGI:1314653])

HSP 1 Score: 287.73 bits (735), Expect = 1.274e-77
Identity = 194/545 (35.60%), Postives = 294/545 (53.94%), Query Frame = 3
Query:   51 GPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYP----NILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +R++  +E PL+VQLNW  DD++G+F+LKNE+      D        + G  K      + N       R+ S              L     + +  S+ D+ +  R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  DTA+  +AE+L+KYGL +E+ + Y + +  +PP          +EIIL D +CPL I    P  +G     ++RR P D +P K       +   +  KS    +R D S    Y + +  +  +P LV+LS     +             S +     S + +  K  ++    + VG+      +I L   + P I+P HC ++        VV  T+TP ++D+ +        Y++ Q++ ++T L+    +Q G + +F+F
Sbjct:    4 GGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNEN------DAIPAKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKKKEKEALRQASDKEERPSQGDDSENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPP-DYIPKK-------MKKHVEGKSLKGKDRADGS---GYGSALPPEK-LPYLVELSPGRRNH---------FAYYSYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKFDDNSIQL---FGPGIQPHHCDLTN----MDGVV--TVTPRSMDAET--------YVDGQRISETTMLQSGMRLQFGTSHVFKF 499          

HSP 2 Score: 153.295 bits (386), Expect = 1.980e-36
Identity = 127/376 (33.78%), Postives = 188/376 (50.00%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLGKDQH----------------VSNLINI---IAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKR---DLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCDRGIVSCPKDLKTMLNAL 2963
            F+L+P Y+ Y+  R  L   QH                V+ ++++   + Q ++QV Q  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+D    D  +N+       L R             I  +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++LG ++ W+E  GL++AA+CH+ ++ Q T L+  DK    D+      C +   LN  QL  LL N  C   E  +P   IE VV  +    D+        + +++ L ED DL+LP LLP DGYSCD  + + P  L+  L+ L
Sbjct:  630 FKLSPTYVLYMACRYVLS-SQHRPDISPTERTHKAIAVVNKMVSMMEGVIQEVDQVDQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLD----DPEENS-------LQRPK-----------IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFK---LNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADELARS----DGRDVQLEEDPDLQLPFLLPEDGYSCD-VVRNIPNGLQEFLDPL 966          

HSP 3 Score: 76.2554 bits (186), Expect = 4.261e-13
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK  N +GLSI+AAK +  D   IY+K V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct: 1016 TVTLKK-QNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1119          
BLAST of Afadin vs. Ensembl Mouse
Match: Afdn (afadin, adherens junction formation factor [Source:MGI Symbol;Acc:MGI:1314653])

HSP 1 Score: 287.73 bits (735), Expect = 1.294e-77
Identity = 194/545 (35.60%), Postives = 294/545 (53.94%), Query Frame = 3
Query:   51 GPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYP----NILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +R++  +E PL+VQLNW  DD++G+F+LKNE+      D        + G  K      + N       R+ S              L     + +  S+ D+ +  R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  DTA+  +AE+L+KYGL +E+ + Y + +  +PP          +EIIL D +CPL I    P  +G     ++RR P D +P K       +   +  KS    +R D S    Y + +  +  +P LV+LS     +             S +     S + +  K  ++    + VG+      +I L   + P I+P HC ++        VV  T+TP ++D+ +        Y++ Q++ ++T L+    +Q G + +F+F
Sbjct:    4 GGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNEN------DAIPAKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKKKEKEALRQASDKEERPSQGDDSENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPP-DYIPKK-------MKKHVEGKSLKGKDRADGS---GYGSALPPEK-LPYLVELSPGRRNH---------FAYYSYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKFDDNSIQL---FGPGIQPHHCDLTN----MDGVV--TVTPRSMDAET--------YVDGQRISETTMLQSGMRLQFGTSHVFKF 499          

HSP 2 Score: 155.992 bits (393), Expect = 3.006e-37
Identity = 107/317 (33.75%), Postives = 156/317 (49.21%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLGKDQHVSNL------------INIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKR---DLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  L   QH  ++            +N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+D    D  +N+       L R             I  +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++LG ++ W+E  GL++AA+CH+ ++ Q T L+  DK    D+      C +   LN  QL  LL N  C   E  +P   IE VV  +    D+
Sbjct:  630 FKLSPTYVLYMACRYVLS-SQHRPDISPTERTHKAIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLD----DPEENS-------LQRPK-----------IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFK---LNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADE 912          

HSP 3 Score: 76.2554 bits (186), Expect = 4.404e-13
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK  N +GLSI+AAK +  D   IY+K V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct: 1009 TVTLKK-QNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1112          
BLAST of Afadin vs. Ensembl Mouse
Match: Afdn (afadin, adherens junction formation factor [Source:MGI Symbol;Acc:MGI:1314653])

HSP 1 Score: 287.345 bits (734), Expect = 1.581e-77
Identity = 194/545 (35.60%), Postives = 292/545 (53.58%), Query Frame = 3
Query:   51 GPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYP----NILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +R++  +E PL+VQLNW  DD++G+F+LKNE+      D        + G  K      + N       R+ S              L     + +  S+ D+ +  R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  DTA+  +AE+L+KYGL +E+ + Y + +  +PP          +EIIL D +CPL I    P  +G     ++RR P D +P K       +   +  KS    +R D S    Y + +  +  +P LV+LS D                         S + +  K  ++    + VG+      +I L   + P I+P HC ++        VV  T+TP ++D+ +        Y++ Q++ ++T L+    +Q G + +F+F
Sbjct:    4 GGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNEN------DAIPAKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKKKEKEALRQASDKEERPSQGDDSENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPP-DYIPKK-------MKKHVEGKSLKGKDRADGS---GYGSALPPEK-LPYLVELSPDG------------------------SDSRDKPKLYRLQLSVTEVGTEKFDDNSIQL---FGPGIQPHHCDLTN----MDGVV--TVTPRSMDAET--------YVDGQRISETTMLQSGMRLQFGTSHVFKF 484          

HSP 2 Score: 155.992 bits (393), Expect = 2.679e-37
Identity = 107/317 (33.75%), Postives = 156/317 (49.21%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLGKDQHVSNL------------INIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKR---DLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  L   QH  ++            +N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+D    D  +N+       L R             I  +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++LG ++ W+E  GL++AA+CH+ ++ Q T L+  DK    D+      C +   LN  QL  LL N  C   E  +P   IE VV  +    D+
Sbjct:  615 FKLSPTYVLYMACRYVLS-SQHRPDISPTERTHKAIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLD----DPEENS-------LQRPK-----------IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFK---LNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADE 897          

HSP 3 Score: 76.2554 bits (186), Expect = 4.359e-13
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK  N +GLSI+AAK +  D   IY+K V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct:  994 TVTLKK-QNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1097          
BLAST of Afadin vs. Ensembl Mouse
Match: Afdn (afadin, adherens junction formation factor [Source:MGI Symbol;Acc:MGI:1314653])

HSP 1 Score: 287.345 bits (734), Expect = 1.650e-77
Identity = 194/545 (35.60%), Postives = 292/545 (53.58%), Query Frame = 3
Query:   51 GPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYP----NILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +R++  +E PL+VQLNW  DD++G+F+LKNE+      D        + G  K      + N       R+ S              L     + +  S+ D+ +  R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  DTA+  +AE+L+KYGL +E+ + Y + +  +PP          +EIIL D +CPL I    P  +G     ++RR P D +P K       +   +  KS    +R D S    Y + +  +  +P LV+LS D                         S + +  K  ++    + VG+      +I L   + P I+P HC ++        VV  T+TP ++D+ +        Y++ Q++ ++T L+    +Q G + +F+F
Sbjct:    4 GGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNEN------DAIPAKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKKKEKEALRQASDKEERPSQGDDSENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPP-DYIPKK-------MKKHVEGKSLKGKDRADGS---GYGSALPPEK-LPYLVELSPDG------------------------SDSRDKPKLYRLQLSVTEVGTEKFDDNSIQL---FGPGIQPHHCDLTN----MDGVV--TVTPRSMDAET--------YVDGQRISETTMLQSGMRLQFGTSHVFKF 484          

HSP 2 Score: 155.992 bits (393), Expect = 2.656e-37
Identity = 107/317 (33.75%), Postives = 156/317 (49.21%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLGKDQHVSNL------------INIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKR---DLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  L   QH  ++            +N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+D    D  +N+       L R             I  +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++LG ++ W+E  GL++AA+CH+ ++ Q T L+  DK    D+      C +   LN  QL  LL N  C   E  +P   IE VV  +    D+
Sbjct:  615 FKLSPTYVLYMACRYVLS-SQHRPDISPTERTHKAIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLD----DPEENS-------LQRPK-----------IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFK---LNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADE 897          

HSP 3 Score: 76.2554 bits (186), Expect = 4.433e-13
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK  N +GLSI+AAK +  D   IY+K V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct:  994 TVTLKK-QNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1097          
BLAST of Afadin vs. UniProt/SwissProt
Match: sp|Q9QZQ1|AFAD_MOUSE (Afadin OS=Mus musculus OX=10090 GN=Afdn PE=1 SV=3)

HSP 1 Score: 287.73 bits (735), Expect = 9.050e-77
Identity = 194/545 (35.60%), Postives = 294/545 (53.94%), Query Frame = 3
Query:   51 GPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYP----NILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +R++  +E PL+VQLNW  DD++G+F+LKNE+      D        + G  K      + N       R+ S              L     + +  S+ D+ +  R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  DTA+  +AE+L+KYGL +E+ + Y + +  +PP          +EIIL D +CPL I    P  +G     ++RR P D +P K       +   +  KS    +R D S    Y + +  +  +P LV+LS     +             S +     S + +  K  ++    + VG+      +I L   + P I+P HC ++        VV  T+TP ++D+ +        Y++ Q++ ++T L+    +Q G + +F+F
Sbjct:    4 GGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNEN------DAIPAKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKKKEKEALRQASDKEERPSQGDDSENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPP-DYIPKK-------MKKHVEGKSLKGKDRADGS---GYGSALPPEK-LPYLVELSPGRRNH---------FAYYSYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKFDDNSIQL---FGPGIQPHHCDLTN----MDGVV--TVTPRSMDAET--------YVDGQRISETTMLQSGMRLQFGTSHVFKF 499          

HSP 2 Score: 155.992 bits (393), Expect = 2.102e-36
Identity = 107/317 (33.75%), Postives = 156/317 (49.21%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLGKDQHVSNL------------INIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKR---DLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  L   QH  ++            +N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+D    D  +N+       L R             I  +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++LG ++ W+E  GL++AA+CH+ ++ Q T L+  DK    D+      C +   LN  QL  LL N  C   E  +P   IE VV  +    D+
Sbjct:  630 FKLSPTYVLYMACRYVLS-SQHRPDISPTERTHKAIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLD----DPEENS-------LQRPK-----------IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFK---LNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADE 912          

HSP 3 Score: 76.2554 bits (186), Expect = 3.080e-12
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK  N +GLSI+AAK +  D   IY+K V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct: 1009 TVTLKK-QNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1112          
BLAST of Afadin vs. UniProt/SwissProt
Match: sp|P55196|AFAD_HUMAN (Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3)

HSP 1 Score: 285.804 bits (730), Expect = 3.827e-76
Identity = 193/547 (35.28%), Postives = 290/547 (53.02%), Query Frame = 3
Query:   51 GPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS---GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSG--AVEGSKFIKIGSQQSAVGSYP----NILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +R++  +E PL+VQLNW  DD++G+F+LKNE+      D        + G  K      + N       R+ S              L     +     + ++ +  R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  D A+  +AE L+KYGL +E+ + Y + +  +PP       +  +EIIL D +CPL I    P  +G     ++RR P D +P K +         L  K+P    R D S    Y + +  +  +P LV+LS     +               N   Y  G  + +  K  ++    + VG+      +I L   + P I+P HC ++        VV  T+TP ++D+ +        Y+  Q++ ++T L+    +Q G + +F+F
Sbjct:    4 GGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNEN------DAIPPKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPP-DHIPKKTKK-------HLEGKTPKGKERADGS---GYGSTLPPEK-LPYLVELSPGRRNHF-----------AYYNYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKLDDNSIQL---FGPGIQPHHCDLTN----MDGVV--TVTPRSMDAET--------YVEGQRISETTMLQSGMKVQFGASHVFKF 499          

HSP 2 Score: 157.532 bits (397), Expect = 5.784e-37
Identity = 106/316 (33.54%), Postives = 155/316 (49.05%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKR---DLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  L            +   V  ++N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+D    D  +N+       L R             I  +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++LG ++ W+E  GL++AA+CH+ ++ Q T L+  DK    D+      C +   LN  QL  LL N  C   E  +P   IE VV  +    D+
Sbjct:  630 FKLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLD----DPEENS-------LQRPK-----------IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFK---LNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADE 912          

HSP 3 Score: 76.2554 bits (186), Expect = 3.740e-12
Identity = 44/115 (38.26%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK  N +GLSI+AAK +  D   IY+K V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct: 1009 TVTLKK-QNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1112          
BLAST of Afadin vs. UniProt/SwissProt
Match: sp|O35889|AFAD_RAT (Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 1.131e-75
Identity = 190/545 (34.86%), Postives = 289/545 (53.03%), Query Frame = 3
Query:   51 GPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDL-KYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYP----NILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTP-TLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q      + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +R++  +E PL+VQLNW  DD++G+F+LKNE+      D        + G  K      + N       R+ S              L     + +  S+ D+ +  R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  D A+  +AE+L+KYGL +E+ + Y + +  +PP          +EIIL D +CPL I    P  +G     ++RR P D +P K +      P+    ++      D   +      E      +P LV+LS     +             S +     S + +  K  ++    + VG+      +I L   + P I+P HC ++        VV  T+TP ++D+ +        Y++ Q++ ++T L+    +Q G + +F+F
Sbjct:    4 GGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNEN------DAIPAKKAQSNGPEKQEKEGVIQNFK-----RTLSKKEKKEKKKREKEALRQASDKEERPSQGDDSENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAESLEKYGLEKENPKDYCIARVMLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPP-DYIPKKMKKHVEGKPLKGKDRA------DGSGYGSALPPE-----KLPYLVELSPGRRNH---------FAYYSYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKFDDNSIQL---FGPGIQPHHCDLTN----MDGVV--TVTPRSMDAET--------YVDGQRISETTMLQSGMRLQFGTSHVFKF 499          

HSP 2 Score: 152.91 bits (385), Expect = 1.600e-35
Identity = 127/376 (33.78%), Postives = 188/376 (50.00%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLGKDQH----------------VSNLINI---IAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKR---DLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCDRGIVSCPKDLKTMLNAL 2963
            F+L+P Y+ Y+  R  L   QH                V+ ++++   + Q ++QV Q  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      +L   +PAF+D    D  +N+       L R             I  +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D   P S        S  WG  + ++LG ++ W+E  GL++AA+CH+ ++ Q T L+  DK    D+      C +   LN  QL  LL N  C   E  +P   IE VV  +    D+        + +++ L ED DL+LP LLP DGYSCD  + + P  L+  L+ L
Sbjct:  630 FKLSPTYVLYMACRYVLSS-QHRPDISPTERTHKAIAVVNKMVSMMEGVIQEVDQVDQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLD----DPEENS-------LQRPK-----------IDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTD---PDSGL-----CSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFK---LNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADELARS----DGRDVQLEEDPDLQLPFLLPEDGYSCD-VVRNIPNGLQEFLDPL 966          

