SMED30030844

Overview
NameSMED30030844
Smed IDSMED30030844
Length (bp)1371
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30030844 (SMED30030844) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30030844 (SMED30030844) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30030844 (SMED30030844) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30030844 (SMED30030844) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030844

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30030844 dd_Smed_v4_4529_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30030844 Contig32340newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30030844 Contig32340uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30030844 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.010240:3486..4915 -6815
Homology
BLAST of SMED30030844 vs. Ensembl Fly
Match: CG4325 (gene:FBgn0026878 transcript:FBtr0070342)

HSP 1 Score: 48.1358 bits (113), Expect = 2.085e-6
Identity = 21/55 (38.18%), Postives = 31/55 (56.36%), Query Frame = -2
Query: 1104 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLPIVID 1268
            C IC + F   + I    C HAFH++CL  W K   TCPIC++  + A+  + +D
Sbjct:    8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQ-DAAYFQLYLD 61          
BLAST of SMED30030844 vs. Ensembl Fly
Match: CG4325 (gene:FBgn0026878 transcript:FBtr0310443)

HSP 1 Score: 48.1358 bits (113), Expect = 2.085e-6
Identity = 21/55 (38.18%), Postives = 31/55 (56.36%), Query Frame = -2
Query: 1104 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLPIVID 1268
            C IC + F   + I    C HAFH++CL  W K   TCPIC++  + A+  + +D
Sbjct:    8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQ-DAAYFQLYLD 61          
BLAST of SMED30030844 vs. Ensembl Fly
Match: CG6923 (gene:FBgn0037944 transcript:FBtr0082432)

HSP 1 Score: 49.6766 bits (117), Expect = 6.009e-6
Identity = 19/51 (37.25%), Postives = 29/51 (56.86%), Query Frame = -2
Query: 1116 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 1268
            C IC + FE+  ++ R  C H FH +C+ +W      CPIC+  + E H+P
Sbjct: 1187 CAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDI-ETHMP 1236          
BLAST of SMED30030844 vs. Ensembl Fly
Match: CG6923 (gene:FBgn0037944 transcript:FBtr0307892)

HSP 1 Score: 49.6766 bits (117), Expect = 6.009e-6
Identity = 19/51 (37.25%), Postives = 29/51 (56.86%), Query Frame = -2
Query: 1116 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 1268
            C IC + FE+  ++ R  C H FH +C+ +W      CPIC+  + E H+P
Sbjct: 1187 CAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDI-ETHMP 1236          
BLAST of SMED30030844 vs. Ensembl Fly
Match: CG6923 (gene:FBgn0037944 transcript:FBtr0082433)

HSP 1 Score: 49.6766 bits (117), Expect = 6.009e-6
Identity = 19/51 (37.25%), Postives = 29/51 (56.86%), Query Frame = -2
Query: 1116 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 1268
            C IC + FE+  ++ R  C H FH +C+ +W      CPIC+  + E H+P
Sbjct: 1187 CAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDI-ETHMP 1236          
BLAST of SMED30030844 vs. Ensembl Zebrafish
Match: si:ch211-81a5.1 (si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-608])

HSP 1 Score: 50.447 bits (119), Expect = 1.829e-6
Identity = 18/46 (39.13%), Postives = 27/46 (58.70%), Query Frame = -2
Query: 1131 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 1268
            CP+C + F VGE + +  C H FH  C+  W +   TCP+C+  L+
Sbjct:  202 CPVCREEFSVGESVRQLPCLHYFHSSCIVPWLQLHDTCPVCRKSLD 247          
BLAST of SMED30030844 vs. Ensembl Zebrafish
Match: si:ch211-81a5.1 (si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-608])

HSP 1 Score: 50.447 bits (119), Expect = 2.129e-6
Identity = 18/46 (39.13%), Postives = 27/46 (58.70%), Query Frame = -2
Query: 1131 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 1268
            CP+C + F VGE + +  C H FH  C+  W +   TCP+C+  L+
Sbjct:  225 CPVCREEFSVGESVRQLPCLHYFHSSCIVPWLQLHDTCPVCRKSLD 270          
BLAST of SMED30030844 vs. Ensembl Zebrafish
Match: rnf115 (ring finger protein 115 [Source:ZFIN;Acc:ZDB-GENE-061215-82])

