Glycine receptor subunit alpha-3

Overview
NameGlycine receptor subunit alpha-3
Smed IDSMED30030843
Length (bp)1769
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycine receptor subunit alpha-3 (SMED30030843) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycine receptor subunit alpha-3 (SMED30030843) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycine receptor subunit alpha-3 (SMED30030843) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycine receptor subunit alpha-3 (SMED30030843) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030843

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30030843h1SMcG0011762 SmedASXL_011047SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30030843h1SMcG0011762 dd_Smed_v4_18321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30030843h1SMcG0011762 dd_Smed_v4_18321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030843h1SMcG0011762 dd_Smed_v4_18321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30030843h1SMcG0011762 dd_Smed_v4_18321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30030843h1SMcG0011762 dd_Smed_v4_18321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30030843h1SMcG0011762 dd_Smed_v6_18321_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA2 (glycine receptor alpha 2 [Source:HGNC Symbol;Acc:HGNC:4327])

HSP 1 Score: 186.808 bits (473), Expect = 3.539e-52
Identity = 112/285 (39.30%), Postives = 180/285 (63.16%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNF 1079
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    + +T  N L+R+  +G++LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W ++  V  ++ + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ + F
Sbjct:   70 PVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDSRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYC--TKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEF 348          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA2 (glycine receptor alpha 2 [Source:HGNC Symbol;Acc:HGNC:4327])

HSP 1 Score: 186.422 bits (472), Expect = 5.436e-52
Identity = 111/285 (38.95%), Postives = 180/285 (63.16%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNF 1079
            P  V  NI I +  S+    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    + +T  N L+R+  +G++LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W ++  V  ++ + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ + F
Sbjct:   70 PVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYC--TKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEF 348          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA3 (glycine receptor alpha 3 [Source:HGNC Symbol;Acc:HGNC:4328])

HSP 1 Score: 183.726 bits (465), Expect = 4.089e-51
Identity = 115/304 (37.83%), Postives = 185/304 (60.86%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWDKNASKTDYDRIDPNRL 1136
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W+    V  ++ + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ +  L  +   K   D +  +R 
Sbjct:   69 PVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYC--TKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKDDEVRESRF 366          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA3 (glycine receptor alpha 3 [Source:HGNC Symbol;Acc:HGNC:4328])

HSP 1 Score: 182.57 bits (462), Expect = 1.479e-50
Identity = 112/286 (39.16%), Postives = 179/286 (62.59%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W+    V  ++ + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ +  L
Sbjct:   69 PVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYC--TKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELL 348          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA2 (glycine receptor alpha 2 [Source:HGNC Symbol;Acc:HGNC:4327])

HSP 1 Score: 179.489 bits (454), Expect = 2.056e-50
Identity = 105/265 (39.62%), Postives = 172/265 (64.91%), Query Frame = 3
Query:  285 MAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNF 1079
            M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    + +T  N L+R+  +G++LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W ++  V  ++ + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ + F
Sbjct:    1 MDYRVNIFLRQQWNDSRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYC--TKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEF 259          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: avr-14 (pep chromosome:WBcel235:I:5967250:5973320:-1 gene:WBGene00000232.1 transcript:B0207.12b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-14)

HSP 1 Score: 196.052 bits (497), Expect = 2.605e-56
Identity = 121/305 (39.67%), Postives = 189/305 (61.97%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISI-------PSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQIS-EFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWDKNASKTDYD 1115
            P +V VNI++ +I+ ID +NM ++A F  R+EW D+RLA+   E   +   P  +            ++W+PD FF+N KE   + +  PN LIR+  +G+ILYS ++++  SC M L  +P+D Q C I++ SY YT  D++++WK  + + Q   ++ S   +   +V+T  C   S T+TG YSC +++  L+R+ S YL+  YIP I++V+VSW+SFW+  +AVPARV+LG+ TLL + TQ  G++  LP VSYIKA+D++I  C+ FI GA  E+A+ + Y   R+ FL  +   KT  D
Sbjct:   57 PVLVTVNIYLRSISKIDDVNMEYSAQFTFREEWTDQRLAYERYEESGDTEVPPFVVLATSENADQSQQIWMPDTFFQNEKEARRHLIDKPNVLIRIHKNGQILYSVRLSLVLSCPMSLEFYPLDRQNCLIDLASYAYTTQDIKYEWKEKKPIQQKDGLRQSLPSFELQDVVTDYC--TSLTNTGEYSCARVVLRLRREYSYYLIQLYIPCIMLVVVSWVSFWLDKDAVPARVSLGVTTLLTMTTQASGINSKLPPVSYIKAVDVWIGVCLAFIFGALLEYAVVNYYG--RKEFLRKEKKKKTRID 357          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: glc-3 (Glutamate-gated ChLoride channel; Glutamate-gated chloride channel subunit [Source:UniProtKB/TrEMBL;Acc:G5EEZ3])