HSP 3 Score: 76.6406 bits (187), Expect = 2.787e-12
Identity = 55/166 (33.13%), Postives = 79/166 (47.59%), Query Frame = 3
Query: 3192 FDSGQYKKSLQTKNTKTYERPQTLPLDNKPVDSSDDSNATEVFKADLKNRYTVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            F+   Y+  L  +NT+      T PL  +P          EV         TV LKK  N +GLSI+AAK +  D   IY+K V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct:  988 FEGADYESHLMRENTEL-----TQPLRKEP----------EVI--------TVTLKK-QNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1119          
BLAST of Afadin vs. UniProt/SwissProt
Match: sp|Q8VBX6|MPDZ_MOUSE (Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 2.572e-10
Identity = 36/98 (36.73%), Postives = 57/98 (58.16%), Query Frame = 3
Query: 3303 NATEVFKADLK--NRYTVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLM 3590
             ++ +F  DL      T+ L +  + LG SI+    SP+    IY+K V   GA  + G+++ GDQ++AV+G  LE +  EEAV  +K+TK TV L++
Sbjct: 1956 TSSSIFPDDLGPPQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2053          
BLAST of Afadin vs. UniProt/SwissProt
Match: sp|O75970|MPDZ_HUMAN (Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 3.342e-10
Identity = 35/98 (35.71%), Postives = 59/98 (60.20%), Query Frame = 3
Query: 3303 NATEVFKADLK--NRYTVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLM 3590
             ++ +F+ DL      ++ L++  + LG SI+    SP+    IY+K V   GA  + G+++ GDQ++AV+G  LE +  EEAV  +K+TK TV L++
Sbjct: 1971 TSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2068          
BLAST of Afadin vs. TrEMBL
Match: A0A553PI81 (Uncharacterized protein OS=Tigriopus californicus OX=6832 GN=TCAL_03845 PE=4 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 1.849e-125
Identity = 379/1220 (31.07%), Postives = 565/1220 (46.31%), Query Frame = 3
Query:   90 IREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDD-----LKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS---GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLV------QQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEEC----EEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSELFRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPV---SPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDNCE----DVELPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCD--RGIVSCPKDLKTMLNALHGLLSYKLNP-PILNDVDTRWKSYLGSYEHTPSVSRSGTIIEQSPIAPLKIDTQHKLPRNWISEDQNSMILSSPDSQFDSGQYKKSLQTKNTKTYERPQTLPLDNKPV-DSSDDSNATEVFKADLKNRYTVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            I +WNANRLDLF ++ PNE LEF GVMRF+YQ  D      K  TKC+RVSSTATT+ +IE ++ KF PDMKML    YALYE H   +R++   E PL+VQLNW  DD++G+F+L+      R  + +N        +SK            ++ L+ + +    T                      D   A+++  EL    P++SFTR+ISNP+ VM+RRRQ+KLE +L+QF    G  +TGGTLKIYG++I  D+PYKTLL+S+ D A  V  E L+KYG  + +   Y LV      Q+ + PK         ++  L D +CPL IL+++PP RGT T  VR + P D  P K +  P      ++    V P  DD +              VP LV+ + D   NL      F     +N                K+GS   A+ +  ++LLP    P I P HC ++        +V  T+TP+   +         Y+  Q++ ++T L+  ++I  G +  FRF +      E+ R  +S+V L      D   S  +++  A   +  + S    + ++  + +  +E     S++ F              F+LAP Y FY+  R               +   +++++N + + I   +Q  ++      FW++N+SELLH L+CD  + +FS  AQD+LA  +  AF  L     + L   +P  +   D D   +                        I  ++  LS A  L   C+VN ALTIQ+FSQLFH +N W FN ++      G    G  P+   +  WG RL +RL +++ W+E  GL++AA+CH+ ++ Q   L++A K    D+      C +   LN  QL  LL   E    +  +    I+ +V  +    D+  N       + + L ED  L+LP LLP DGYSCD  RGI   P  L   +  L  +    + P P  +     W  Y+   + TP ++        SP+                SE   +   ++ D  F  G      Q  N      P  +   NKP   S +  N  E+         T++L K  N +GLSI+AAK    D   IYIK V+  GA +  G++E GDQL+ VDG  L  I QE+A E M +T P V L++ K  A  HG+
Sbjct:   88 ITQWNANRLDLFALTLPNEELEFNGVMRFYYQSQDKDDTGQKVATKCIRVSSTATTKAIIETLIEKFRPDMKMLEVPEYALYEIHESGERRLNPEEKPLLVQLNWHKDDREGRFLLRRIDEASRMPEPSNEDSSFKRKLSKREKKQLKKQEKLNK-LKDKENRDGLTGPGQ------------------DGGVAEKLYTEL----PDTSFTRSISNPEAVMRRRRQQKLERKLQQFRSKDGGPDTGGTLKIYGEAICKDVPYKTLLISIRDNAAYVTEEMLEKYGRDRREAIRYCLVQCTTMDQEGVEPKT--------QDYYLEDDECPLEILMNHPPARGTVTFHVRPK-PSDFFPRKRKKKPMYQGGAVSDS--VLPRNDDLAM-----------NSVPFLVETNPDGSENL-RGGAPFKFPIPTN--------------VTKVGS-DPAIQNAQSLLLPPG--PFIFPQHCVLAHT----EGIV--TVTPSHRDAE-------TYVGNQRIIETTILQHGNLICFGRSKTFRFLDAAILKREQWRLQTSSVTLP-----DPRHSNYVHFGPASSTMGGEGSLRGKDNILPAVLEFREE-----SEENFFNAITMGLETNGVQFKLAPTYTFYMATRFRASTHYRPELIPEERAVRLTDMLNRVTEKIYNNVQLHQSEASNLAFWMANASELLHFLKCDRHITSFSLQAQDILAETVHLAFKQLVLCLQKGLKSAMPHMLHDSDEDDKSDKS----------------------IPDIMMVLSSAMNLLRKCRVNAALTIQLFSQLFHYVNMWTFNQIVMSGYPRG----GERPINYCNHRWGLRLKKRLSKIETWAERQGLELAADCHLARVVQAAHLLLARKNSAEDIASVSSICFK---LNSLQLKTLLHKYEPEPNETPISNEMIDTIVRVAENTVDEMTN----SEGREVRLEEDFVLQLPFLLPEDGYSCDIVRGI---PGGLVEFIGPLQQMGLCIMTPQPTSSGF---WTIYMERLDATPMMA--------SPVP---------------SEMSQNTTTTTGDQPFHHG--NPPPQHYNVG----PPKMDSPNKPSPPSHNQGNEPEI--------QTIQLAKSTNGMGLSIVAAKGVGKDRLGIYIKAVVEGGAAFHDGRLEAGDQLINVDGQSLVGITQEKAAEIMMRTGPVVTLVVAKQGAIFHGL 1145          
BLAST of Afadin vs. TrEMBL
Match: C3YI18 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_208117 PE=4 SV=1)

HSP 1 Score: 441.81 bits (1135), Expect = 5.841e-124
Identity = 355/1050 (33.81%), Postives = 521/1050 (49.62%), Query Frame = 3
Query:   66 ERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQ--TKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFSGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKND--RHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKK------SPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIF-TLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEE---CEEKSR-------------NLSSNVVLD-----------------HMKSEDTIE-SIQLNYLTADLPVTIKHSYNVSEELI--DTIFQLSKEYADGGSKDLFSCNADPRFPNLSELFRLAPAYMFYLLLRSSLGKDQ----------HVSNLINI-IAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDNCE----DVELPRAWIEVVVNTSIQLHDQAF--NGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCD--RGIVSCPKD----LKTMLNALHGLLSYKLNP 2993
            ER RL N IR+WNANRLDLFE+SEPNE LEF+GVMRFF+Q  D K +  TKC+RVSSTATT  +IE +V KF PDM+ML    Y LYE H N ++R++ DNE PL+VQLNW  DD++G+F+LK E       D  N S   +Y   KS   +        +    +                  K++  K    KD+   +  A +L  + PES FTR+ISNP+ VM+RRRQ+KLE +L+QF     +GGTLK+Y ++I P++PYKTLLLS NDTA  V+ E+L+KYGL +ED   Y LVQ  +PP +      G    E+IL D DCPL IL+  P ++GT    ++RR P D    K +          ++        PV  +R                  +P +V+L   N G L    +I  T+    N+ L +           ++GS++S+  S   + L   + P+++P HC I+        VV  T+TPT   +         Y+N Q++ ++T L+   V++ G+   FRF E    E + R             N  +   +D                 H++ +  ++ ++   YL   L   ++ +Y   +  I  +T+   S EY D   + L S          +  F+LAP Y  Y+  R  +  D           H  N + I +A  I + IQ+         FW++N+SELLH L+ D D    +  AQ +L  A++ AF  L    +++L   +PAF+  D+    D   E+ +            GD+       L TLS A +L   C+VN ALTIQ+FSQLFH +N WLFN V+ +        LG    +  WG +L RRLGRV++W+E  GL++AA+CH+ ++ Q   L+ A K    D+      C +   LN  QL  LL+       +  +P+  IE VV+ +    D+    +GG      ++ L ED DL+LP LLP DGYSCD  RG+ +  ++    L   ++ L GLL   ++P
Sbjct:    9 ERQRLTNIIRQWNANRLDLFELSEPNEDLEFHGVMRFFHQDTDSKERVTTKCIRVSSTATTAAVIETLVEKFRPDMRMLTTPVYGLYEVHANGEERRLDDNEKPLLVQLNWNKDDREGRFLLKRE-------DNLNVSGTGDYFEDKSVMQNF------KRKPSKKEKKEEKKKKKKEALAAKGKENSPKVSLPKDDVGEESAAEKLYQELPESGFTRSISNPEAVMRRRRQQKLEKKLQQFMSGPSSGGTLKVYAETIKPEVPYKTLLLSTNDTAAFVVKESLEKYGLDKEDPLDYCLVQVQLPPGSTTVTETGGWGRELILDDDDCPLQILMDWPAQKGTLAFQLKRR-PSDAHGQKRKPKKSKSSSKSSESDSYQDMGPVPQDR------------------LPFMVEL---NPGALLFLSKILCTVIEFRNHFLQFPRLHRLQPNVTEVGSERSSATSGQYLQL---FSPNVKPRHCVIAN----MEGVV--TVTPTNHDAE-------TYVNGQRIYETTMLQHNSVVRFGKMHTFRFCEPVPVEVRLRSCIGDIPPSSGQANFETTFDVDGHIETVSSPVNKVRTTIHIRRQVIVQNNVDFKYLYPYLCRHLQEAYRRGQSNIPFETVLPASIEYRDSTEEQLLS-QVISEVNGAAVQFKLAPTYTLYMAARHRIASDARNVQTAAERLHRLNSMTIRVASMISRTIQEGSAIAGVLAFWMANASELLHFLKMDRDTSRQTQEAQGILGDAVQMAFRYLVQCMTRELRASMPAFL--DESSEADQEDEESL-----------TGDV-------LNTLSSAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKVVMEP------HLG--LCTRMWGLKLKRRLGRVELWAEKQGLELAADCHLCRVIQAAHLLQAPKHSAEDIASISSTCFK---LNSMQLRALLEQYRPDPNEPRIPQDLIESVVSVAENTADELTRSDGG------DVRLEEDSDLQLPFLLPEDGYSCDIVRGVPTGLQEFLDPLVYTISCLTGLLRMNIHP 969          

HSP 2 Score: 64.6994 bits (156), Expect = 2.732e-6
Identity = 34/91 (37.36%), Postives = 50/91 (54.95%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            +RL ++   L L +  A+ +  D   IY+K V+  GA    G++  GDQL+ VDG  L  ++QE A   M +T  TVNL + K  A  HG+
Sbjct: 1007 LRLFEVTVGLSLRVFEAQGAGQDQLGIYVKSVVKGGAADLDGRLAAGDQLLEVDGHNLVGLSQERAAALMTQTGQTVNLKVAKQGAIYHGL 1097          
BLAST of Afadin vs. TrEMBL
Match: A0A2R5LKM4 (Putative actin filament-binding protein afadin OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 440.654 bits (1132), Expect = 1.774e-122
Identity = 385/1273 (30.24%), Postives = 572/1273 (44.93%), Query Frame = 3
Query:   66 ERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKML---NNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF-----SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKND--------RHRGEMP-----------EEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYY-PDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF-----EECEEKSR-NLSSNVVLDHMKSEDTI---ESIQLNY-LTADLPVTIKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSEL----------------------FRLAPAYMFYLLLR-----------SSLGKDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLP-AFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDNCEDVE----LPRAWIEVVVNTSIQLHD-QAFNGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCD--RGIVSCPKDLKTMLN--ALHGLLSYKLNPPILNDVDTRWKSYLGSYEHTPSVSR--SGTIIEQSPIAPLKIDTQHKLPRNWISEDQNSMILSSPD-SQFDSGQYKKSLQTKNTKTYERPQTLPLDNKPVDSSDDSNATEVFKADLKNRYTVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            ER  L N I +WNANRLDLFE+SEPNE LEF+GVMRF++Q  D K  TKC+RVSSTAT +D++  ++ KF PD++ML   +   YALYE H N ++RK+   E PL+VQLNW  DD++G+F+ +    + R   +   S+   +G   S          + + +                                   D   +A +L  + PE+SFTR+ISNP+ VM+RRRQ+KLE +L+QF     +G++E GGTL+I+G+S+N D+PYKTLLLS  DTA  V+ E LDKYG+ +ED   Y LVQ  +PP  +        + R   P           +E IL D DCPL I   +   +GT +  +RRR P D  P K             KK P+T  R  E   +    E    + +P LV+L  +  G  F    +  +                           + VGS P+    +    P I P HC     F     V+  T+TP+   +        +Y++  ++  +T L+   V++ G +  FRF     E     SR N      ++  + +D +   E+ +  + +   +  T  HS++  E L     Q    +++ G        +DP  P + E                       F+LAPAY  Y+  R           S   +   ++ L N I   +   ++          FWL+N+SELLH L+ D  L  ++  AQD+L+ A+++AF+ L +   ++L   LP AF     +      +E  +            G+I       L  L    +L   C+VN ALTIQ+FS LFH +N WLFN ++          +G       +G  L RRL  +  W+E  GL++AA+CH+ ++ Q   L+   K    D+      C +   LN  QL  LL+  +  +    + RA IE VV  +    D QA N G     + + L E+ DL+LP LLP DGYSCD  RG+   P  L+  L   AL GL    L P  +      W  Y+   +    + R   G+ +E +P                 S+    +I+ +    +  S     S Q  +     RP   P  N  V                    T+ L+K N+ +GLSI+AA+    +   IYIK V+  GA  + G+++ GDQL+ VDG  L  I QE+A E M +T   V L + K  A  HG+
Sbjct:   11 ERINLRNVINQWNANRLDLFELSEPNEDLEFHGVMRFYFQDADQKVVTKCIRVSSTATVRDVVLTLIEKFRPDIRMLSMPDYTGYALYEIHENGEERKLGPEEKPLLVQLNWHKDDREGRFLFRRMEDKSRLPTLKVESL--RFGRKLSKREKKDKKKKEKKEM-----------------------------------DRDGIAEKLYTELPETSFTRSISNPEAVMRRRRQQKLEKKLQQFRQENGAGSSEAGGTLRIFGESLNRDVPYKTLLLSTTDTAAHVVKEILDKYGMDKEDPLHYCLVQVLLPPSGETSPLDHMLQQRSSSPPGSIGPIPAGIKEYILDDDDCPLAIERQHNRIKGTLSFHIRRR-PADYQPRK------------RKKRPLT-TRSSEHPGKGNFGERSPPSLLPWLVELRPEGTGEPFRHRLMLGM---------------------------TEVGSAPSADQGLQLQGPGIHPRHC----VFAHTEGVI--TVTPSHHEAE-------IYVDSARIYDTTILQHGSVVRFGRHQAFRFLILHVEPPHVGSRDNSYPPEYMERPRDDDDMLGGETYETAFDVLGSVEATSTHSHHSDEVLSTAPSQQKHSHSESGMD--HRRGSDPILPAVLEFWEEHEGAFLEAVIGQLDWSAAQFKLAPAYTLYMACRYRASTHFRPEISPTERAHRLTALANEIGARVRNTVEAPNGQPGPLAFWLANASELLHFLRQDRHLSAYTLDAQDLLSEAVQRAFAFLVSAHRKELARALPSAFA---PHHQGQAPQEAAV------------GEI-------LSVLGGTMSLLRRCRVNAALTIQLFSWLFHHINVWLFNGLV----------MGTNYCCRAYGAMLKRRLAHLVAWAEKQGLELAADCHLARIIQAAHLLQTSKSTAEDVTSISSACFK---LNSVQLRTLLERYQTTQDEPPVQRALIEGVVKVAENTADEQARNEG-----REVQLEEEADLQLPFLLPEDGYSCDIVRGV---PAGLQEFLQPLALSGLCRLTLQPTSVGF----WTIYMSDQD----ILRPPGGSCVEAAP-----------------SQSHQPVIMGNASRRESSSSPMPNSTQGGHNGNIVRP---PSQNVQV-------------------ATICLQKSNSGMGLSIVAARGVNQEKLGIYIKSVVKGGAADQDGRLQAGDQLLKVDGHSLIGITQEKAAELMTRTGQVVTLEVAKQGAIYHGL 1100          
BLAST of Afadin vs. TrEMBL
Match: A0A2H5BFD4 (Afadin OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 5.795e-122
Identity = 315/969 (32.51%), Postives = 474/969 (48.92%), Query Frame = 3
Query:   66 ERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQT-LRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS---GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMP----EEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNM-----LNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVT----------------IKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSELFRLAPAYMFYLLLR-----------SSLGKDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPE-------WGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELM---VADKRDLNVFGEKCLELVNLNGTQLHFLLDN----CEDVELPRAWIEVVVNTSIQLHDQ 2807
            ER RL  QI EWNANRLDLFE+S PNE LEFYGVMRFF+Q +  K  TKC+RVSSTA TQD++  ++ KF PDM+ML    Y+LYE H N ++RK+   E PL VQLNW  DD++G+F+LK E       D+   S+                NV   QT L  Q +            R   +  +++ +++   ++ + +A++L  + P++ FTR+ISNP+ VM+RRRQ+KLE +L+Q+    G  +TGGTLKIYG+S+N D+PYKTLLLS+ D+A  V+ ETL+KYGL +ED   Y+LVQ  +PP      G        +IIL + +CPL ILV  PP +GT    +RRR             P ++P    KK P          E       +    +P LV++  D             L  L N M     LN +          ++GS ++      +I L   Y  DI+P HC I+      + VV  T+TP         K  L +++ Q +  +T L+    ++ G    +RF +   + + +    V+            + N  TA+   +                +   Y      ID I   + E+ + G +D F           +  F+L P Y  Y+  R           S   +   ++ L+N +A  + Q IQ++K++  +  FW++N+SELLH  + D D+  FS  AQD LA+A++ AF  L      +L   + AF++  D+D+N++         +R +++            ++Q LS A +L   C+VN ALTIQ+FSQLFH +N WLFN ++               + P+       WGERL RRL R++ W+E  GL++AA+CH+ ++ Q   L+    A + D+      C +   LN  QL  LL N      +  +PR  IE +V  +    D+
Sbjct:    9 ERERLIAQINEWNANRLDLFELSLPNENLEFYGVMRFFHQDEGSKVSTKCIRVSSTAATQDVLATLIEKFRPDMRMLTRGEYSLYEVHVNGEERKLDGQERPLFVQLNWGKDDREGRFLLKRE-------DLKTVSL----------------NVMMQQTNLAPQPTEEPQQFKRKLSKREKKELKKKEKEAKIKEQEKENVASKLYNEVPDTGFTRSISNPEAVMRRRRQQKLEKKLQQYKSKDGGPDTGGTLKIYGESLNADVPYKTLLLSITDSAAYVVKETLEKYGLDKEDPNNYMLVQVVVPPGGSEFHGGQGWPGQRDIILDENECPLQILVQFPPSKGTIMFHIRRR-------------PDTMPKKKKKKGPRG------EMEDPGIPRYDGPEKMPFLVEIKND-------------LSELPNGMRYTLPLNVT----------EVGSDKNMAIRGQHIQL---YGNDIKPRHCLIAHT----AGVV--TVTPAS-------KEALTFVDGQVIHDTTMLQHGMTVKFGNKHFYRFIDPGFEEKMMQPPSVVREGIPRGGPPPYEGNMETANFETSFNLDGQVETVAGQDPAMSPPYGNIPPQIDDILPATLEFREDG-EDAFLAAVISEVNGAAVQFKLGPTYTIYMATRFRISMAYRPKMSPEERADRLTALVNKVANLVLQTIQENKDNAVQLSFWMANASELLHFYKQDGDISRFSLDAQDTLANAVQMAFRYLVNCMQSELHHTMLAFLNPSDFDMNEDEFGGGY-EHNRPNLM-----------DVIQVLSSAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLV---------------LEPDLQLCTRAWGERLRRRLARIEAWAEKQGLELAADCHLARIIQAAHLLKEPKASRDDITNISSACFK---LNSLQLRALLQNYIPGPGEPHIPRDLIENLVGVAQSTADE 865          