HSP 1 Score: 50.447 bits (119), Expect = 2.161e-6
Identity = 18/46 (39.13%), Postives = 28/46 (60.87%), Query Frame = -2
Query: 1131 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 1268
            CP+C + + VGE + +  C H FH +C+  W +   TCP+C+  LN
Sbjct:  238 CPVCKEDYTVGEPVRQLPCNHFFHSDCIVPWLELHDTCPVCRKSLN 283          
BLAST of SMED30030844 vs. Ensembl Zebrafish
Match: ttc3 (tetratricopeptide repeat domain 3 [Source:ZFIN;Acc:ZDB-GENE-090313-3])

HSP 1 Score: 49.2914 bits (116), Expect = 9.885e-6
Identity = 18/44 (40.91%), Postives = 26/44 (59.09%), Query Frame = -2
Query: 1137 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNH 1268
            C ICH+     E +    C+H+FH+EC+  W K + TCP C+ H
Sbjct: 1631 CIICHEDMS-AEDLCVLECRHSFHRECIKSWLKEQSTCPTCREH 1673          
BLAST of SMED30030844 vs. TrEMBL
Match: A0A183TA38 (C2H2-type domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS13336 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 6.020e-33
Identity = 92/317 (29.02%), Postives = 129/317 (40.69%), Query Frame = 1
Query:  175 KDHDCLRSKSLHIKHISCN-SIKYGLPLICLLCHGRKFRSKVVLFVHLLCYHSPNVVKSNKCGICTFKIKR---------KIINKKLEQYCLPQYDKSFDK-----------------------HIEENHVYGYDLSFIYQLNIDTEKRHPYSCIACSTILNGNDQFHAHVICQHTTQNEYDKEMNVCLICNIPYWSSDKFAMHVNNSHSFLYRQLAIQLAKEGCMTNHVDLDSICVYCWSYFEKRNQLHSHILMQHSYFTTSIQCGLCNMNFKVNAELIQTYKLLNEHNEFHFSQFESNDNLKNDIF-KVPHTLEE 1023
            + H C  +K+ +++HIS N S+  G P  CL C  R F S+  L VHLL YH P   +   CG+C+F                    ++  L QY K   K                       H    HV  Y L    +L +D   R P++C+ C  + N N ++HAH+IC+H T     +E+ +C IC+    S D F  HV   H      LA        M N VD   +C  CW       QL +HIL+ H+  T  + CG CN+ F    + +  + +   H   H     S        F  VP  L E
Sbjct:   93 EKHKCCLAKAAYLRHISSNVSLPGGPPYRCLFCRSRPFNSRSELTVHLLAYHRPQ-RQPGVCGMCSFTFTEPLPPPPPPVPPPPANADEATLQQYTKDVKKVAELRMCEFEYAEVAPGLLDLHNHCARVHVPAYTLLLRQKLLMDFHLREPFACVICGQVFNSNVEYHAHIICRHATDIAVKEELRICSICSKGIRSEDCFNQHVKRRHEEPIAHLADLWISRELMMNAVDAGQVCTTCWEVLPNATQLQAHILVAHTS-TNPLVCGWCNLEFTAYPDPLVAFPIFLNHERNHARVLHSQALESKRTFDPVPELLNE 407          
BLAST of SMED30030844 vs. TrEMBL
Match: A0A183WEL8 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS10572 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 6.117e-31
Identity = 86/297 (28.96%), Postives = 144/297 (48.48%), Query Frame = 1