HSP 1 Score: 196.438 bits (498), Expect = 6.029e-56
Identity = 126/282 (44.68%), Postives = 177/282 (62.77%), Query Frame = 3
Query:  228 TIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRP-ISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNL-NSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRR 1067
             IV VN+ I +I+ ID +NM ++     R+EW+D RLA+     F   + P   I +   ++W+PD FF+N K+   + +  PN LIR+  DG ILYS +I+M  SC MHL  +PMD Q C I++ SY YT +D+ ++WK  + V   K +  S      E+  +D  L  SKT+TGTYSCL+ +  L+RQ S YL+  YIP+ ++V+VSW+SFW+   AVPARVTLG+ TLL + TQ  G++  LP VSY KAID++I AC+ FI GA  EFA  +  S R
Sbjct:   59 VIVYVNMLIRSISKIDDVNMEYSVQLTFREEWVDGRLAY----GFPGDSTPDFLILTAGQQIWMPDSFFQNEKQAHKHDIDKPNVLIRIHRDGRILYSVRISMVLSCPMHLQYYPMDVQTCLIDLASYAYTENDIEYRWKKTDPVQLKKGLHSS--LPSFELNNVDTTLCTSKTNTGTYSCLRTVLELRRQFSYYLLQLYIPSTMLVIVSWVSFWLDRGAVPARVTLGVTTLLTMTTQASGINAKLPPVSYTKAIDVWIGACLTFIFGALLEFAWVTYISSR 334          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: avr-14 (pep chromosome:WBcel235:I:5968009:5973320:-1 gene:WBGene00000232.1 transcript:B0207.12a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-14)

HSP 1 Score: 190.66 bits (483), Expect = 1.854e-54
Identity = 118/290 (40.69%), Postives = 183/290 (63.10%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISI-------PSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQIS-EFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRR 1070
            P +V VNI++ +I+ ID +NM ++A F  R+EW D+RLA+   E   +   P  +            ++W+PD FF+N KE   + +  PN LIR+  +G+ILYS ++++  SC M L  +P+D Q C I++ SY YT  D++++WK  + + Q   ++ S   +   +V+T  C   S T+TG YSCL+    L+R+ S YL+  YIP+ ++V+VSW+SFW+  ++VPARVTLG+ TLL + TQ+ G++  LP VSY KAID++I  C+ FI GA  EFA+  NY+ R+
Sbjct:   57 PVLVTVNIYLRSISKIDDVNMEYSAQFTFREEWTDQRLAYERYEESGDTEVPPFVVLATSENADQSQQIWMPDTFFQNEKEARRHLIDKPNVLIRIHKNGQILYSVRLSLVLSCPMSLEFYPLDRQNCLIDLASYAYTTQDIKYEWKEKKPIQQKDGLRQSLPSFELQDVVTDYC--TSLTNTGEYSCLRTRMVLRREFSYYLLQLYIPSFMLVIVSWVSFWLDKDSVPARVTLGVTTLLTMTTQSSGINAKLPPVSYTKAIDVWIGVCLAFIFGALLEFALV-NYAARK 343          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: avr-14 (pep chromosome:WBcel235:I:5967250:5973320:-1 gene:WBGene00000232.1 transcript:B0207.12a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-14)

HSP 1 Score: 190.66 bits (483), Expect = 1.854e-54
Identity = 118/290 (40.69%), Postives = 183/290 (63.10%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISI-------PSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQIS-EFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRR 1070
            P +V VNI++ +I+ ID +NM ++A F  R+EW D+RLA+   E   +   P  +            ++W+PD FF+N KE   + +  PN LIR+  +G+ILYS ++++  SC M L  +P+D Q C I++ SY YT  D++++WK  + + Q   ++ S   +   +V+T  C   S T+TG YSCL+    L+R+ S YL+  YIP+ ++V+VSW+SFW+  ++VPARVTLG+ TLL + TQ+ G++  LP VSY KAID++I  C+ FI GA  EFA+  NY+ R+
Sbjct:   57 PVLVTVNIYLRSISKIDDVNMEYSAQFTFREEWTDQRLAYERYEESGDTEVPPFVVLATSENADQSQQIWMPDTFFQNEKEARRHLIDKPNVLIRIHKNGQILYSVRLSLVLSCPMSLEFYPLDRQNCLIDLASYAYTTQDIKYEWKEKKPIQQKDGLRQSLPSFELQDVVTDYC--TSLTNTGEYSCLRTRMVLRREFSYYLLQLYIPSFMLVIVSWVSFWLDKDSVPARVTLGVTTLLTMTTQSSGINAKLPPVSYTKAIDVWIGVCLAFIFGALLEFALV-NYAARK 343          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: glc-1 (Glutamate-gated chloride channel alpha [Source:UniProtKB/Swiss-Prot;Acc:G5EBR3])