HSP 2 Score: 81.2629 bits (199), Expect = 3.217e-11
Identity = 50/145 (34.48%), Postives = 71/145 (48.97%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHG----------VMDNILRSKSIKAAMNKK-APTLQKEYSASPKFTSPQSKSLSNKP 3749
            +   K+  S+GLSI+AAK    +   IY+K V+ DGA  + G+++TGDQL+ VDG  L  + QE+A E M +T   V L + K  A  HG          VM     ++    A NK   P   +   + P F     +S S KP
Sbjct:  964 ITFNKVKGSMGLSIVAAKGEGQEKKGIYVKSVVTDGAAAQDGRLQTGDQLLEVDGKSLIGVTQEKAAELMTRTGQVVTLKVAKQGAIYHGLATLLSQPSPVMQRAANNRKSGGAGNKSPGPPRSRSEESMPPFMEGSPRSSSGKP 1108          
BLAST of Afadin vs. TrEMBL
Match: A0A4V3SGF6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002251 PE=4 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 6.534e-122
Identity = 419/1401 (29.91%), Postives = 668/1401 (47.68%), Query Frame = 3
Query:   87 QIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQ-DRKMKDNEHPLIVQLNWAFDDKDGKFILKNESR----RRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFSGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQE-DHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGI--LVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIEN-DTD-VPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFD---------PQSN-------VVRFTL--TPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSS----NVVLDHM-----------------------------KSEDTIE---SIQLNYLT----ADLPVTIKHS---YNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSELFRLAPAYMFYLLLRSS-----------LGKDQH-VSNLINIIAQNIEQVI-------QDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQ---------------DVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPI--QHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVL----------GDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCED-VELPRAWIEVVVNTSIQLHDQAF-------------NGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCDRGIVSCPKDLKTMLNAL--HGLLSYKLNPPILNDVDTR-WKSYL-----------------GSYEHTPSVSRSGTIIEQSPIAPLK--------IDTQHKLPRNWISEDQNSMILSSPDSQFDSGQYK-KSLQTKNT----KTYERPQTLPLDNKPVDSSDDSNATEVFKADLKNRYTVR--LKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKK---TKPTVNLLMEKGAASRHGVMDNILRSKSIKA---AMNKKAPTLQKEYSASPKFTSPQSKSLSNKPVSHAQSHR 3773
            +I+EWNA RLDLF+ISEPN   EF+GV+RFF+QGDD KYQ KCLR+S+T T   L+  +V KF+PD+KML   R+ALYE H    +R++  NE PL+VQLN+A+D+ + +FIL++ES+     R+   + N       G ++  S+  L +           SA     S   F+R  +  SR+K K ++  E  ++   +L+   P+SSFTRT+SNPDEV++RRRQ+++++RL+  +   E    +KIYGDSINP++P+ T+ L+++DTA+KV+A  L+KYGL+++ + + + LVQ NI P+ +R   ++  E  LH+QD  +GI  L+    +  +    +R R    K   KP       P  +  ++P +  +       +     E+ DT+ VP L+++    + +   +  + +L  L +               I++G+ +  VG  PNIL+  + +PDIRP HC  SA            P+S        V  ++L  TP+LD  +R P P  V +N Q++     +  +  IQ+G+    +F   E  +  +      NV L  +                             ++E T E    ++L   +     +LP+TI+         E+ ++   Q+  E  +G   DL +     +  N   LF L+PAY  YL+ R+            L + +H VS + N IA  + + +        D    I+  V+WL+NSSELL   + D +L + S  +Q                +LA A++  F  L+T  +  L  +        D DL ++ R D  P   +       G    PI  Q L+Q LS    L    +VN +LTIQ+F+QLFH LN ++FN  L           D  N     LG +        RL RRL R+K W++  GL+ AA C +Q+  Q  +L+ AD+ +L+ F + C+ L++LN  QL +LL +  D   +P  WI+++V    +++D+A              +  +P+    L L E  DL LPLLLP DGY+ D  +   P  L   L  L   GL+  + NP      D+R W   L                    E  P  SRS + I  SP              D++  LP N                +    QY+ K++ ++ +    +T  + ++LP      D ++        +A++  R   R  L+K NNSLGLSI+AAK   +  + IY+KD++P GA  + G+++ GDQ++A+  A L    Q +AV  + K   ++  V L + +GAA  HG+++ I    S +    A    +P ++  +S  P  T+P     S+ P  HA  H+
Sbjct:   12 RIKEWNATRLDLFKISEPNRRNEFHGVVRFFFQGDDSKYQAKCLRISNTTTACQLVNTLVEKFYPDLKMLTAGRFALYEYHTSSGERRLGANEAPLLVQLNYAYDNNEVRFILRDESKPLPTARQHQALENQPGALQNGTARYRSSQKLVD-----------SAEDSAKSDRGFARRWSSGSRKKKKRKEGQE--EQNGTDLTPV-PDSSFTRTLSNPDEVLRRRRQQRMQNRLQSGTPGEERVDIVKIYGDSINPEVPFVTISLTIDDTADKVVAMALEKYGLIKQVNPKDFCLVQMNIAPRGERLPPDVEREQTLHNQDSLVGIRLLLRRQREDVSCIFQLRHRRATGKDGRKP-----PAPAPVHPRAPPSAFKHGSRTRSSGPGASESTDTESVPYLIEVQSSTDHSSRPDGMVISLAGLFDRTYPAP---------IQLGTIEKMVGPPPNILVDKNLHPDIRPVHCTFSAVLASTSGSKWSIPKSGQPGDFDAVTSYSLLITPSLDGFARPPGPAQVRVNGQRITGPMLVPSDGFIQLGKTMFLKFVYLETDTGRVEEPAKVNVTLPRIANGAPGAYSMKATTMKPLEGHSTPGTRTSQTEKTNEHDSHVRLRKTSVSAAGELPLTIELQDLDRIDREDFLEHYTQIVDEILNGVGSDLHTLTHRTKDENRPALFSLSPAYALYLVYRACEKHMESSPDLVLAEKEHNVSYITNYIATRMYESLPSTTRGPADHMGLIQPFVYWLANSSELLQFFKNDVNLCSPSDKSQPTRSRSPIHACRQALHLLADAVDHCFYELRTCVTSILQPMFHCLTYPGDSDLQEDLRLDDRPINPQQ----ISGHPRDPIKLQTLMQFLSWLMHLLRRTRVNASLTIQLFAQLFHTLNAYIFNHALINTEARPRHTRDEQNIWLTRLGAI--------RLVRRLERIKHWAQRFGLERAAECRLQRCVQACQLIQADRSNLDDFYQFCMGLLSLNSIQLEWLLAHLGDPPPVPDDWIDLIVTGGKEVNDRAILDEMDHYLRASQQDLSIPE----LQLSEIKDLPLPLLLPPDGYASDAVLTGTPSGLSEFLRPLVSKGLIFVRRNPAGTGQSDSRPWIRCLRLSKVEDIEAQSTDEVKRKLEVPPPTSRSASHIPSSPHGESGDNGSDLSDTDSEDSLPTN---------------RRLKQRQYQPKTVNSRKSTLLGQTTRQHRSLP------DLTNSDFGGLAKEANVPVRSITRFYLRKHNNSLGLSIVAAKAEGDTQYGIYVKDIVPGGAADRDGRLDMGDQILAIGSANLVGCAQSDAVATLAKQSQSEEGVLLTVAQGAAKFHGILELIRPPGSERPSPIADETVSPAVKPRHSTKP-LTTP-----SDAPPPHAGPHK 1341          
BLAST of Afadin vs. Ensembl Cavefish
Match: afdna (afadin, adherens junction formation factor a [Source:ZFIN;Acc:ZDB-GENE-050419-52])

HSP 1 Score: 265.774 bits (678), Expect = 4.537e-71
Identity = 191/555 (34.41%), Postives = 290/555 (52.25%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLK--YQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYD-SQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMP-EEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSK-----PRMGPY--SIPID-LTKKSPVTPNRDDESFEQTY-DNEIENDT-DVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q D +   + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +RK+  +E PL+VQLNW  DD++G+F+LKNE+            ++     S        G + +  +TL  +            F+R+        ++ + D+    R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  DTA+  +AE L+KYGL +E+ R Y + +         H  + P +E IL D +CPL I       +      +++R P D +  K      RMGP   S+P + L     ++P R +      Y  +E  +D+ D P+L +L                                      ++GS +S  G   NI L   + P I P HC++       ++ +      ++D+ +        +++ Q+++ +T LR    +Q G   +F+F
Sbjct:    1 MSGSREEERRKLADIINHWNANRLDLFEISQPTEELEFHGVMRFYFQ-DRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERKLDLDEKPLVVQLNWNKDDREGRFVLKNEN-----------DIIPKKAQSNGPEKEKEGVIQNFKRTLSKKEKKKEKKKDKEAFARIPDGDDHALNREDGDS----RLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSGDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAEALEKYGLEKENPREYCIARVV-------HSDDKPVKETILDDTECPLQIFRDWTSDKEALVFQLKKRPP-DYIAKKGRKSDERMGPLHGSLPPEKLPYLVELSPGRGNHYAYYGYRQHEDGSDSRDKPKLYRLQ---------------------------------HSLTEVGSDRSEDG---NIQL---FGPGILPHHCNLM-----HADGLVMVTPVSMDAET--------FVDGQRIQDTTVLRSGMTLQFGAAHVFKF 479          

HSP 2 Score: 153.295 bits (386), Expect = 1.238e-36
Identity = 101/316 (31.96%), Postives = 156/316 (49.37%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  +            +   V  ++N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      DL   +PAF+  DD +  +  R                      I+ +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ +S +     L     S  WG  L ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  DK   +D+      C +   LN  QL+ L+ N  C   E  +P   I+ VV  +    D+
Sbjct:  597 FKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDKDLSRITLDAQDVLAHLVQMAFKYLVHCLQSDLNNYMPAFL--DDPEEQNPQRPK--------------------IEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTESDS----GL----CSHYWGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSVQDVQNINNTCFK---LNSLQLNALMSNYHCAPDEPYIPHELIDHVVAVAENTADE 879          

HSP 3 Score: 56.225 bits (134), Expect = 4.815e-7
Identity = 28/65 (43.08%), Postives = 38/65 (58.46%), Query Frame = 3
Query: 3426 IYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG+
Sbjct:  976 IYIKSVVKGGAADMDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVVTLEVAKQGAIYHGL 1040          
BLAST of Afadin vs. Ensembl Cavefish
Match: afdna (afadin, adherens junction formation factor a [Source:ZFIN;Acc:ZDB-GENE-050419-52])

HSP 1 Score: 265.774 bits (678), Expect = 5.688e-71
Identity = 190/557 (34.11%), Postives = 288/557 (51.71%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLK--YQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYD-SQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMP-EEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSK-----PRMGPY--SIPID-LTKKSPVTPNRDDE----SFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q D +   + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H   +RK+  +E PL+VQLNW  DD++G+F+LKNE           + ++     S        G + +  +TL  +            F+R+        ++ + D+    R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  DTA+  +AE L+KYGL +E+ R Y + +         H  + P +E IL D +CPL I       +      +++R P D +  K      RMGP   S+P + L     ++P R +      + Q  D    +  D P+L +L                                      ++GS +S  G   NI L   + P I P HC++       ++ +      ++D+ +        +++ Q+++ +T LR    +Q G   +F+F
Sbjct:    1 MSGSREEERRKLADIINHWNANRLDLFEISQPTEELEFHGVMRFYFQ-DRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERKLDLDEKPLVVQLNWNKDDREGRFVLKNE-----------NDIIPKKAQSNGPEKEKEGVIQNFKRTLSKKEKKKEKKKDKEAFARIPDGDDHALNREDGDS----RLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSGDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAEALEKYGLEKENPREYCIARVV-------HSDDKPVKETILDDTECPLQIFRDWTSDKEALVFQLKKRPP-DYIAKKGRKSDERMGPLHGSLPPEKLPYLVELSPGRGNHYAYYGYRQHEDG--SDSRDKPKLYRLQ---------------------------------HSLTEVGSDRSEDG---NIQL---FGPGILPHHCNLM-----HADGLVMVTPVSMDAET--------FVDGQRIQDTTVLRSGMTLQFGAAHVFKF 479          

HSP 2 Score: 149.058 bits (375), Expect = 2.591e-35
Identity = 100/323 (30.96%), Postives = 159/323 (49.23%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKE-------VFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  +            +   V  ++N +   +E VIQ+  +  +K+        FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      DL   +PAF+D  D +  +  R                      I+ +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ +S +     L     S  WG  L ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  DK   +D+      C +   LN  QL+ L+ N  C   E  +P   I+ VV  +    D+
Sbjct:  601 FKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQEIADGDQKQKNIAGALAFWMANASELLNFIKQDKDLSRITLDAQDVLAHLVQMAFKYLVHCLQSDLNNYMPAFLD--DPEEQNPQRPK--------------------IEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTESDS----GL----CSHYWGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSVQDVQNINNTCFK---LNSLQLNALMSNYHCAPDEPYIPHELIDHVVAVAENTADE 890          