Query:  169 VIKD---HDCLRSKSLHIKHISCNS-IKYGLPLICLLCHGRKFRSKVVLFVHLLCYHSPNVVKSNKCGICTF---------------------KIKRKIINKKLE-----QYCLP-----QYDKSFDKHIEENHVYGYDLSFIYQLNIDTEKRHPYSCIACSTILNGNDQFHAHVICQHTTQNEYDKEMNVCLICNIPYWSSDKFAMHVNNSHSFLYRQLAIQLAKEGCMTNHVDLDSICVYCWSYFEKRNQLHSHILMQHSYFTTSIQCGLCNMNFKVNAELIQTYKLLNEHNEFH 954
            ++KD   H C   K+++I+ +S +S + YG P  CL C  +   S++ L +HLLCYH PN   + +CG+C F                     + +++   K+L      Q C P     Q   + + HI  +HV  Y L     +  DT  R+PY+C  CS ++N N + HAHV+C H        E+ +C +C +   + D    H+  +H+   ++L     K   + N+ D  S+C+YCW  F+   QL +H+L+ H+    S+QCG C ++F   ++ +  + +L  H   H
Sbjct:   91 MVKDTETHKCAVMKAIYIRFMSGSSNLFYGPPYRCLYCRSKPMGSRIELVIHLLCYHRPNK-STGRCGMCNFTYDEPSQPPPPNLPNLPANATEEQKRAHEKELRTLKEIQMCEPSNVDSQGLANLNAHILYDHVPAYMLWSRRNILEDTFLRYPYACPLCSYLINSNYELHAHVLCAHGNPTTIQNELKICAMCGVSAGTDDGLNKHI-AAHTDPIKRLGNIWIKRELLMNYTDPGSVCIYCWENFKHDFQLQAHLLVAHN-TKNSLQCGWCKIDFLSYSDPVLAFMMLQNHELNH 384          
BLAST of SMED30030844 vs. TrEMBL
Match: A0A183TA37 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS13335 PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 5.904e-29
Identity = 86/334 (25.75%), Postives = 135/334 (40.42%), Query Frame = 1
Query:  175 KDHDCLRSKSLHIKHISCN-SIKYGLPLICLLCHGRKFRSKVVLFVHLLCYHSPNVVKSNKCGICTFKIK----------------------------RKIINK---KLEQYCLPQYDKSFDKHIEENHVYGYDLSFIYQLNIDTEKRHPYSCIACSTILNGNDQFHAHVICQHTTQNEYDKEMNVCLICNIPYWSSDKFAMHVNNSHSFLYRQLAIQLAKEGCMTNHVDLDSICVYCWSYFEKRNQLHSHILMQHSYFTTSIQCGLCNMNFKVNAELIQTYKLLNEHNEFHFSQFESNDNLKNDIFK-VPHTLEEKLCQTKNLTSHNLKTKLD 1077
            + H C  SKS +++++S N S+  G P  CL C  R   S+  L VHLL YH P   +   CG+CTF  +                            +K + +   K E   L       DKH    HV  Y L    +L    + R P++C+ C  + + N ++H+H++C+H T     + + +C +C+    S D F  HV   H     QLA     +  M +  D + +C  CW       QL +HIL+ H+     + CG C++ F    + +  + +L  H   H              F+ +P  L E+             TK D
Sbjct:   92 EKHKCCLSKSAYLRYVSSNVSLSGGPPYRCLFCRSRPLNSRSELTVHLLAYHRPQR-QPGVCGLCTFTFQEPPQLPPPIPPPPANADEVTLRQYEINLKKAVGEQMCKFESAELAPGLLELDKHCANTHVPAYTLLLRKELLTQFQLREPFACVICGQVFHSNVEYHSHILCRHGTDEPIKEGLRICAMCSKGIRSEDCFNQHVKRRHEESIAQLADLWTSQELMMDATDTNQVCTTCWEVLPNATQLQAHILVAHTT-DNPLVCGWCHVEFTDCPDPLIAFPILLNHERNHARVLHRQALESKKTFEPIPEPLNEEFSMEAIAAIATEPTKPD 423          
BLAST of SMED30030844 vs. TrEMBL
Match: A0A0V0J3E6 (Gastrula zinc finger protein XlCGF7.1 OS=Schistocephalus solidus OX=70667 GN=ZG7 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 6.111e-29