HSP 1 Score: 191.045 bits (484), Expect = 4.526e-54
Identity = 122/316 (38.61%), Postives = 190/316 (60.13%), Query Frame = 3
Query:  135 IKNPSIRD-KIIVQIF-ENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRP-ISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQIS-EFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRR 1070
            I+ P   D KI+  +F   Y     P  +   P +V VN+ +  I+ IDV+NM ++A   LR+ W+D+RL++      +   +P   I ++ +++W+PD FF N K+ + + +  PN LIR+ +DG +LYS +I++  SC M+L  +PMD QQC I++ SY YT  D+ + WK +  +     +  S   +      T  C   S T+TG YSCL+    LKR+ S YL+  YIP+ ++V+VSW+SFW    A+PARVTLG+ TLL +  Q+ G++  LP VSYIKAID++I AC+ FI  A  EFA+ ++ + ++
Sbjct:   56 IEQPQTSDSKILAHLFTSGYDFRVRPPTDNGGPVVVSVNMLLRTISKIDVVNMEYSAQLTLRESWIDKRLSY----GVKGDGQPDFVILTVGHQIWMPDTFFPNEKQAYKHTIDKPNVLIRIHNDGTVLYSVRISLVLSCPMYLQYYPMDVQQCSIDLASYAYTTKDIEYLWKEHSPLQLKVGLSSSLPSFQLTNTSTTYC--TSVTNTGIYSCLRTTIQLKREFSFYLLQLYIPSCMLVIVSWVSFWFDRTAIPARVTLGVTTLLTMTAQSAGINSQLPPVSYIKAIDVWIGACMTFIFCALLEFALVNHIANKQ 365          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0301379)

HSP 1 Score: 196.052 bits (497), Expect = 4.262e-57
Identity = 120/282 (42.55%), Postives = 177/282 (62.77%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTD-QEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRR 1067
            P +V VNI + +I+ ID + M ++     R++W D RL + D Q   +  T      +  N++W+PDLFF N KEG  + + MPN  IR+  +G +LYS +I++  +C M+L  +P+D Q C + + SYG+T +DL F WK  + V   K++ +  F T  + LT  C  NSKT+TG YSCLK+    KR+ S YL+  YIP  ++V+VSW+SFW+   AVPARV+LG+ TLL + TQ  G++ +LP VSY KAID++   C+ F+ GA  EFA+  NY+ R
Sbjct:   61 PAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKYLTL-----TEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF-TLEKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALV-NYASR 333          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0343789)

HSP 1 Score: 197.593 bits (501), Expect = 1.596e-56
Identity = 120/284 (42.25%), Postives = 177/284 (62.32%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTD-QEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRR 1073
            P +V VNI + +I+ ID + M ++     R++W D RL + D Q   +  T      +  N++W+PDLFF N KEG  + + MPN  IR+  +G +LYS +I++  +C M+L  +P+D Q C + + SYG+T +DL F WK  + V   K++ +  F T  + LT  C  NSKT+TG YSCLK+    KR+ S YL+  YIP  ++V+VSW+SFW+   AVPARV+LG+ TLL + TQ  G++ +LP VSY KAID++   C+ F+ GA  EFA+ +  SR  R
Sbjct:   61 PAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKYLTL-----TEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF-TLEKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSDR 336          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0343790)

HSP 1 Score: 197.593 bits (501), Expect = 2.027e-56
Identity = 120/285 (42.11%), Postives = 177/285 (62.11%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTD-QEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRN 1076
            P +V VNI + +I+ ID + M ++     R++W D RL + D Q   +  T      +  N++W+PDLFF N KEG  + + MPN  IR+  +G +LYS +I++  +C M+L  +P+D Q C + + SYG+T +DL F WK  + V   K++ +  F T  + LT  C  NSKT+TG YSCLK+    KR+ S YL+  YIP  ++V+VSW+SFW+   AVPARV+LG+ TLL + TQ  G++ +LP VSY KAID++   C+ F+ GA  EFA+ +  SR   N
Sbjct:   61 PAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKYLTL-----TEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF-TLEKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSN 337          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335416)