HSP 3 Score: 74.7146 bits (182), Expect = 1.165e-12
Identity = 41/92 (44.57%), Postives = 56/92 (60.87%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            TV LKK +N +GLSI+AAK +  +   IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG+
Sbjct:  985 TVTLKK-HNGMGLSIVAAKGAGQEKLGIYIKSVVKGGAADMDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVVTLEVAKQGAIYHGL 1075          
BLAST of Afadin vs. Ensembl Cavefish
Match: afdna (afadin, adherens junction formation factor a [Source:ZFIN;Acc:ZDB-GENE-050419-52])

HSP 1 Score: 263.462 bits (672), Expect = 3.073e-70
Identity = 190/558 (34.05%), Postives = 290/558 (51.97%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLK--YQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYD-SQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMP-EEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSK-----PRMGPY--SIPID-LTKKSPVTPNRDDE----SFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q D +   + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H + ++RK+  +E PL+VQLNW  DD++G+F+LKNE           + ++     S        G + +  +TL  +            F+R+        ++ + D+    R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  DTA+  +AE L+KYGL +E+ R Y + +         H  + P +E IL D +CPL I       +      +++R P D +  K      RMGP   S+P + L     ++P R +      + Q  D    +  D P+L +L                                      ++GS +S  G   NI L   + P I P HC++       ++ +      ++D+ +        +++ Q+++ +T LR    +Q G   +F+F
Sbjct:    1 MSGSREEERRKLADIINHWNANRLDLFEISQPTEELEFHGVMRFYFQ-DRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERKLDLDEKPLVVQLNWNKDDREGRFVLKNE-----------NDIIPKKAQSNGPEKEKEGVIQNFKRTLSKKEKKKEKKKDKEAFARIPDGDDHALNREDGDS----RLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSGDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAEALEKYGLEKENPREYCIARVV-------HSDDKPVKETILDDTECPLQIFRDWTSDKEALVFQLKKRPP-DYIAKKGRKSDERMGPLHGSLPPEKLPYLVELSPGRGNHYAYYGYRQHEDG--SDSRDKPKLYRLQ---------------------------------HSLTEVGSDRSEDG---NIQL---FGPGILPHHCNLM-----HADGLVMVTPVSMDAET--------FVDGQRIQDTTVLRSGMTLQFGAAHVFKF 480          

HSP 2 Score: 154.836 bits (390), Expect = 4.353e-37
Identity = 101/316 (31.96%), Postives = 156/316 (49.37%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  +            +   V  ++N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      DL   +PAF+  DD +  +  R                      I+ +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ +S +     L     S  WG  L ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  DK   +D+      C +   LN  QL+ L+ N  C   E  +P   I+ VV  +    D+
Sbjct:  602 FKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDKDLSRITLDAQDVLAHLVQMAFKYLVHCLQSDLNNYMPAFL--DDPEEQNPQRPK--------------------IEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTESDS----GL----CSHYWGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSVQDVQNINNTCFK---LNSLQLNALMSNYHCAPDEPYIPHELIDHVVAVAENTADE 884          

HSP 3 Score: 74.7146 bits (182), Expect = 1.101e-12
Identity = 41/92 (44.57%), Postives = 56/92 (60.87%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            TV LKK +N +GLSI+AAK +  +   IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG+
Sbjct:  979 TVTLKK-HNGMGLSIVAAKGAGQEKLGIYIKSVVKGGAADMDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVVTLEVAKQGAIYHGL 1069          
BLAST of Afadin vs. Ensembl Cavefish
Match: afdna (afadin, adherens junction formation factor a [Source:ZFIN;Acc:ZDB-GENE-050419-52])

HSP 1 Score: 263.462 bits (672), Expect = 3.073e-70
Identity = 190/558 (34.05%), Postives = 290/558 (51.97%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLK--YQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYD-SQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMP-EEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSK-----PRMGPY--SIPID-LTKKSPVTPNRDDE----SFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q D +   + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H + ++RK+  +E PL+VQLNW  DD++G+F+LKNE           + ++     S        G + +  +TL  +            F+R+        ++ + D+    R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  DTA+  +AE L+KYGL +E+ R Y + +         H  + P +E IL D +CPL I       +      +++R P D +  K      RMGP   S+P + L     ++P R +      + Q  D    +  D P+L +L                                      ++GS +S  G   NI L   + P I P HC++       ++ +      ++D+ +        +++ Q+++ +T LR    +Q G   +F+F
Sbjct:    1 MSGSREEERRKLADIINHWNANRLDLFEISQPTEELEFHGVMRFYFQ-DRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERKLDLDEKPLVVQLNWNKDDREGRFVLKNE-----------NDIIPKKAQSNGPEKEKEGVIQNFKRTLSKKEKKKEKKKDKEAFARIPDGDDHALNREDGDS----RLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSGDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAEALEKYGLEKENPREYCIARVV-------HSDDKPVKETILDDTECPLQIFRDWTSDKEALVFQLKKRPP-DYIAKKGRKSDERMGPLHGSLPPEKLPYLVELSPGRGNHYAYYGYRQHEDG--SDSRDKPKLYRLQ---------------------------------HSLTEVGSDRSEDG---NIQL---FGPGILPHHCNLM-----HADGLVMVTPVSMDAET--------FVDGQRIQDTTVLRSGMTLQFGAAHVFKF 480          

HSP 2 Score: 154.836 bits (390), Expect = 4.353e-37
Identity = 101/316 (31.96%), Postives = 156/316 (49.37%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  +            +   V  ++N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      DL   +PAF+  DD +  +  R                      I+ +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ +S +     L     S  WG  L ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  DK   +D+      C +   LN  QL+ L+ N  C   E  +P   I+ VV  +    D+
Sbjct:  602 FKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDKDLSRITLDAQDVLAHLVQMAFKYLVHCLQSDLNNYMPAFL--DDPEEQNPQRPK--------------------IEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTESDS----GL----CSHYWGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSVQDVQNINNTCFK---LNSLQLNALMSNYHCAPDEPYIPHELIDHVVAVAENTADE 884          

HSP 3 Score: 74.7146 bits (182), Expect = 1.101e-12
Identity = 41/92 (44.57%), Postives = 56/92 (60.87%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            TV LKK +N +GLSI+AAK +  +   IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG+
Sbjct:  979 TVTLKK-HNGMGLSIVAAKGAGQEKLGIYIKSVVKGGAADMDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVVTLEVAKQGAIYHGL 1069          
BLAST of Afadin vs. Ensembl Cavefish
Match: afdna (afadin, adherens junction formation factor a [Source:ZFIN;Acc:ZDB-GENE-050419-52])

HSP 1 Score: 263.462 bits (672), Expect = 3.535e-70
Identity = 188/553 (34.00%), Postives = 290/553 (52.44%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLK--YQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYD-SQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMP-EEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSK-----PRMGPY--SIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRF 1658
            M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q D +   + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H + ++RK+  +E PL+VQLNW  DD++G+F+LKNE           + ++     S        G + +  +TL  +            F+R+        ++ + D+    R+AAE+    PE+SFTRTISNP+ VMKRRRQ+KLE R+++F    G  ++GGTL+IY DS+ P+IPYKT+LLS  DTA+  +AE L+KYGL +E+ R Y + +         H  + P +E IL D +CPL I       +      +++R P D +  K      RMGP   S+P +                             +P LV+LS D   +  ++ +++ L+                    ++GS +S  G   NI L   + P I P HC++       ++ +      ++D+ +        +++ Q+++ +T LR    +Q G   +F+F
Sbjct:    1 MSGSREEERRKLADIINHWNANRLDLFEISQPTEELEFHGVMRFYFQ-DRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERKLDLDEKPLVVQLNWNKDDREGRFVLKNE-----------NDIIPKKAQSNGPEKEKEGVIQNFKRTLSKKEKKKEKKKDKEAFARIPDGDDHALNREDGDS----RLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSGDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAEALEKYGLEKENPREYCIARVV-------HSDDKPVKETILDDTECPLQIFRDWTSDKEALVFQLKKRPP-DYIAKKGRKSDERMGPLHGSLPPE----------------------------KLPYLVELSPDGSDSR-DKPKLYRLQ----------------HSLTEVGSDRSEDG---NIQL---FGPGILPHHCNLM-----HADGLVMVTPVSMDAET--------FVDGQRIQDTTVLRSGMTLQFGAAHVFKF 465          

HSP 2 Score: 154.836 bits (390), Expect = 4.225e-37
Identity = 101/316 (31.96%), Postives = 156/316 (49.37%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADK---RDLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            F+L+P Y+ Y+  R  +            +   V  ++N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQDVLA  ++ AF  L      DL   +PAF+  DD +  +  R                      I+ +L TL+ A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ +S +     L     S  WG  L ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  DK   +D+      C +   LN  QL+ L+ N  C   E  +P   I+ VV  +    D+
Sbjct:  587 FKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDKDLSRITLDAQDVLAHLVQMAFKYLVHCLQSDLNNYMPAFL--DDPEEQNPQRPK--------------------IEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTESDS----GL----CSHYWGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSVQDVQNINNTCFK---LNSLQLNALMSNYHCAPDEPYIPHELIDHVVAVAENTADE 869          

HSP 3 Score: 74.7146 bits (182), Expect = 1.166e-12
Identity = 41/92 (44.57%), Postives = 56/92 (60.87%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            TV LKK +N +GLSI+AAK +  +   IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG+
Sbjct:  964 TVTLKK-HNGMGLSIVAAKGAGQEKLGIYIKSVVKGGAADMDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVVTLEVAKQGAIYHGL 1054          
BLAST of Afadin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009066.1 (pep scaffold:Pmarinus_7.0:GL479913:2065:18580:1 gene:ENSPMAG00000008193.1 transcript:ENSPMAT00000009066.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.398 bits (298), Expect = 2.727e-27
Identity = 111/367 (30.25%), Postives = 169/367 (46.05%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLLR---SSLGK------------DQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCE----DVELPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCDRGIVSCPKDLKTMLN 2957
            F L PAY  Y   R   SS G              QH++ L    A  IE  +Q     +    FW++N+SELLH L+ D DLR  +  AQ++L+SA+  AFS L      +L + LP F+  D   L     +                     I  +L  L+   ++    + N AL +Q+F+++F L+  WLFNS+L D        LG    S  W   L RRL  +  W+E  GL+ AA CH+  + Q TEL+   K +++   E  +    LN  Q+  LL+  +    + ++P+  IE VV+ +    D  +       ++ +   E L+LRLP L+P DGY+C+ G+ + P  L   L 
Sbjct:  248 FSLGPAYTIYSACRFLLSSQGSCSLPSQQQQRRRHQHIAYLTEGAASRIEGTVQASGRDMMVSGFWMANTSELLHFLEQDGDLRPLTLPAQEMLSSAVHTAFSNLVECLKTELSVRLPVFLQ-DPQTLTAGAPQ---------------------IGPVLSLLTEVMSMLRTFKTNPALLVQIFARVFTLIAGWLFNSLLSDV------DLGLR--SRYWATTLQRRLLPLARWAEGQGLERAAACHLAHIVQATELLTMRKYEVSDVREILVTCYRLNSLQMRALLETYQYAPDEPKIPQEVIEQVVSVTRDTTDAVWL----SQQQEVSRLESLELRLPFLVPGDGYACE-GLAAIPAGLHQFLQ 579          

HSP 2 Score: 62.7734 bits (151), Expect = 7.013e-10
Identity = 36/89 (40.45%), Postives = 49/89 (55.06%), Query Frame = 3
Query: 3366 NNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNI 3632
               LG SI+AAK        IYIK +I  GA    G+I  GDQL++++G  L  I+++ AVE M KT   V L + K AA  H + D +
Sbjct:  635 RQGLGFSIVAAKGPRQANIGIYIKSIIKGGAADLDGRIARGDQLLSINGTSLIGISEKRAVEIMMKTGSVVALDIAKNAALFHNLADTL 723          
BLAST of Afadin vs. Ensembl Sea Lamprey
Match: lin7a (lin-7 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-040426-1665])

HSP 1 Score: 59.6918 bits (143), Expect = 4.665e-10
Identity = 32/82 (39.02%), Postives = 49/82 (59.76%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLM 3590
             V L K +  LG +IM  K   N P  IYI  +IP G   + G ++ GDQL++V+G  +E  + E+AVE +K+ + TV L++
Sbjct:   80 VVELPKTDEGLGFNIMGGK-EQNSP--IYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHEKAVELLKQAQGTVKLVV 158          
BLAST of Afadin vs. Ensembl Sea Lamprey
Match: LIN7B (lin-7 homolog B, crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:17788])

HSP 1 Score: 57.3806 bits (137), Expect = 2.347e-9
Identity = 30/81 (37.04%), Postives = 48/81 (59.26%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLM 3590
            V L K +  LG ++M  K   N P  IYI  +IP G   + G ++ GDQL++V+G  +E  + E AVE +K+ + +V L++
Sbjct:   71 VELPKTDEGLGFNVMGGK-EQNSP--IYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHERAVELLKQAQGSVKLVV 148          
BLAST of Afadin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001593.1 (pep scaffold:Pmarinus_7.0:GL476350:451250:469638:1 gene:ENSPMAG00000001437.1 transcript:ENSPMAT00000001593.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.477e-8
Identity = 38/128 (29.69%), Postives = 68/128 (53.12%), Query Frame = 3
Query: 3327 DLKNRYTVRLKKINNSLGLSIMAAKC---SPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQKEYSA 3701
            +L + + V L K +  LG+SI+       S  +   I++K VI  GA +K G+I+  DQ+V VDG  L  ++Q  A   +K TK  V  L+ +    +   + +IL  +++ A   ++   LQ+++S+
Sbjct:  127 ELMDVFPVELNKGDGGLGISIIGMGVGIDSGIEKLGIFVKSVIDGGAAHKDGRIKENDQIVEVDGTSLVGVSQHFAASVLKNTKGLVKFLIGREQEGQKNCVCSILM-QTLPAEKKQQEEPLQQDHSS 253          
BLAST of Afadin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001597.1 (pep scaffold:Pmarinus_7.0:GL476350:451394:472918:1 gene:ENSPMAG00000001437.1 transcript:ENSPMAT00000001597.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 2.406e-8
Identity = 38/128 (29.69%), Postives = 68/128 (53.12%), Query Frame = 3
Query: 3327 DLKNRYTVRLKKINNSLGLSIMAAKC---SPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQKEYSA 3701
            +L + + V L K +  LG+SI+       S  +   I++K VI  GA +K G+I+  DQ+V VDG  L  ++Q  A   +K TK  V  L+ +    +   + +IL  +++ A   ++   LQ+++S+
Sbjct:   79 ELMDVFPVELNKGDGGLGISIIGMGVGIDSGIEKLGIFVKSVIDGGAAHKDGRIKENDQIVEVDGTSLVGVSQHFAASVLKNTKGLVKFLIGREQEGQKNCVCSILM-QTLPAEKKQQEEPLQQDHSS 205          
BLAST of Afadin vs. Ensembl Nematostella
Match: EDO32442 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV26])