Identity = 86/334 (25.75%), Postives = 135/334 (40.42%), Query Frame = 1
Query:  175 KDHDCLRSKSLHIKHISCN-SIKYGLPLICLLCHGRKFRSKVVLFVHLLCYHSPNVVKSNKCGICTFKIK----------------------------RKIINK---KLEQYCLPQYDKSFDKHIEENHVYGYDLSFIYQLNIDTEKRHPYSCIACSTILNGNDQFHAHVICQHTTQNEYDKEMNVCLICNIPYWSSDKFAMHVNNSHSFLYRQLAIQLAKEGCMTNHVDLDSICVYCWSYFEKRNQLHSHILMQHSYFTTSIQCGLCNMNFKVNAELIQTYKLLNEHNEFHFSQFESNDNLKNDIFK-VPHTLEEKLCQTKNLTSHNLKTKLD 1077
            + H C  SKS +++++S N S+  G P  CL C  R   S+  L VHLL YH P   +   CG+CTF  +                            +K + +   K E   L       DKH    HV  Y L    +L    + R P++C+ C  + + N ++H+H++C+H T     + + +C +C+    S D F  HV   H     QLA     +  M +  D + +C  CW       QL +HIL+ H+     + CG C++ F    + +  + +L  H   H              F+ +P  L E+             TK D
Sbjct:   84 EKHKCCLSKSAYLRYVSSNVSLSGGPPYRCLFCRSRPLNSRSELTVHLLAYHRPQR-QPGVCGLCTFTFQEPPQLPPPIPPPPANADEVTLRQYEINLKKAVGEQMCKFESAELAPGLLELDKHCANTHVPAYTLLLRKELLTQFQLREPFACVICGQVFHSNVEYHSHILCRHGTDEPIKEGLRICAMCSKGIRSEDCFNQHVKRRHEESIAQLADLWTSQELMMDATDTNQVCTTCWEVLPNATQLQAHILVAHTT-DNPLVCGWCHVEFTDCPDPLIAFPILLNHERNHARVLHRQALESKKTFEPIPEPLNEEFSMEAIAAIATEPTKPD 415          
BLAST of SMED30030844 vs. TrEMBL
Match: A0A158QE93 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7056 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 4.182e-28
Identity = 78/266 (29.32%), Postives = 120/266 (45.11%), Query Frame = 1
Query:  181 HDCLRSKSLH-IKHISCNSIKYGLPLICLLCHGRKFRSKVVLFVHLLCYHSPNVVKSNKCGICTFKIKRKIINKKLEQYCLPQ-YDKSFDKHIEENHVYGYDLSFIYQLNIDTEKRHPYSCIACSTILNGNDQFHAHVICQHTTQNEYDKEMNVCLICNIPYWSSDKFAMHVNNSHSFLYRQLAIQLAKEGCMTNHVDLDSICVYCWSYFEKRNQLHSHILMQHS--YFTTSIQCGLCNMNFKVNAELIQTYKLLNEHNEFHFSQF 966
            H C    S++  ++ +   I+ G P  CLLC GR F+S+  L  HLL +H PN  K  +C +C F  + ++ +   E    P+  ++  +KH    H   Y L     ++ DT  R PY+C  C      N +FHAHVIC+H  Q++    +  C +C    +S + F  H+   H      LA  L K        D  S C  CW  FE+  +L  H+L  H   +F   + CG C + F     L+ ++ +   H   H  + 
Sbjct:   99 HKCCSFNSIYNQRNFTAPVIQGGAPFRCLLCRGRAFKSRSDLVTHLLAFHRPNRPKG-QCSLCAFTFE-EMPSDNYEDNGEPKPSEQKLEKHWIVEHAPTYRLISRQAVHEDTSLRVPYACFLCRRTYQNNWEFHAHVICRHGVQSDVQSRLFKCSMCQECAYSEEAFDKHIRLHHCDKLHCLANSLLKREMFMEVADPASTCSVCWENFEENFELQVHLLAAHGAPHF---LHCGCCKVEFSRGLVLLDSFLIFLNHERNHMREL 359          
BLAST of SMED30030844 vs. Ensembl Cavefish
Match: si:ch211-81a5.1 (si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-608])