HSP 1 Score: 391.734 bits (1005), Expect = 2.202e-114
Identity = 327/1044 (31.32%), Postives = 497/1044 (47.61%), Query Frame = 3
Query:   66 ERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF-SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTD----VPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEEC----EEKSRNLSS----------------------------------NVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYN--------------VSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSELFRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVD-GDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKR---DLNVFGEKCLELVNLNGTQLHFLLDN---CEDVELPRAWIEVVVNTSIQLHDQ-AFNGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCD--RGIVSCPKDLKTMLNAL 2963
            ER  L   I EWNA+RLD+F ISEP E LE+ GVMRFF+Q    K  TKC+R+SS   T D+ + +V KFHPDMKML N  Y+LYE H     K+K  +HPL +QL W  DD++G+F+LK++                     K      L     +Q L+ + S                +++++    + D   AQ +  EL    PE+SFTR+ISNP+ VM+RRRQ+KLE +L++F S  +  GGTLKI+ +++ P+IPYKTLL+SV++    ++ E L KY + +ED   Y LV  NIPP+       + +E ++HD+DCPL I V  P  RG+    +RRR  + K     R            KSP      D S +++    +   T     +P L +LS D      E D    +  L  N+ +  S ++            SA GS+  ++      P I P HC I+   D      R ++TP+   +        V+++ ++V ++T L+  DV++ G   +FRF  C    EEK +  S+                                  N V D +  + ++    +   T D+   + ++Y+              V ++L  T+     E+ + G +D F          L+  F+LAP Y  Y+  R  +            K + +   I  IA      I+++ +      FW++N SELLH ++ D D+  ++  +Q VLA +++ AF  L      +L   LPAF+D  DD D+ D+  E   P +               I HL  T+S    L   C+VN ALTIQ+FSQLFH +N WLFN ++ +        LG    S EWG R+++RL RV+ W+   GL++AA+CH+ ++ Q   L+ A K    D+N     C +   LN  Q+  LL +    +D  L + +I+ VV  +    DQ A+  G     + + L ED +L+LP LLP DGYSC+  RG+   P+ L+  L  L
Sbjct:   10 EREYLLKLIEEWNASRLDIFAISEPTEDLEYRGVMRFFFQDSGSKVATKCVRISSKDNTDDVTKILVDKFHPDMKMLTNPSYSLYEVHPNGAHKLKATDHPLRIQLEWQLDDREGRFLLKSDQ-------------------DKIVHAKNLFEGEQNQNLKRRLSKREKKQMKK----KREEEAKKVKAGKDDTAIAQHLYDEL----PETSFTRSISNPEAVMRRRRQQKLEKKLKEFESRESAPGGTLKIFAETLKPEIPYKTLLVSVDEITTNIVKEALVKYNMEKEDPEEYCLVMVNIPPEGSNTSATLGKERVVHDEDCPLRIAVTWPENRGSVAFHLRRRANLPKYRRDKR----------RSKSPTRSPMQDVSPDKSVAERLAKSTYPQHLLPYLQELSPDGR----ELDHKPEIHRLQMNVTDVGSESL-----------MSAGGSHLQLVA-----PHILPRHCVIT-NMDG-----RVSVTPSNGDAE-------VFVDGKRVYETTTLQHGDVVKFGRVHVFRF--CDPAYEEKHKRHSAPGGDRGSASSLSDSEGHRGGRQRSSGPALRSHHENHVEDSVDFDTSVHKDGMFETTFDVDGDLPYTYDRLPPSPSSPKSPNSVRDKLPATL-----EFRESG-EDAFFAAVISEVNGLAVHFKLAPTYTLYMCSRYRMSSAYRPELMPQQKAERLGVTIMKIANMARSTIRENSHMPGSLAFWMANCSELLHFIKEDIDISPYTKDSQSVLAKSVQLAFRHLVLCIQHELRNSLPAFLDQSDDADVEDSDMEANRPTVSEV------------IYHLSSTMS----LLRRCRVNAALTIQVFSQLFHFINMWLFNKLVLEP------KLG--LCSREWGRRISKRLRRVEDWALRQGLELAADCHLGRIEQAAYLLQAPKSSPADINAISSSCFK---LNSVQMRTLLQSYRPTQDEYLSQEFIDRVVAIAEDTADQTAYKSG-----QEITLEEDPELQLPFLLPEDGYSCEVIRGV---PQGLREFLEPL 940          

HSP 2 Score: 73.559 bits (179), Expect = 7.590e-13
Identity = 37/91 (40.66%), Postives = 54/91 (59.34%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGV 3620
            +   K    +GLSI+AAK +  D   IYIK V+ DG   K G+++ GDQL+AV+G  L  ++QE+A E M ++   V L + K  A  HG+
Sbjct:  988 ITFNKGRGGMGLSIVAAKGAGQDRLGIYIKQVVKDGPAAKDGRLQAGDQLIAVNGESLIGVSQEKAAECMVRSGANVTLRIVKQGAIYHGL 1078          
BLAST of Afadin vs. Ensembl Nematostella
Match: EDO30290 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T176])

HSP 1 Score: 62.7734 bits (151), Expect = 6.502e-10
Identity = 96/468 (20.51%), Postives = 176/468 (37.61%), Query Frame = 3
Query: 1449 PDIRPTHCHISAKFDPQSNV------VRFT--LTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEE---------------CEEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSELFRLAPAYMFYLLLRSSLGK--DQHVSNLINIIAQNIEQVI----QDDKNSIEKE-----------------VFWLSNSSELLHLLQCDNDLRNFSGSA------QDVLASAIEQA---------FSILQTQF--SQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDL 2663
            PD+ P HC +S K +   NV      V F   L P  D+        L+ +N   V    KL   D++ +GE ++F F++                 +KS  L  +     +  +D  + I+  Y  AD            E ++  +  L  E                      +++ L PAY+  L ++ S     D     L+  IA  I+ ++     D  N+I+K+                 + W++N  E+LH LQ +  L  + G+A      ++ L SA E+          +S  QT +  ++ L + LP  +D + +   D+         D+A      G     +  ++   +  + L   C V+  ++ Q+F+ LF   N  LFN+++   +                G ++   L  ++ W+   GL      ++Q++S   +L+   K  L
Sbjct:    7 PDVLPHHCILSKKVETSGNVDLDECEVNFVVYLEPYKDA--------LIRVNGVSVVTPIKLTPGDLVSLGEYYVFMFKDPTHTLDKELKLHWLDVLQKSHALHKDGDYSVVNGDDQTDKIRFPYKVAD-----------EERMLQVVMGLVDE---------------------DDIYPLTPAYLLLLAVKHSATHHTDTQTRQLLLRIANAIQTIVWEKTSDMSNTIDKDTAPSKALLELLPQLRPVICWMANCLEMLHYLQAN--LSRYLGNASHLSGGEEALLSADEEMLICLEEVVMYSFQQTVYHLTKVLYVALPVILDTNPFQFEDDD--------DQA------GKHPQEVDMVVGIFNSTHFLLRGCGVHEDISRQLFAYLFFFANASLFNTLMERGAGGKFYRWAK-------GAQIRGNLDALEAWASQVGLQDEYVHYLQRLSTAVDLLATPKVQL 411          
BLAST of Afadin vs. Ensembl Nematostella
Match: EDO33706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG3])

HSP 1 Score: 63.929 bits (154), Expect = 7.818e-10
Identity = 36/110 (32.73%), Postives = 60/110 (54.55%), Query Frame = 3
Query: 3261 LPLDNKPVDSSDDSNATEVFKADLKNRYTVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLM 3590
            LP+       SDD   +E   + L+ +  + L++    LG SI+    SP+    IY+K V P GA  + G+++ GDQ++AV+G  L  ++ E AV  +KKT+  + L +
Sbjct: 1726 LPVQQDSPSQSDDEEESE---SPLQTKI-IELERGPEGLGFSIVGGHGSPHGDLPIYVKTVFPTGAASRDGRLKRGDQIIAVNGQSLVGVSHESAVSQLKKTRGKIILTV 1831          

HSP 2 Score: 53.5286 bits (127), Expect = 9.661e-7
Identity = 31/110 (28.18%), Postives = 57/110 (51.82%), Query Frame = 3
Query: 3312 EVFKADLKNRY------TVRLKKIN-NSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLED-INQEEAVEFMKKTKPTVNLLMEKGAASRHG 3617
            E F+A ++         TV L K     LG S++  K        I+I+++  +G   + G++   DQ++++DG  L+  I+ EEA+  ++KT+  V L++ +G   R G
Sbjct:  147 EAFQAKIEGLAQGREVETVVLNKPGQGGLGFSVVGLKSENRGELGIFIQEIQEEGVAGRDGRLRESDQILSIDGQQLDSGISHEEAIVLLQKTRGEVELIVARGGIPRTG 256          
BLAST of Afadin vs. Ensembl Nematostella
Match: EDO27952 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DUS2])

HSP 1 Score: 60.4622 bits (145), Expect = 7.654e-9
Identity = 24/83 (28.92%), Postives = 51/83 (61.45%), Query Frame = 3
Query: 3348 VRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEK 3596
            + + K+N S GL++       +D   I++K ++P GA    GKI+ GD++  ++   +E +N+++AVE ++++  T  L++E+
Sbjct:  740 IEIPKLNGSFGLNVTGG----HDLGGIFVKSLLPGGAAEASGKIKVGDRITEINSVSMEGLNRKQAVELLRRSAATATLMIER 818          
BLAST of Afadin vs. Ensembl Nematostella
Match: EDO47722 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN6])

HSP 1 Score: 56.6102 bits (135), Expect = 1.149e-8
Identity = 29/82 (35.37%), Postives = 49/82 (59.76%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLM 3590
             V L K +  LG ++M  +   N P  IYI  +IP G   + G ++ GDQL++V+G  +E  N E+AV+ +K+ + +V L++
Sbjct:   92 VVELPKTDEGLGFNVMGGR-EQNSP--IYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGENHEKAVDLLKEAQGSVRLVV 170          
BLAST of Afadin vs. Ensembl Medaka
Match: afdna (afadin, adherens junction formation factor [Source:NCBI gene;Acc:101169758])

HSP 1 Score: 385.185 bits (988), Expect = 1.363e-108
Identity = 301/974 (30.90%), Postives = 454/974 (46.61%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLK--YQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIEN---DTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYY-PDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEEC---EEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSEL----------------------FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVAD---KRDLNVFGEKCLELVNLNGTQLHFLLDN--CEDVE--LPRAWIEVVVNTSIQLHDQ 2807
            M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q D +   + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H + ++R++  +E PL+VQLNW  DD++G+F+LKNE+        +N       G+ ++            +TL  +           F       +     +   D E++ R+AAE+    PE+SFTRTISNP+ VMKRRRQ+K+E R++ F    G  ++GGTL+IY DS+ P+IPYKTLL SV DTA+ V+ E L+KYGL +E+ R + + +Q           +  +E+IL D +CPL IL   P  RG                             L KK P    R     E       E       +P LV+LS    GN +     +  +   +      S + +  K  ++    + VGS       I    P + P HC++        +    T+TP    +         +I++Q+V ++T L     +Q G   +F+F +    +   R+  S +   H         +  +  +     T K S  +  E       +  E  D  S+D  +   +   P   E                       F+L+P Y+ Y+  R  L            +   V  ++N +   +E VIQ  KN      FW++N+SELL+ ++ D DL   +  AQD+LA  ++ AF  L      DL   +PAF+D D  + N  + +                     I+ +L TLS A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D+ +              WG  L ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  +   K D+      C +   LN  QLH LL N  C   E  +P   I  VV  +    D+
Sbjct:    1 MSGTREEERRKLADIINHWNANRLDLFEISQPTEDLEFHGVMRFYFQ-DRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERQLDLDEKPLVVQLNWNKDDREGRFVLKNENDVPPKKSQSNGPEREKDGVIQNFK----------RTLSKKEKKKEKKREKEFIRMPDEDERTLGRE---DGENS-RLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKVEKRMQDFINNDGRPDSGGTLRIYADSLKPNIPYKTLLCSVRDTADLVVVEALEKYGLEKENPREFCIARQE---------EKTGKEVILDDSECPLQILRDWPADRGVLVF------------------------QLKKKPPDYQGRKGRKMEDKGLRGKEGLLPPEKLPYLVELS-PGRGNHYA---YYAYRHPEDG-----SDSRDKPKMYRLQQSITEVGSDCTDDGAIQLLGPGVLPHHCNL------MHSEGMVTVTPHGPDAE-------TFIDRQRVTETTVLHSGSTLQFGSAHVFKFVDPLFDQGGKRDPPSAMRGRHKSGSVPENDLHRDVHSGAALPTSKSSGKLEMERGMVKPMIRGEQLDSRSQDALAERTELCLPASIEFRENSEDTFLSAIINYTNSSTVHFKLSPTYVLYMACRFVLSPAYRPDISPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDILAHLVQMAFKYLVHCLQADLNNYMPAFLD-DPEEHNPQSPK---------------------IEDVLHTLSGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTDADSGLCCHY--------WGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMNKYSKEDVQNIHSTCFK---LNSLQLHALLTNYHCAQGEPYIPPELINEVVAVAENTADE 871          

HSP 2 Score: 75.485 bits (184), Expect = 5.995e-13
Identity = 44/115 (38.26%), Postives = 64/115 (55.65%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK +N +GLSI+AAK +  +   IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct:  967 TVTLKK-HNGMGLSIVAAKGAGQEKLGIYIKSVVKGGAADNDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGAVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1070          
BLAST of Afadin vs. Ensembl Medaka
Match: afdna (afadin, adherens junction formation factor [Source:NCBI gene;Acc:101169758])

HSP 1 Score: 383.259 bits (983), Expect = 5.646e-108
Identity = 293/952 (30.78%), Postives = 448/952 (47.06%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLK--YQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIEN---DTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEEC---EEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSEL----------------------FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKE-------VFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVAD---KRDLNVFGEKCLELVNLNGTQLHFLLDN 2735
            M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q D +   + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H + ++R++  +E PL+VQLNW  DD++G+F+LKNE+        +N       G+ ++            +TL  +           F       +     +   D E++ R+AAE+    PE+SFTRTISNP+ VMKRRRQ+K+E R++ F    G  ++GGTL+IY DS+ P+IPYKTLL SV DTA+ V+ E L+KYGL +E+ R + + +Q           +  +E+IL D +CPL IL   P  RG                             L KK P    R     E       E       +P LV+LS D   +  ++ +++ L+                    ++GS  +  G+   I L     P + P HC++        +    T+TP    +         +I++Q+V ++T L     +Q G   +F+F +    +   R+  S +   H         +  +  +     T K S  +  E       +  E  D  S+D  +   +   P   E                       F+L+P Y+ Y+  R  L            +   V  ++N +   +E VIQD +   +K+        FW++N+SELL+ ++ D DL   +  AQD+LA  ++ AF  L      DL   +PAF+D D  + N  + +                     I+ +L TLS A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D+ +              WG  L ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  +   K D+      C +   LN  QLH LL N
Sbjct:    1 MSGTREEERRKLADIINHWNANRLDLFEISQPTEDLEFHGVMRFYFQ-DRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERQLDLDEKPLVVQLNWNKDDREGRFVLKNENDVPPKKSQSNGPEREKDGVIQNFK----------RTLSKKEKKKEKKREKEFIRMPDEDERTLGRE---DGENS-RLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKVEKRMQDFINNDGRPDSGGTLRIYADSLKPNIPYKTLLCSVRDTADLVVVEALEKYGLEKENPREFCIARQE---------EKTGKEVILDDSECPLQILRDWPADRGVLVF------------------------QLKKKPPDYQGRKGRKMEDKGLRGKEGLLPPEKLPYLVELSPDGSDSR-DKPKMYRLQQ----------------SITEVGSDCTDDGA---IQL---LGPGVLPHHCNL------MHSEGMVTVTPHGPDAE-------TFIDRQRVTETTVLHSGSTLQFGSAHVFKFVDPLFDQGGKRDPPSAMRGRHKSGSVPENDLHRDVHSGAALPTSKSSGKLEMERGMVKPMIRGEQLDSRSQDALAERTELCLPASIEFRENSEDTFLSAIINYTNSSTVHFKLSPTYVLYMACRFVLSPAYRPDISPSERTHKVIAIVNKMVSMMEGVIQDMREGDQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDILAHLVQMAFKYLVHCLQADLNNYMPAFLD-DPEEHNPQSPK---------------------IEDVLHTLSGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTDADSGLCCHY--------WGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMNKYSKEDVQNIHSTCFK---LNSLQLHALLTN 835          

HSP 2 Score: 75.8702 bits (185), Expect = 5.368e-13
Identity = 44/115 (38.26%), Postives = 64/115 (55.65%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK +N +GLSI+AAK +  +   IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct:  959 TVTLKK-HNGMGLSIVAAKGAGQEKLGIYIKSVVKGGAADNDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGAVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1062          
BLAST of Afadin vs. Ensembl Medaka
Match: afdna (afadin, adherens junction formation factor [Source:NCBI gene;Acc:101169758])