HSP 1 Score: 50.8322 bits (120), Expect = 1.038e-6
Identity = 18/46 (39.13%), Postives = 28/46 (60.87%), Query Frame = -2
Query: 1131 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 1268
            CP+C + + VGE + +  C H FH +C+  W +   TCP+C+  LN
Sbjct:  209 CPVCREEYSVGESVRQLPCLHCFHSDCIVPWLQLHDTCPVCRKSLN 254          
BLAST of SMED30030844 vs. Ensembl Cavefish
Match: rnf115 (ring finger protein 115 [Source:NCBI gene;Acc:107197307])

HSP 1 Score: 48.521 bits (114), Expect = 6.643e-6
Identity = 17/46 (36.96%), Postives = 28/46 (60.87%), Query Frame = -2
Query: 1131 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 1268
            CP+C + + VGE + +  C H FH +C+  W +   TCP+C+  L+
Sbjct:  238 CPVCKEDYTVGEPVRQLPCNHFFHSDCIVPWLELHDTCPVCRKSLS 283          
BLAST of SMED30030844 vs. Ensembl Cavefish
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 48.521 bits (114), Expect = 8.606e-6
Identity = 16/46 (34.78%), Postives = 27/46 (58.70%), Query Frame = -2
Query: 1131 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 1268
            CP+C + +  GE + +  C H FH +C+  W +   TCP+C+  L+
Sbjct:  276 CPVCKEDYSAGESVRQLPCNHLFHNDCIVPWLEQHDTCPVCRKSLS 321          
BLAST of SMED30030844 vs. Ensembl Cavefish
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 48.521 bits (114), Expect = 9.314e-6
Identity = 16/46 (34.78%), Postives = 27/46 (58.70%), Query Frame = -2
Query: 1131 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 1268
            CP+C + +  GE + +  C H FH +C+  W +   TCP+C+  L+
Sbjct:  290 CPVCKEDYSAGESVRQLPCNHLFHNDCIVPWLEQHDTCPVCRKSLS 335          
BLAST of SMED30030844 vs. Ensembl Cavefish
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 48.1358 bits (113), Expect = 9.771e-6
Identity = 16/46 (34.78%), Postives = 27/46 (58.70%), Query Frame = -2
Query: 1131 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 1268
            CP+C + +  GE + +  C H FH +C+  W +   TCP+C+  L+
Sbjct:  223 CPVCKEDYSAGESVRQLPCNHLFHNDCIVPWLEQHDTCPVCRKSLS 268          
BLAST of SMED30030844 vs. Ensembl Sea Lamprey
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 46.2098 bits (108), Expect = 8.094e-6
Identity = 17/46 (36.96%), Postives = 28/46 (60.87%), Query Frame = -2
Query: 1131 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 1268
            C +C + F+ GEK  +  CKH +H +C+  W +   TCP+C+  L+
Sbjct:  225 CSVCKEDFDEGEKARQLPCKHIYHTDCIIPWLEMHDTCPVCRTSLS 270          
BLAST of SMED30030844 vs. Ensembl Sea Lamprey
Match: RNF115 (ring finger protein 115 [Source:HGNC Symbol;Acc:HGNC:18154])

HSP 1 Score: 45.8246 bits (107), Expect = 9.115e-6
Identity = 16/47 (34.04%), Postives = 26/47 (55.32%), Query Frame = -2
Query: 1128 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNE 1268
            C +C + + VGE + +  C H FH  C+  W +   +CP+C+  LN 
Sbjct:  204 CAVCKEDYSVGESVRQLPCLHLFHSNCIVPWLEMHDSCPVCRKGLNS 250          
BLAST of SMED30030844 vs. Ensembl Medaka
Match: rnf115 (ring finger protein 115 [Source:NCBI gene;Acc:101158133])

HSP 1 Score: 49.2914 bits (116), Expect = 3.721e-6
Identity = 18/46 (39.13%), Postives = 28/46 (60.87%), Query Frame = -2
Query: 1131 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 1268
            CP+C + F VGE + +  C H FH +C+  W +   TCP+C+  L+
Sbjct:  243 CPVCKEDFTVGEPVRKLPCNHFFHSDCIVPWLEMHDTCPVCRMSLS 288          
BLAST of SMED30030844 vs. Planmine SMEST
Match: SMESG000061120.1 (SMESG000061120.1)

HSP 1 Score: 133.65 bits (335), Expect = 2.506e-34
Identity = 90/306 (29.41%), Postives = 137/306 (44.77%), Query Frame = 1
Query:  172 IKDHDCLRSKSLHIKHI-SCNSIKYGLPLICLLCHGRKFRSKVVLFVHLLCYHSPNVVKSNKCGICTFKIKRKIINKKLE------------QYCLPQYDKSFDKHIEENHVYGYDLSFIYQLNIDTEKRHPYSCIACSTILNGNDQFHAHVICQHTTQNEYDKEMNVCLICNIPYWSSDKFAMHVNNSHSFLYRQLAIQLAKEGCMTNHVDLDSICVYCWSYFEKRNQLHSHILMQHSYFTTSIQCGLCNMNFKVNAELIQTYKLLNEHNE-----FHFSQFESN---DNLKNDIFKVPHTLEEK 1026
            +  H C R K   ++ I S   IKYG P +CLLC G K  S+  L  HL   H      S  CG C FK   ++ +  L+            +Y LP+Y    +KH  + H     L    Q   ++  R PY C  C   L  N QF +H++C H T   Y+  +NVC  C  P  S      H N +H F    LA +  ++  + N+V L   C  CW  F+    L +HIL+ H       +CGLC  +F +   + + ++++ +H +     FH +  E N   + + ++I +V   +E K
Sbjct:   97 VDSHKCARDKMHFLELILSGTGIKYGAPNVCLLCRGAKMMSRSNLISHLFARHRYGR-GSGICGDCCFKFD-EVTDAPLKTPFATEPDQPQPEYILPEYPSEMEKHYHDIHDTSNALVIKKQTQAESYIRFPYVCPYCHFELKNNAQFQSHILCVHGTSERYETYLNVCKGCGKPTESGPFLNSHANTNHCFQLTNLAKECMRQNLVQNYVPLAQTCTLCWMCFKYDFYLQAHILVTH-LTRFPFECGLCKRDFSLCGTMSEIWQIMRKHEKNHYRAFHLAALERNLTTEPIPDEIPEVADVIEPK 399          
The following BLAST results are available for this feature:
BLAST of SMED30030844 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030844 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030844 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG43252.085e-638.18gene:FBgn0026878 transcript:FBtr0070342[more]
CG43252.085e-638.18gene:FBgn0026878 transcript:FBtr0310443[more]
CG69236.009e-637.25gene:FBgn0037944 transcript:FBtr0082432[more]
CG69236.009e-637.25gene:FBgn0037944 transcript:FBtr0307892[more]
CG69236.009e-637.25gene:FBgn0037944 transcript:FBtr0082433[more]
back to top
BLAST of SMED30030844 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:ch211-81a5.11.829e-639.13si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-6... [more]
si:ch211-81a5.12.129e-639.13si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-6... [more]
rnf1152.161e-639.13ring finger protein 115 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ttc39.885e-640.91tetratricopeptide repeat domain 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of SMED30030844 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030844 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030844 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030844 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183TA386.020e-3329.02C2H2-type domain-containing protein OS=Schistoceph... [more]
A0A183WEL86.117e-3128.96Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A183TA375.904e-2925.75Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0V0J3E66.111e-2925.75Gastrula zinc finger protein XlCGF7.1 OS=Schistoce... [more]
A0A158QE934.182e-2829.32Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of SMED30030844 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-81a5.11.038e-639.13si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-6... [more]