HSP 1 Score: 382.104 bits (980), Expect = 1.418e-107
Identity = 294/953 (30.85%), Postives = 447/953 (46.90%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLK--YQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESH-NLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQF---SGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIEN---DTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYY-PDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEEC---EEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSEL----------------------FRLAPAYMFYLLLRSSLG-----------KDQHVSNLINIIAQNIEQVIQDDKNSIEKE-------VFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVAD---KRDLNVFGEKCLELVNLNGTQLHFLLDN 2735
            M G    ER +L + I  WNANRLDLFEIS+P E LEF+GVMRF++Q D +   + TKC+RVSSTATTQD+IE +  KF PDM+ML++ +Y+LYE H + ++R++  +E PL+VQLNW  DD++G+F+LKNE+        +N       G+ ++            +TL  +           F       +     +   D E++ R+AAE+    PE+SFTRTISNP+ VMKRRRQ+K+E R++ F    G  ++GGTL+IY DS+ P+IPYKTLL SV DTA+ V+ E L+KYGL +E+ R + + +Q           +  +E+IL D +CPL IL   P  RG                             L KK P    R     E       E       +P LV+LS    GN +     +  +   +      S + +  K  ++    + VGS       I    P + P HC++        +    T+TP    +         +I++Q+V ++T L     +Q G   +F+F +    +   R+  S +   H         +  +  +     T K S  +  E       +  E  D  S+D  +   +   P   E                       F+L+P Y+ Y+  R  L            +   V  ++N +   +E VIQD +   +K+        FW++N+SELL+ ++ D DL   +  AQD+LA  ++ AF  L      DL   +PAF+D D  + N  + +                     I+ +L TLS A +L   C+VN ALTIQ+FSQLFH +N WLFN ++ D+ +              WG  L ++L  ++ W+E  GL++AA+CH+ ++ Q T L+  +   K D+      C +   LN  QLH LL N
Sbjct:    1 MSGTREEERRKLADIINHWNANRLDLFEISQPTEDLEFHGVMRFYFQ-DRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERQLDLDEKPLVVQLNWNKDDREGRFVLKNENDVPPKKSQSNGPEREKDGVIQNFK----------RTLSKKEKKKEKKREKEFIRMPDEDERTLGRE---DGENS-RLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKVEKRMQDFINNDGRPDSGGTLRIYADSLKPNIPYKTLLCSVRDTADLVVVEALEKYGLEKENPREFCIARQE---------EKTGKEVILDDSECPLQILRDWPADRGVLVF------------------------QLKKKPPDYQGRKGRKMEDKGLRGKEGLLPPEKLPYLVELS-PGRGNHYA---YYAYRHPEDG-----SDSRDKPKMYRLQQSITEVGSDCTDDGAIQLLGPGVLPHHCNL------MHSEGMVTVTPHGPDAE-------TFIDRQRVTETTVLHSGSTLQFGSAHVFKFVDPLFDQGGKRDPPSAMRGRHKSGSVPENDLHRDVHSGAALPTSKSSGKLEMERGMVKPMIRGEQLDSRSQDALAERTELCLPASIEFRENSEDTFLSAIINYTNSSTVHFKLSPTYVLYMACRFVLSPAYRPDISPSERTHKVIAIVNKMVSMMEGVIQDMREGDQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDILAHLVQMAFKYLVHCLQADLNNYMPAFLD-DPEEHNPQSPK---------------------IEDVLHTLSGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTDADSGLCCHY--------WGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMNKYSKEDVQNIHSTCFK---LNSLQLHALLTN 850          

HSP 2 Score: 75.485 bits (184), Expect = 5.516e-13
Identity = 44/115 (38.26%), Postives = 64/115 (55.65%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQK 3689
            TV LKK +N +GLSI+AAK +  +   IYIK V+  GA    G++  GDQL++VDG  L  ++QE A E M +T   V L + K  A  HG          +   +N+ +P +Q+
Sbjct:  974 TVTLKK-HNGMGLSIVAAKGAGQEKLGIYIKSVVKGGAADNDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGAVVTLEVAKQGAIYHG----------LATLLNQPSPMMQR 1077          
BLAST of Afadin vs. Ensembl Medaka
Match: MPDZ (multiple PDZ domain protein-like [Source:NCBI gene;Acc:101166191])

HSP 1 Score: 68.1662 bits (165), Expect = 1.010e-10
Identity = 31/82 (37.80%), Postives = 52/82 (63.41%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLM 3590
            T+ L++ ++ LG SI+    SP+    IY+K +   GA  + G+++ GDQ++AV+G  LE +   EAV+ +K+TK TV L +
Sbjct: 1828 TITLERGSSGLGFSIVGGFGSPHGDLPIYVKTIFNKGAAVEDGRLKRGDQIIAVNGHCLEGVTHAEAVDILKRTKGTVVLTL 1909          
BLAST of Afadin vs. Ensembl Medaka
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:NCBI gene;Acc:101165593])

HSP 1 Score: 62.7734 bits (151), Expect = 1.817e-10
Identity = 32/80 (40.00%), Postives = 49/80 (61.25%), Query Frame = 3
Query: 3345 TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNL 3584
            T+ L++  + LG SI+    SP+    IY+K     GA  + G+++ GDQ++AV+G  LE +  EEAV  +K+TK TV L
Sbjct:   52 TITLERGPDGLGFSIVGGHGSPHGDLPIYVKT----GAAAEDGRLKRGDQIIAVNGQTLEGVTHEEAVGILKRTKGTVTL 127          
BLAST of Afadin vs. Planmine SMEST
Match: SMESG000037577.1 (SMESG000037577.1)

HSP 1 Score: 3193.68 bits (8279), Expect = 0.000e+0
Identity = 1793/1805 (99.34%), Postives = 1802/1805 (99.83%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFSGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSELFRLAPAYMFYLLLRSSLGKDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCEDVELPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCDRGIVSCPKDLKTMLNALHGLLSYKLNPPILNDVDTRWKSYLGSYEHTPSVSRSGTIIEQSPIAPLKIDTQHKLPRNWISEDQNSMILSSPDSQFDSGQYKKSLQTKNTKTYERPQTLPLDNKPVDSSDDSNATEVFKADLKNRYTVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQKEYSASPKFTSPQSKSLSNKPVSHAQSHRQPPLKKAPQYEQENKKRTDYXXXXXXXXXXXXXXXXXXXXXXXXXXKIDNDDLSDHEYHSLPVRKSKTNQLTKPNDSMYATVKSKQSPKIYDDSSYNSLQNVNNKXXXXXXXXXXXXXXXXKRIXXXXXXXXXXXXXXXXXXXXVEXXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXXXXXXXXDNNIQLSGKSMPRTEVKISPKQKVLTRPVIXXXXXXXXXXXXXXXXXKLSLNGPVKLSNNKTKXXXXXXXXXXXXXXXXXXXXXXXXXXPVPQRKMNSEPILSVKPTEVIPPVKASIKVNGSVPNSVGKPDKTDKEKLPSPTIKNERPKTIEINTNIPKVNQWKPNISVQXXXXXXXXXXXXXXXXXXQYHPPTQLEEKDWNSDSVKQPNLQTDEEIKLRRKAIEDKIRKETEIHNIKERVSSPLDSRSESIGVSESNNNPTAARTSVKYGRPQFNDKPNRPEPQFKVQIDXXXXXXXXXXXXXXQRGLVVPASPTQGKNEKSPDHSKQIKEEPVEQLSFKEKMQLFAQKSGENQVANRNKFSSKQRKIESGDFS 5459
            MYGPNHP+RT+LNNQIREWNANRLDLFEISEPNEYLE+YGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFSRLSTKKSRRKSKSEKDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFSGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPI+LTKKSPVTPNRDDESF+QTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCL+YINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSELFRLAPAYM YLLLRSSLGKDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCEDVELPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNLPLYEDLDLRLPLLLPADGYSCDRGIVSCPKDLKTMLNALHGLLSYKLNPPILNDVDTRWKSYLGSYEHTPSVSRSGTIIEQSPIAPLKIDTQHKLPRNWISEDQNSMILSSPDSQFDSGQYKKSLQTKNTKTYERPQTLPLDNKPVDSSDDSNATEVFKADLKNRYTVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQKEYSASPKFTSPQSKSLSNKPVSHAQSHRQPPLKKAPQYEQENKKRTDYRLPPVPLPAKVPPRPGRPPPKTRQPAKIDNDDLSDHEYHSLPVRKSKTNQLTKPNDSMYATVKSKQSPKIYDDSSYNSLQNVNNKPRQSSSQPNLSLNLPRKRISTPSDSSSSGSITTSDDEDSVEKKPPVKTVKNPKRKNVFQLAKLPQPPKQSPAPPKLPAKASSDNNIQLSGKSMPRTEVKISPKQKVLTRPVIASVSDSSDQANSESSVNKLSLNGPVKLSNNKTKSQSSSSSESESETLSSLSESLSSDSSPVPQRKMNSEPILSVKPTEVIPP KASIKVNGSVPNSVGKPDKT+KEKLPSPTIKNERPKTIEIN NIPKVNQWKPNISVQPHINPPSTPPPVPTAIHPQYHPPTQLEEKDWNSDSVKQPNLQTDEEIKLRRKAIEDKIRKETEIHNIKERVSSPLDSRSESIGVSESNNNPTAARTSVKYGRPQFNDKPNRPEPQFKV+IDNSSNNNSLPSPSLLQRGLVVPASPTQGKNEKSPDHSKQIKEEPVEQLSFKEKMQLFAQK+GENQVANRNKFSSKQRKIESGDFS
Sbjct:    1 MYGPNHPDRTKLNNQIREWNANRLDLFEISEPNEYLEYYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFSRLSTKKSRRKSKSEKDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFSGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIELTKKSPVTPNRDDESFDQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLIYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSELFRLAPAYMLYLLLRSSLGKDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCEDVELPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNLPLYEDLDLRLPLLLPADGYSCDRGIVSCPKDLKTMLNALHGLLSYKLNPPILNDVDTRWKSYLGSYEHTPSVSRSGTIIEQSPIAPLKIDTQHKLPRNWISEDQNSMILSSPDSQFDSGQYKKSLQTKNTKTYERPQTLPLDNKPVDSSDDSNATEVFKADLKNRYTVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQKEYSASPKFTSPQSKSLSNKPVSHAQSHRQPPLKKAPQYEQENKKRTDYRLPPVPLPAKVPPRPGRPPPKTRQPAKIDNDDLSDHEYHSLPVRKSKTNQLTKPNDSMYATVKSKQSPKIYDDSSYNSLQNVNNKPRQSSSQPNLSLNLPRKRISTPSDSSSSGSITTSDDEDSVEKKPPVKTVKNPKRKNVFQLAKLPQPPKQSPAPPKLPAKASSDNNIQLSGKSMPRTEVKISPKQKVLTRPVIASVSDSSDQANSESSVNKLSLNGPVKLSNNKTKSQSSSSSESESETLSSLSESLSSDSSPVPQRKMNSEPILSVKPTEVIPPFKASIKVNGSVPNSVGKPDKTEKEKLPSPTIKNERPKTIEINANIPKVNQWKPNISVQPHINPPSTPPPVPTAIHPQYHPPTQLEEKDWNSDSVKQPNLQTDEEIKLRRKAIEDKIRKETEIHNIKERVSSPLDSRSESIGVSESNNNPTAARTSVKYGRPQFNDKPNRPEPQFKVKIDNSSNNNSLPSPSLLQRGLVVPASPTQGKNEKSPDHSKQIKEEPVEQLSFKEKMQLFAQKNGENQVANRNKFSSKQRKIESGDFS 1805          
BLAST of Afadin vs. Planmine SMEST
Match: SMESG000037577.1 (SMESG000037577.1)

HSP 1 Score: 3186.74 bits (8261), Expect = 0.000e+0
Identity = 1793/1807 (99.23%), Postives = 1802/1807 (99.72%), Query Frame = 3
Query:   45 MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFSGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSELFRLAPAYMFYLLLRSSLGKDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCEDVELPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNXXXXXXXXXXXXXXXXXXGYSCDRGIVSCPKDLKTMLNALHGLLSYKLNPPILNDVDTRWKSYLGSYEHTPSVSRSGTIIEQSPIAPLKIDTQHKLPRNWISEDQNSMILSSPDSQFDSGQYKKSLQTKNTKTYERPQTLPLDNKPVDSSDDSNATEVFKADLKNRYTVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQKEYSASPKFTSPQSKSLSNKPVSHAQSHRQPPLKKAPQYEQENKKRTDYXXXXXXXXXXXXXXXXXXXXXXXXXXKIDNDDLSDHEYHSLPVRKSKTNQLTKPNDSMYATVKSKQSPKIYDDSSYNSLQNVNNKXXXXXXXXXXXXXXXXKRIXXXXXXXXXXXXXXXXXXXXVEXXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXXXXXXXXDNNIQLSGKSMPRTEVKISPKQKVLTRPVIXXXXXXXXXXXXXXXXXKLSLNGPVKLSNNKTKXXXXXXXXXXXXXXXXXXXXXXXXXXPVPQRKMNSEPILSVKPTEVIPPVKASIKVNGSVPNSVGKPDKTDKEKLPSPTIKNERPKTIEINTNIPKVNQWKPNISVQXXXXXXXXXXXXXXXXXXQYHPPTQLEEKDWNSDSVKQPNLQTDEEIKLRRKAIEDKIRKETEIHNIKERVSSPLDSRSESIGVSESNNNPTAARTSVKYGRPQFN--DKPNRPEPQFKVQIDXXXXXXXXXXXXXXQRGLVVPASPTQGKNEKSPDHSKQIKEEPVEQLSFKEKMQLFAQKSGENQVANRNKFSSKQRKIESGDFS 5459
            MYGPNHP+RT+LNNQIREWNANRLDLFEISEPNEYLE+YGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFSRLSTKKSRRKSKSEKDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFSGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPI+LTKKSPVTPNRDDESF+QTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCL+YINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSELFRLAPAYM YLLLRSSLGKDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCEDVELPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNLPLYEDLDLRLPLLLPADGYSCDRGIVSCPKDLKTMLNALHGLLSYKLNPPILNDVDTRWKSYLGSYEHTPSVSRSGTIIEQSPIAPLKIDTQHKLPRNWISEDQNSMILSSPDSQFDSGQYKKSLQTKNTKTYERPQTLPLDNKPVDSSDDSNATEVFKADLKNRYTVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQKEYSASPKFTSPQSKSLSNKPVSHAQSHRQPPLKKAPQYEQENKKRTDYRLPPVPLPAKVPPRPGRPPPKTRQPAKIDNDDLSDHEYHSLPVRKSKTNQLTKPNDSMYATVKSKQSPKIYDDSSYNSLQNVNNKPRQSSSQPNLSLNLPRKRISTPSDSSSSGSITTSDDEDSVEKKPPVKTVKNPKRKNVFQLAKLPQPPKQSPAPPKLPAKASSDNNIQLSGKSMPRTEVKISPKQKVLTRPVIASVSDSSDQANSESSVNKLSLNGPVKLSNNKTKSQSSSSSESESETLSSLSESLSSDSSPVPQRKMNSEPILSVKPTEVIPP KASIKVNGSVPNSVGKPDKT+KEKLPSPTIKNERPKTIEIN NIPKVNQWKPNISVQPHINPPSTPPPVPTAIHPQYHPPTQLEEKDWNSDSVKQPNLQTDEEIKLRRKAIEDKIRKETEIHNIKERVSSPLDSRSESIGVSESNNNPTAARTSVKYGRPQFN  DKPNRPEPQFKV+IDNSSNNNSLPSPSLLQRGLVVPASPTQGKNEKSPDHSKQIKEEPVEQLSFKEKMQLFAQK+GENQVANRNKFSSKQRKIESGDFS
Sbjct:    1 MYGPNHPDRTKLNNQIREWNANRLDLFEISEPNEYLEYYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFSRLSTKKSRRKSKSEKDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFSGANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVRRRTPMDKLPSKPRMGPYSIPIELTKKSPVTPNRDDESFDQTYDNEIENDTDVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGSQQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSSSRIPKPCLIYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSSNVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSEELIDTIFQLSKEYADGGSKDLFSCNADPRFPNLSELFRLAPAYMLYLLLRSSLGKDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCEDVELPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNLPLYEDLDLRLPLLLPADGYSCDRGIVSCPKDLKTMLNALHGLLSYKLNPPILNDVDTRWKSYLGSYEHTPSVSRSGTIIEQSPIAPLKIDTQHKLPRNWISEDQNSMILSSPDSQFDSGQYKKSLQTKNTKTYERPQTLPLDNKPVDSSDDSNATEVFKADLKNRYTVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQLVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSKSIKAAMNKKAPTLQKEYSASPKFTSPQSKSLSNKPVSHAQSHRQPPLKKAPQYEQENKKRTDYRLPPVPLPAKVPPRPGRPPPKTRQPAKIDNDDLSDHEYHSLPVRKSKTNQLTKPNDSMYATVKSKQSPKIYDDSSYNSLQNVNNKPRQSSSQPNLSLNLPRKRISTPSDSSSSGSITTSDDEDSVEKKPPVKTVKNPKRKNVFQLAKLPQPPKQSPAPPKLPAKASSDNNIQLSGKSMPRTEVKISPKQKVLTRPVIASVSDSSDQANSESSVNKLSLNGPVKLSNNKTKSQSSSSSESESETLSSLSESLSSDSSPVPQRKMNSEPILSVKPTEVIPPFKASIKVNGSVPNSVGKPDKTEKEKLPSPTIKNERPKTIEINANIPKVNQWKPNISVQPHINPPSTPPPVPTAIHPQYHPPTQLEEKDWNSDSVKQPNLQTDEEIKLRRKAIEDKIRKETEIHNIKERVSSPLDSRSESIGVSESNNNPTAARTSVKYGRPQFNGTDKPNRPEPQFKVKIDNSSNNNSLPSPSLLQRGLVVPASPTQGKNEKSPDHSKQIKEEPVEQLSFKEKMQLFAQKNGENQVANRNKFSSKQRKIESGDFS 1807          
BLAST of Afadin vs. Planmine SMEST
Match: SMESG000058689.1 (SMESG000058689.1)