rnf1156.643e-636.96ring finger protein 115 [Source:NCBI gene;Acc:1071... [more]
rnf1268.606e-634.78ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf1269.314e-634.78ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf1269.771e-634.78ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of SMED30030844 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rnf1268.094e-636.96ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
RNF1159.115e-634.04ring finger protein 115 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of SMED30030844 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030844 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030844 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnf1153.721e-639.13ring finger protein 115 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of SMED30030844 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000061120.12.506e-3429.41SMESG000061120.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030844 ID=SMED30030844|Name=SMED30030844|organism=Schmidtea mediterranea sexual|type=transcript|length=1371bp
TCGATAATTGGATGCATTCAAAATTTAAAGCATATACAAAATACAAAATT
TATGAATCAAATAATAAATGTGATTTTTCCAGCCAGACGATTGAAGATTT
AACTTGCTATTTGTGTAATTACAAATGGGACAATAAATATGATCTTTATA
GTCATATTGTAACTCAATGTCATAAAAGACCACGATTGCTTGAGAAGTAA
GTCTCTTCATATTAAACATATAAGCTGCAATTCGATCAAATATGGATTAC
CTTTAATCTGCTTACTTTGCCATGGGAGAAAGTTTCGTTCGAAAGTTGTA
TTGTTTGTTCATTTATTATGCTATCATTCCCCTAATGTAGTCAAATCGAA
TAAATGTGGAATTTGCACTTTTAAAATTAAACGAAAAATTATTAATAAAA
AGTTAGAACAATATTGCTTACCTCAATATGATAAATCATTTGATAAACAC
ATTGAAGAAAATCACGTTTATGGATATGATCTATCATTTATTTATCAACT
AAACATAGACACTGAAAAACGGCATCCGTATTCTTGCATAGCTTGCTCAA
CAATACTGAATGGCAATGATCAATTTCATGCCCACGTGATTTGTCAACAC
ACTACCCAAAATGAGTATGATAAAGAAATGAATGTTTGTCTAATTTGCAA
CATACCCTATTGGAGTTCAGATAAATTTGCAATGCATGTAAACAATTCAC
ACTCATTTCTTTATCGCCAGCTAGCAATTCAATTGGCTAAAGAAGGATGT
ATGACTAATCATGTCGATTTAGACTCGATATGTGTGTATTGCTGGAGTTA
CTTTGAAAAACGAAATCAATTGCATTCACATATTTTAATGCAGCATTCAT
ATTTCACTACGTCTATCCAATGTGGACTTTGCAACATGAATTTCAAGGTG
AATGCAGAATTAATTCAAACCTATAAATTATTAAATGAACACAATGAGTT
CCATTTCTCTCAATTTGAGTCAAATGACAATTTGAAAAATGATATTTTTA
AAGTTCCACATACATTAGAAGAAAAGCTTTGTCAAACTAAAAATCTAACA
AGTCACAATTTGAAAACGAAGTTAGATATATGAATATTTTATTATAAACA
TTAATCTATCACAATTGGTAAATGGGCTTCATTTAAATGATTCTGACAAA
TGGGGCATGTAATTTTGTATTTGAACCATTCTGTTAGACATTCTTTGTGG
AATGCGTGTTTGCAAATTGTTCTGAAAATCTTTTCGCCTACTTCAAAGGT
ATCATGGCAAATAGGACATATCTTAATCAAAATAATTAGTTTTAATTGCA
AATCATCTTACATTGTTATAATGCCGATTTAAAATTGCTATTCTGCTTAC
ATGAACTGATTGAATATCTTT
back to top

protein sequence of SMED30030844-orf-1

>SMED30030844-orf-1 ID=SMED30030844-orf-1|Name=SMED30030844-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=152bp
MNVCLICNIPYWSSDKFAMHVNNSHSFLYRQLAIQLAKEGCMTNHVDLDS
ICVYCWSYFEKRNQLHSHILMQHSYFTTSIQCGLCNMNFKVNAELIQTYK
LLNEHNEFHFSQFESNDNLKNDIFKVPHTLEEKLCQTKNLTSHNLKTKLD
I*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
IPR015880Znf_C2H2-like
IPR011016Znf_RING-CH
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
IPR002350Kazal_dom
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0008514organic anion transmembrane transporter activity
GO:0016887ATPase activity
GO:0042626ATPase activity, coupled to transmembrane movement of substances
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0015711organic anion transport
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 52..73