HSP 1 Score: 178.333 bits (451), Expect = 3.202e-45
Identity = 114/336 (33.93%), Postives = 181/336 (53.87%), Query Frame = 3
Query:   90 IREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS--GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAV 1091
            I +WN++RL+LF+IS+P++ L+F+GVMRFF++ +D K+ +KCLRVSS    +DL+  ++ KF+      +   + L+E  +  D+ +   + PL++QL W  DDK+G F+ K+  + + S  + + +     G     ST+ L    +S T R          +                      +  ++ +   S     S  +RTISNP+ +M+ +R+ KLE +L+Q S  G    GGTLKIYGDS+NP IPYK+LLLS++DTAE V+ E LDKYG+  E+   + LV        D++  ++  E IL + D PL  L+ +    G     V
Sbjct:    8 INQWNSSRLELFKISQPDKNLKFFGVMRFFFETED-KFHSKCLRVSSDLKVKDLLPVLLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRWIRSQTRKYKIG-----STTCL----NSPTTRCLDKVCTDPPT----------------------KSTKQFSKSPSLLSTPSFLSRTISNPESLMRLKRKSKLEEKLKQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSS---VYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRV 308          

HSP 2 Score: 138.272 bits (347), Expect = 1.316e-32
Identity = 87/314 (27.71%), Postives = 159/314 (50.64%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLL-----------RSSLGKDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSA----QDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNC----EDVELPRAWIEVVVNTSIQL 2798
            F+LA AY+ +L++            + L ++  +   I  +A  I Q I   +  I  + +WL+N +E LHLL+ +  L  F+ S      D+ A   +  F  +   F+ D++  L   ++ +    +D+  +D  P   +AS           +  L++TLS   ++   C VN AL IQ+ S++FHL+N W+FNS +            P  +   W   +  R+ R++ WSE + L +AA+C+ Q+  Q  +L++ +K D+ VF  + +++V++N  QL +LLDN      + ++P+ WI+ VV+ + Q+
Sbjct:  518 FKLASAYVLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENT---DDSEEKDDFPLSRKASD-------PKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFID----------TPCRIFRGWARIILNRIERIRRWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQV 811          
BLAST of Afadin vs. Planmine SMEST
Match: SMESG000058689.1 (SMESG000058689.1)

HSP 1 Score: 177.563 bits (449), Expect = 6.921e-45
Identity = 114/336 (33.93%), Postives = 181/336 (53.87%), Query Frame = 3
Query:   90 IREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS--GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAV 1091
            I +WN++RL+LF+IS+P++ L+F+GVMRFF++ +D K+ +KCLRVSS    +DL+  ++ KF+      +   + L+E  +  D+ +   + PL++QL W  DDK+G F+ K+  + + S  + + +     G     ST+ L    +S T R          +                      +  ++ +   S     S  +RTISNP+ +M+ +R+ KLE +L+Q S  G    GGTLKIYGDS+NP IPYK+LLLS++DTAE V+ E LDKYG+  E+   + LV        D++  ++  E IL + D PL  L+ +    G     V
Sbjct:    8 INQWNSSRLELFKISQPDKNLKFFGVMRFFFETED-KFHSKCLRVSSDLKVKDLLPVLLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRWIRSQTRKYKIG-----STTCL----NSPTTRCLDKVCTDPPT----------------------KSTKQFSKSPSLLSTPSFLSRTISNPESLMRLKRKSKLEEKLKQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSS---VYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRV 308          

HSP 2 Score: 137.887 bits (346), Expect = 1.843e-32
Identity = 87/313 (27.80%), Postives = 158/313 (50.48%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLL-----------RSSLGKDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSA----QDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNC----EDVELPRAWIEVVVNTSIQ 2795
            F+LA AY+ +L++            + L ++  +   I  +A  I Q I   +  I  + +WL+N +E LHLL+ +  L  F+ S      D+ A   +  F  +   F+ D++  L   ++ +    +D+  +D  P   +AS           +  L++TLS   ++   C VN AL IQ+ S++FHL+N W+FNS +            P  +   W   +  R+ R++ WSE + L +AA+C+ Q+  Q  +L++ +K D+ VF  + +++V++N  QL +LLDN      + ++P+ WI+ VV+ + Q
Sbjct:  518 FKLASAYVLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNENT---DDSEEKDDFPLSRKASD-------PKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFID----------TPCRIFRGWARIILNRIERIRRWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQ 810          
BLAST of Afadin vs. Planmine SMEST
Match: SMESG000058689.1 (SMESG000058689.1)

HSP 1 Score: 176.792 bits (447), Expect = 4.629e-44
Identity = 114/336 (33.93%), Postives = 181/336 (53.87%), Query Frame = 3
Query:   90 IREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDDLKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDRKMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMSKSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFXXXXXXXXXXXXXXXXDNEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFS--GANETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRFYVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAV 1091
            I +WN++RL+LF+IS+P++ L+F+GVMRFF++ +D K+ +KCLRVSS    +DL+  ++ KF+      +   + L+E  +  D+ +   + PL++QL W  DDK+G F+ K+  + + S  + + +     G     ST+ L    +S T R          +                      +  ++ +   S     S  +RTISNP+ +M+ +R+ KLE +L+Q S  G    GGTLKIYGDS+NP IPYK+LLLS++DTAE V+ E LDKYG+  E+   + LV        D++  ++  E IL + D PL  L+ +    G     V
Sbjct:    8 INQWNSSRLELFKISQPDKNLKFFGVMRFFFETED-KFHSKCLRVSSDLKVKDLLPVLLEKFYVSDICSSKQDFRLFERSSSIDKLLDPEDFPLLIQLFWCKDDKEGVFVFKSNLKNKNSRWIRSQTRKYKIG-----STTCL----NSPTTRCLDKVCTDPPT----------------------KSTKQFSKSPSLLSTPSFLSRTISNPESLMRLKRKSKLEEKLKQISKSGNLNGGGTLKIYGDSLNPLIPYKSLLLSIDDTAEFVVREILDKYGMENENENDFSLVSS---VYKDQNTQKIEYEEILQNSDSPLRFLLQSNKNDGFIKFRV 308          

HSP 2 Score: 144.05 bits (362), Expect = 5.350e-34
Identity = 89/319 (27.90%), Postives = 162/319 (50.78%), Query Frame = 3
Query: 1914 FRLAPAYMFYLLL-----------RSSLGKDQHVSNLINIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSA----QDVLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDRASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLNTWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDVAANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNC----EDVELPRAWIEVVVNTSIQLHDQAF 2813
            F+LA AY+ +L++            + L ++  +   I  +A  I Q I   +  I  + +WL+N +E LHLL+ +  L  F+ S      D+ A   +  F  +   F+ D++  L   ++ +    +D+  +D  P   +AS           +  L++TLS   ++   C VN AL IQ+ S++FHL+N W+FNS +            P  +   W   +  R+ R++ WSE + L +AA+C+ Q+  Q  +L++ +K D+ VF  + +++V++N  QL +LLDN      + ++P+ WI+ VV+ + Q+ D+ F
Sbjct:  518 FKLASAYVLHLMVVDIIRLTCINRATVLDQELVIGMFIEKVASKIRQSIMQHRTIISIQSYWLANCTEFLHLLKNNILLSQFNSSIFDKYYDLFADNAQWCFQCISFGFTDDMVNTLSVLLNEN---TDDSEEKDDFPLSRKASD-------PKNMSILIRTLSSCMSVLQQCHVNPALIIQIISRIFHLINCWIFNSFID----------TPCRIFRGWARIILNRIERIRRWSERHDLLLAADCYFQQSLQACKLLIMEKTDIEVFYNETVDMVDINSIQLRYLLDNYIYSPNEPKVPQIWIDFVVSGANQVADKVF 816          
The following BLAST results are available for this feature:
BLAST of Afadin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AFDN3.946e-7735.28afadin, adherens junction formation factor [Source... [more]
AFDN4.390e-7735.28afadin, adherens junction formation factor [Source... [more]
AFDN6.723e-7735.28afadin, adherens junction formation factor [Source... [more]
AFDN7.968e-7735.28afadin, adherens junction formation factor [Source... [more]
AFDN2.103e-7635.47afadin, adherens junction formation factor [Source... [more]
back to top
BLAST of Afadin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
afd-17.790e-3352.42AFaDin (Actin filament binding protein) homolog [... [more]
afd-18.542e-3352.42AFaDin (Actin filament binding protein) homolog [... [more]
afd-19.182e-3352.42AFaDin (Actin filament binding protein) homolog [... [more]
afd-19.331e-3352.42AFaDin (Actin filament binding protein) homolog [... [more]
afd-18.383e-2128.47AFaDin (Actin filament binding protein) homolog [... [more]
back to top
BLAST of Afadin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cno1.189e-11031.18gene:FBgn0259212 transcript:FBtr0334911[more]
cno5.295e-10731.11gene:FBgn0259212 transcript:FBtr0299709[more]
cno1.086e-7435.20gene:FBgn0259212 transcript:FBtr0300525[more]
cno1.086e-7435.20gene:FBgn0259212 transcript:FBtr0347363[more]
cno1.186e-7435.20gene:FBgn0259212 transcript:FBtr0299710[more]
back to top
BLAST of Afadin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
afdna3.056e-11132.40afadin, adherens junction formation factor a [Sour... [more]
afdna3.555e-11132.19afadin, adherens junction formation factor a [Sour... [more]
ptpn133.085e-1235.97protein tyrosine phosphatase non-receptor type 13 ... [more]
si:dkey-92j12.52.641e-1037.50si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-3... [more]
si:dkey-92j12.51.187e-937.50si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-3... [more]
back to top
BLAST of Afadin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AFDN1.111e-11732.38afadin, adherens junction formation factor [Source... [more]
AFDN8.907e-11632.46afadin, adherens junction formation factor [Source... [more]
AFDN4.913e-11532.25afadin, adherens junction formation factor [Source... [more]
AFDN3.160e-11432.50afadin, adherens junction formation factor [Source... [more]
AFDN2.257e-11332.09afadin, adherens junction formation factor [Source... [more]
back to top
BLAST of Afadin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Afdn1.113e-7735.60afadin, adherens junction formation factor [Source... [more]
Afdn1.274e-7735.60afadin, adherens junction formation factor [Source... [more]
Afdn1.294e-7735.60afadin, adherens junction formation factor [Source... [more]
Afdn1.581e-7735.60afadin, adherens junction formation factor [Source... [more]
Afdn1.650e-7735.60afadin, adherens junction formation factor [Source... [more]
back to top
BLAST of Afadin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QZQ1|AFAD_MOUSE9.050e-7735.60Afadin OS=Mus musculus OX=10090 GN=Afdn PE=1 SV=3[more]
sp|P55196|AFAD_HUMAN3.827e-7635.28Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3[more]
sp|O35889|AFAD_RAT1.131e-7534.86Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 ... [more]
sp|Q8VBX6|MPDZ_MOUSE2.572e-1036.73Multiple PDZ domain protein OS=Mus musculus OX=100... [more]
sp|O75970|MPDZ_HUMAN3.342e-1035.71Multiple PDZ domain protein OS=Homo sapiens OX=960... [more]
back to top
BLAST of Afadin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A553PI811.849e-12531.07Uncharacterized protein OS=Tigriopus californicus ... [more]
C3YI185.841e-12433.81Uncharacterized protein (Fragment) OS=Branchiostom... [more]
A0A2R5LKM41.774e-12230.24Putative actin filament-binding protein afadin OS=... [more]
A0A2H5BFD45.795e-12232.51Afadin OS=Platynereis dumerilii OX=6359 PE=2 SV=1[more]
A0A4V3SGF66.534e-12229.91Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Afadin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
afdna4.537e-7134.41afadin, adherens junction formation factor a [Sour... [more]
afdna5.688e-7134.11afadin, adherens junction formation factor a [Sour... [more]
afdna3.073e-7034.05afadin, adherens junction formation factor a [Sour... [more]
afdna3.073e-7034.05afadin, adherens junction formation factor a [Sour... [more]
afdna3.535e-7034.00afadin, adherens junction formation factor a [Sour... [more]
back to top
BLAST of Afadin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009066.12.727e-2730.25pep scaffold:Pmarinus_7.0:GL479913:2065:18580:1 ge... [more]
lin7a4.665e-1039.02lin-7 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-... [more]
LIN7B2.347e-937.04lin-7 homolog B, crumbs cell polarity complex comp... [more]
ENSPMAT00000001593.11.477e-829.69pep scaffold:Pmarinus_7.0:GL476350:451250:469638:1... [more]
ENSPMAT00000001597.12.406e-829.69pep scaffold:Pmarinus_7.0:GL476350:451394:472918:1... [more]
back to top
BLAST of Afadin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Afadin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO324422.202e-11431.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302906.502e-1020.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337067.818e-1032.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279527.654e-928.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO477221.149e-835.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Afadin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
afdna1.363e-10830.90afadin, adherens junction formation factor [Source... [more]
afdna5.646e-10830.78afadin, adherens junction formation factor [Source... [more]
afdna1.418e-10730.85afadin, adherens junction formation factor [Source... [more]
MPDZ1.010e-1037.80multiple PDZ domain protein-like [Source:NCBI gene... [more]
MPDZ1.817e-1040.00multiple PDZ domain crumbs cell polarity complex c... [more]
back to top
BLAST of Afadin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037577.10.000e+099.34SMESG000037577.1[more]
SMESG000037577.10.000e+099.23SMESG000037577.1[more]
SMESG000058689.13.202e-4533.93SMESG000058689.1[more]
SMESG000058689.16.921e-4533.93SMESG000058689.1[more]
SMESG000058689.14.629e-4433.93SMESG000058689.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030845 ID=SMED30030845|Name=Afadin|organism=Schmidtea mediterranea sexual|type=transcript|length=5803bp
TTAGCTTTATTTTTGTTTTTTTAGTAAATTTTAATTAAATAAAAATGTAT
GGTCCAAATCATCCAGAGAGAACAAGGCTTAATAACCAAATTCGAGAGTG
GAATGCAAATAGATTAGATTTATTTGAAATATCAGAGCCAAATGAATATT
TGGAATTTTATGGTGTTATGCGATTTTTCTATCAAGGAGATGATTTAAAA
TATCAAACAAAATGCTTACGAGTTTCAAGCACAGCAACAACTCAAGATTT
AATTGAAGCTGTTGTTATAAAATTTCATCCGGACATGAAAATGTTAAACA
ATGATAGATACGCATTGTATGAGAGTCATAACTTGCAAGATCGTAAAATG
AAAGACAACGAGCATCCGTTAATCGTTCAATTGAATTGGGCATTCGACGA
CAAGGATGGGAAATTTATACTTAAAAACGAATCCCGAAGACGTAGATCTA
CTGATATGACTAACCACTCTATGCTTAATAACTACGGAATGTCTAAATCG
ACATCAACATCTGCATTAGGAAATGTTTATGATAGTCAAACACTACGCAG
TCAATCTTCAGCGGTTTACGGCACGTCATCAGCAAACTTCTTTTCAAGAC
TAAGTACAAAGAAAAGTAGACGTAAAAGTAAAAGTGAAAAAGATAACGAA
GACGCTCAACGAATGGCTGCTGAACTTTCTGGAAAACCTCCGGAATCTAG
TTTTACTCGTACAATTTCAAATCCAGATGAAGTCATGAAACGGAGACGCC
AAAGGAAATTGGAATCCCGCCTAGAACAATTTTCCGGTGCCAACGAAACC
GGTGGCACTTTGAAGATATATGGAGATTCGATCAACCCTGATATTCCATA
CAAAACATTGCTTCTATCAGTAAATGATACTGCGGAAAAGGTTTTAGCTG
AAACTTTAGATAAATATGGATTGGTTCAAGAAGATCATCGGTTTTATGTT
TTGGTTCAACAAAATATTCCTCCGAAAAATGATAGGCATCGTGGCGAAAT
GCCTGAAGAAATAATTTTACACGATCAAGATTGCCCTCTCGGTATTCTCG
TTCACAATCCTCCCAAAAGAGGAACTGCTACAATTGCAGTTCGACGACGA
ACTCCAATGGATAAGTTGCCCTCAAAACCTCGAATGGGTCCATATTCCAT
TCCGATAGATTTGACAAAAAAGTCTCCAGTTACTCCTAACAGAGATGACG
AATCATTCGAACAAACCTATGACAACGAAATTGAAAATGACACAGATGTT
CCGCGGTTAGTGAAATTATCAATCGACAATGAAGGGAATTTGTTTGAAGA
AGATGAAATTTTCACATTAAAATCCTTATCAAATAACATGCTAAATTATA
GTAGTGGTGCAGTCGAGGGATCTAAATTCATCAAAATCGGATCTCAGCAA
TCGGCAGTTGGCAGCTATCCCAACATTTTACTCCCAATAGATTATTATCC
CGACATTCGTCCAACTCACTGTCACATCAGTGCTAAATTTGATCCTCAAA
GCAATGTTGTCAGATTCACACTCACACCGACTCTCGATTCTTCTTCACGG
ATTCCAAAACCTTGTTTGGTTTATATCAATCAACAAAAAGTAGAAAAATC
TACAAAATTGCGAGATGAAGATGTTATACAAATTGGGGAGAATTTCCTAT
TTAGATTCGAAGAATGTGAAGAGAAATCGAGGAATCTTTCATCGAATGTC
GTTTTGGATCACATGAAATCAGAAGATACGATCGAATCTATACAGTTGAA
CTATCTAACTGCTGATCTGCCGGTTACAATAAAACATTCATATAATGTCA
GTGAAGAGCTTATCGATACAATCTTTCAACTGTCCAAAGAATATGCAGAT
GGAGGCAGTAAAGACTTATTCAGCTGTAACGCGGATCCGAGATTTCCGAA
TTTGAGTGAACTATTCAGACTGGCTCCAGCGTACATGTTCTACTTGTTGT
TGCGTTCTTCACTGGGTAAAGATCAACACGTGTCGAATCTAATCAATATC
ATTGCACAAAATATTGAACAAGTCATACAAGACGACAAAAATAGTATTGA
AAAAGAAGTGTTCTGGTTGAGTAATAGCAGTGAATTGCTACACTTGCTAC
AATGTGACAATGATCTACGTAATTTCAGTGGTTCGGCTCAAGATGTACTG
GCCAGTGCCATAGAACAGGCTTTTTCAATTCTACAAACCCAATTTTCACA
GGACTTAATAATACTACTACCTGCCTTTGTTGATGGGGATGACTACGACT
TAAATGATAATACTCGAGAAGATTGTATTCCTTGTCTAGATAGAGCCAGT
GTTCTAATAACATATGGAGACATTGATTATCCAATTCAACACCTTTTGCA
AACTTTATCCCTTGCTTATACACTTTTTCATAATTGCCAGGTGAATGTTG
CCTTAACCATTCAAATGTTCAGCCAACTATTCCATTTGCTGAATACTTGG
CTTTTCAATTCAGTTCTTGGAGACTCATCAAATCCTGGAAGTGATTCCTT
AGGCCCGCTGCCTGTGTCTCCTGAATGGGGTGAACGACTTACAAGGCGAC
TTGGTCGAGTTAAGGTTTGGAGTGAAACTAACGGATTAGATGTCGCTGCA
AATTGCCATATGCAAAAAATGTCTCAAGTCACAGAGTTAATGGTAGCAGA
TAAAAGAGACTTGAATGTTTTTGGTGAGAAATGCTTAGAACTGGTCAATC
TAAATGGTACTCAATTACATTTTCTTTTGGATAATTGTGAAGACGTTGAA
TTGCCGAGGGCATGGATTGAGGTTGTTGTAAATACGTCGATTCAGTTGCA
TGATCAAGCATTCAACGGAGGTGTGCCCCAAAATAAAAAGAATCTTCCTT
TATACGAAGATCTGGATTTACGATTGCCACTTCTTTTGCCAGCCGACGGA
TATAGTTGTGACAGAGGTATTGTCAGTTGTCCGAAGGATTTGAAAACTAT
GCTAAACGCACTTCATGGACTTTTATCATACAAATTGAATCCACCGATAC
TAAATGATGTAGATACAAGGTGGAAATCTTATCTTGGATCTTATGAGCAT
ACACCTTCTGTTTCTCGGTCAGGAACAATTATAGAGCAATCTCCAATAGC
ACCACTAAAAATAGATACTCAACATAAATTACCTAGAAATTGGATCAGTG
AGGACCAGAATAGTATGATTTTATCATCTCCAGATTCCCAATTCGATTCG
GGCCAGTATAAAAAATCACTGCAAACTAAGAATACTAAAACTTATGAAAG
ACCTCAAACTTTACCATTAGACAATAAACCTGTAGATTCTAGCGATGATT
CAAATGCTACAGAAGTTTTCAAAGCAGATTTAAAGAACCGTTATACAGTG
AGATTAAAGAAAATCAACAATAGCCTAGGATTAAGCATAATGGCTGCTAA
ATGTTCTCCAAATGATCCTTTCAGAATATATATCAAAGACGTGATACCGG
ATGGTGCCGGCTATAAATGTGGAAAAATTGAAACTGGAGATCAATTAGTG
GCGGTTGATGGTGCTCTTCTAGAGGATATTAACCAAGAAGAAGCAGTCGA
GTTCATGAAGAAAACCAAACCCACTGTTAACTTATTGATGGAAAAAGGAG
CTGCTTCTAGACATGGCGTCATGGACAATATTTTAAGATCTAAAAGTATT
AAGGCCGCCATGAATAAAAAAGCACCAACTTTACAAAAAGAATATTCAGC
GAGTCCGAAATTTACTTCACCTCAGTCAAAATCATTATCTAATAAACCAG
TTTCACATGCTCAATCTCATCGTCAGCCCCCATTGAAAAAGGCTCCACAA
TATGAGCAAGAAAATAAAAAAAGAACAGATTACCGATTACCTCCCGTACC
TCTTCCGGCCAAGGTTCCACCTAGACCTGGGAGACCTCCACCTAAAACTC
GACAACCGGCAAAAATTGACAATGACGATTTGTCAGATCATGAATATCAC
AGCCTACCGGTTCGCAAAAGTAAGACTAACCAGCTTACTAAACCAAATGA
TTCCATGTATGCAACTGTAAAATCAAAACAATCGCCTAAGATTTATGATG
ATTCCTCATACAATTCCCTACAGAATGTAAACAATAAACCTCGTCAATCA
AGTTCACAGCCCAATCTTTCTCTTAATTTACCTAGAAAACGAATAAGCAC
TCCTTCTGATTCATCCTCGTCTGGATCCATTACTACATCAGATGACGAGG
ATTCAGTGGAAAAGAAACCCCCTGTCAAAACCGTAAAAAATCCAAAAAGA
AAAAACGTTTTCCAACTTGCTAAATTACCACAGCCACCTAAGCAGTCACC
TGCTCCTCCAAAGCTTCCTGCAAAGGCATCGTCCGACAATAATATTCAAT
TAAGCGGTAAAAGTATGCCTAGAACTGAAGTAAAAATAAGTCCCAAACAG
AAAGTGCTAACGCGACCTGTTATTGCGTCGGTTTCAGATTCAAGTGATCA
AGCCAATTCAGAAAGCAGTGTAAATAAATTAAGTCTAAATGGACCAGTTA
AATTATCAAATAACAAAACGAAATCTCAATCGTCTTCATCATCGGAATCA
GAATCCGAAACCTTGTCATCATTGTCTGAATCATTGTCATCTGATTCATC
TCCGGTGCCACAAAGGAAAATGAATTCTGAACCAATTTTGTCAGTAAAAC
CAACCGAAGTCATTCCACCTGTCAAAGCCTCAATTAAAGTAAATGGGTCG
GTTCCAAACTCAGTTGGTAAACCAGATAAAACTGACAAAGAAAAATTGCC
TTCACCAACAATTAAAAATGAAAGGCCGAAAACGATCGAAATAAATACAA
ACATACCAAAAGTTAATCAATGGAAACCAAATATTTCAGTTCAACCTCAC
ATAAATCCACCAAGCACTCCACCACCAGTCCCAACTGCTATTCACCCACA
ATATCATCCCCCTACACAATTAGAAGAAAAGGATTGGAATTCTGATTCTG
TAAAACAACCGAATCTGCAAACAGACGAAGAAATAAAATTGCGAAGAAAA
GCTATCGAAGATAAAATTCGAAAAGAAACTGAAATTCACAATATCAAAGA
AAGAGTTTCATCCCCCTTGGATAGTAGATCAGAAAGCATTGGAGTGTCTG
AAAGTAATAATAACCCTACGGCTGCTAGAACTAGTGTAAAATACGGAAGA
CCACAATTTAATGATAAACCCAATAGGCCCGAACCACAATTCAAAGTACA
AATAGATAATTCCTCAAATAATAACTCATTGCCATCTCCATCATTACTCC
AGCGAGGACTTGTAGTTCCGGCATCTCCAACACAAGGAAAGAATGAAAAG
AGTCCAGATCATTCAAAGCAAATCAAAGAGGAACCCGTAGAGCAATTATC
ATTTAAAGAAAAAATGCAATTGTTTGCTCAGAAAAGCGGGGAAAATCAGG
TGGCTAATCGGAATAAATTTAGCAGTAAACAACGCAAAATCGAAAGCGGA
GATTTCAGTTGATTATCACGTTTCCCGCATTGCAATATCTCAACTTTGTC
TTGATCCATTTTCCAAGAAGATTCTGACCGTATTAAGTTTTTAAATATTT
CTGATAGAATGCACAGACACATTCCTCTTTCTTTCACATATCTTTGTTAT
TTATTATTCTTTCGTATCGTTTAGTAAGTGAATGGTGATTTATTTTTGAT
AACCTACGATGAGTTATTATGTCATATCAATTTTATATTTGGAAAGTGTT
CTAGAGATTTTTTAGACACGAGTGCCAATTGTTTTGCATTCCATTAATAT
AAACAATTATTATTTCATACAGGCATATTCATCTTGTAATCTTTTAAATG
TTT
back to top

protein sequence of SMED30030845-orf-1

>SMED30030845-orf-1 ID=SMED30030845-orf-1|Name=SMED30030845-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1806bp
MYGPNHPERTRLNNQIREWNANRLDLFEISEPNEYLEFYGVMRFFYQGDD
LKYQTKCLRVSSTATTQDLIEAVVIKFHPDMKMLNNDRYALYESHNLQDR
KMKDNEHPLIVQLNWAFDDKDGKFILKNESRRRRSTDMTNHSMLNNYGMS
KSTSTSALGNVYDSQTLRSQSSAVYGTSSANFFSRLSTKKSRRKSKSEKD
NEDAQRMAAELSGKPPESSFTRTISNPDEVMKRRRQRKLESRLEQFSGAN
ETGGTLKIYGDSINPDIPYKTLLLSVNDTAEKVLAETLDKYGLVQEDHRF
YVLVQQNIPPKNDRHRGEMPEEIILHDQDCPLGILVHNPPKRGTATIAVR
RRTPMDKLPSKPRMGPYSIPIDLTKKSPVTPNRDDESFEQTYDNEIENDT
DVPRLVKLSIDNEGNLFEEDEIFTLKSLSNNMLNYSSGAVEGSKFIKIGS
QQSAVGSYPNILLPIDYYPDIRPTHCHISAKFDPQSNVVRFTLTPTLDSS
SRIPKPCLVYINQQKVEKSTKLRDEDVIQIGENFLFRFEECEEKSRNLSS
NVVLDHMKSEDTIESIQLNYLTADLPVTIKHSYNVSEELIDTIFQLSKEY
ADGGSKDLFSCNADPRFPNLSELFRLAPAYMFYLLLRSSLGKDQHVSNLI
NIIAQNIEQVIQDDKNSIEKEVFWLSNSSELLHLLQCDNDLRNFSGSAQD
VLASAIEQAFSILQTQFSQDLIILLPAFVDGDDYDLNDNTREDCIPCLDR
ASVLITYGDIDYPIQHLLQTLSLAYTLFHNCQVNVALTIQMFSQLFHLLN
TWLFNSVLGDSSNPGSDSLGPLPVSPEWGERLTRRLGRVKVWSETNGLDV
AANCHMQKMSQVTELMVADKRDLNVFGEKCLELVNLNGTQLHFLLDNCED
VELPRAWIEVVVNTSIQLHDQAFNGGVPQNKKNLPLYEDLDLRLPLLLPA
DGYSCDRGIVSCPKDLKTMLNALHGLLSYKLNPPILNDVDTRWKSYLGSY
EHTPSVSRSGTIIEQSPIAPLKIDTQHKLPRNWISEDQNSMILSSPDSQF
DSGQYKKSLQTKNTKTYERPQTLPLDNKPVDSSDDSNATEVFKADLKNRY
TVRLKKINNSLGLSIMAAKCSPNDPFRIYIKDVIPDGAGYKCGKIETGDQ
LVAVDGALLEDINQEEAVEFMKKTKPTVNLLMEKGAASRHGVMDNILRSK
SIKAAMNKKAPTLQKEYSASPKFTSPQSKSLSNKPVSHAQSHRQPPLKKA
PQYEQENKKRTDYRLPPVPLPAKVPPRPGRPPPKTRQPAKIDNDDLSDHE
YHSLPVRKSKTNQLTKPNDSMYATVKSKQSPKIYDDSSYNSLQNVNNKPR
QSSSQPNLSLNLPRKRISTPSDSSSSGSITTSDDEDSVEKKPPVKTVKNP
KRKNVFQLAKLPQPPKQSPAPPKLPAKASSDNNIQLSGKSMPRTEVKISP
KQKVLTRPVIASVSDSSDQANSESSVNKLSLNGPVKLSNNKTKSQSSSSS
ESESETLSSLSESLSSDSSPVPQRKMNSEPILSVKPTEVIPPVKASIKVN
GSVPNSVGKPDKTDKEKLPSPTIKNERPKTIEINTNIPKVNQWKPNISVQ
PHINPPSTPPPVPTAIHPQYHPPTQLEEKDWNSDSVKQPNLQTDEEIKLR
RKAIEDKIRKETEIHNIKERVSSPLDSRSESIGVSESNNNPTAARTSVKY
GRPQFNDKPNRPEPQFKVQIDNSSNNNSLPSPSLLQRGLVVPASPTQGKN
EKSPDHSKQIKEEPVEQLSFKEKMQLFAQKSGENQVANRNKFSSKQRKIE
SGDFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR002710Dilute_dom
IPR000159RA_dom
IPR001478PDZ
IPR000253FHA_dom
IPR029071Ubiquitin-like_domsf
IPR008984SMAD_FHA_dom_sf
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005911cell-cell junction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 194..214
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 246..357
e-value: 1.3E-28
score: 101.5
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 27..155
e-value: 7.3E-9
score: 38.0
NoneNo IPR availableGENE3DG3DSA:2.60.200.20coord: 423..550
e-value: 2.6E-9
score: 39.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1459..1526
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1600..1805
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1268..1285
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1717..1734
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 128..147
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1751..1769
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 193..207
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1676..1699
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1602..1618
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1213..1240
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1207..1580
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 186..226
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1641..1675
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1045..1086
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1287..1306
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1428..1442
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1559..1573
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1778..1792
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1307..1382
NoneNo IPR availablePANTHERPTHR10398AFADINcoord: 8..1647
NoneNo IPR availablePANTHERPTHR10398:SF1MYELOID/LYMPHOID OR MIXED-LINEAGE LEUKEMIAcoord: 8..1647
NoneNo IPR availableCDDcd01781RA2_Afadincoord: 253..352
e-value: 2.52532E-41
score: 145.497
NoneNo IPR availableCDDcd01782RA1_Afadincoord: 19..129
e-value: 1.54177E-57
score: 192.169
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 1100..1183
e-value: 1.19883E-12
score: 62.9694
IPR002710Dilute domainSMARTSM01132DIL_2coord: 790..899
e-value: 2.1E-12
score: 57.2
IPR002710Dilute domainPFAMPF01843DILcoord: 790..899
e-value: 3.1E-18
score: 66.0
IPR002710Dilute domainPROSITEPS51126DILUTEcoord: 647..918
score: 22.648
IPR000159Ras-associating (RA) domainSMARTSM00314RA_5coord: 38..131
e-value: 2.7E-11
score: 53.5
coord: 252..354
e-value: 5.9E-9
score: 45.8
IPR000159Ras-associating (RA) domainPFAMPF00788RAcoord: 41..130
e-value: 2.1E-14
score: 53.9
coord: 254..352
e-value: 7.2E-16
score: 58.6
IPR000159Ras-associating (RA) domainPROSITEPS50200RAcoord: 38..131
score: 15.742
IPR000159Ras-associating (RA) domainPROSITEPS50200RAcoord: 252..354
score: 17.576
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 1109..1186
e-value: 3.4E-15
score: 66.5
IPR001478PDZ domainPFAMPF00595PDZcoord: 1102..1181
e-value: 2.9E-9
score: 37.1
IPR001478PDZ domainPROSITEPS50106PDZcoord: 1101..1186
score: 17.712
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 1093..1190
e-value: 4.0E-19
score: 70.6
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 1084..1185
IPR008984SMAD/FHA domain superfamilySUPERFAMILYSSF49879SMAD/FHA domaincoord: 468..538
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 253..352
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 53..135