HSP 1 Score: 197.208 bits (500), Expect = 2.247e-56
Identity = 120/282 (42.55%), Postives = 177/282 (62.77%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTD-QEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRR 1067
            P +V VNI + +I+ ID + M ++     R++W D RL + D Q   +  T      +  N++W+PDLFF N KEG  + + MPN  IR+  +G +LYS +I++  +C M+L  +P+D Q C + + SYG+T +DL F WK  + V   K++ +  F T  + LT  C  NSKT+TG YSCLK+    KR+ S YL+  YIP  ++V+VSW+SFW+   AVPARV+LG+ TLL + TQ  G++ +LP VSY KAID++   C+ F+ GA  EFA+  NY+ R
Sbjct:   61 PAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKYLTL-----TEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF-TLEKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALV-NYASR 333          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335417)

HSP 1 Score: 197.208 bits (500), Expect = 2.247e-56
Identity = 120/285 (42.11%), Postives = 177/285 (62.11%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTD-QEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRN 1076
            P +V VNI + +I+ ID + M ++     R++W D RL + D Q   +  T      +  N++W+PDLFF N KEG  + + MPN  IR+  +G +LYS +I++  +C M+L  +P+D Q C + + SYG+T +DL F WK  + V   K++ +  F T  + LT  C  NSKT+TG YSCLK+    KR+ S YL+  YIP  ++V+VSW+SFW+   AVPARV+LG+ TLL + TQ  G++ +LP VSY KAID++   C+ F+ GA  EFA+ +  SR   N
Sbjct:   61 PAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKYLTL-----TEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF-TLEKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSN 337          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 185.652 bits (470), Expect = 6.632e-52
Identity = 116/290 (40.00%), Postives = 184/290 (63.45%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTD-QEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKT---STGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+++  +A  +       PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W ++  V  + D+ + +F     VL  + +L   T   +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ + F+
Sbjct:   72 PVNVTCNIFINSFGSITETTMDYRLNVFLRQQWNDPRLAYSEYPDASLDLD-----PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQNGNVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLIFEWLSDNPVQVADDLTLPQF-----VLKEEKDLGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFI 351          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 185.652 bits (470), Expect = 6.825e-52
Identity = 116/290 (40.00%), Postives = 184/290 (63.45%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTD-QEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKT---STGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+++  +A  +       PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W ++  V  + D+ + +F     VL  + +L   T   +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ + F+
Sbjct:   70 PVNVTCNIFINSFGSITETTMDYRLNVFLRQQWNDPRLAYSEYPDASLDLD-----PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQNGNVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLIFEWLSDNPVQVADDLTLPQF-----VLKEEKDLGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFI 349          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 185.652 bits (470), Expect = 6.825e-52
Identity = 116/290 (40.00%), Postives = 184/290 (63.45%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTD-QEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKT---STGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+++  +A  +       PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W ++  V  + D+ + +F     VL  + +L   T   +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ + F+
Sbjct:   70 PVNVTCNIFINSFGSITETTMDYRLNVFLRQQWNDPRLAYSEYPDASLDLD-----PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQNGNVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLIFEWLSDNPVQVADDLTLPQF-----VLKEEKDLGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFI 349          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 185.267 bits (469), Expect = 8.361e-52
Identity = 116/290 (40.00%), Postives = 184/290 (63.45%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTD-QEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKT---STGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+++  +A  +       PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W ++  V  + D+ + +F     VL  + +L   T   +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ + F+
Sbjct:   69 PVNVTCNIFINSFGSITETTMDYRLNVFLRQQWNDPRLAYSEYPDASLDLD-----PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQNGNVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLIFEWLSDNPVQVADDLTLPQF-----VLKEEKDLGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFI 348          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 183.341 bits (464), Expect = 3.323e-51
Identity = 113/286 (39.51%), Postives = 178/286 (62.24%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI I +  S+    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    + +T  N L+R+  DG +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W     V  +  + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+++ FL
Sbjct:   68 PVNVTCNIFINSFGSVTETTMDYRVNIFLRQKWNDPRLAYSE---YPDSSLDLD-PSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRIFKDGTVLYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLDKGPVQVADGLTLPQFLIRDEKDLGYC--TKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAGVNFVSRQQKEFL 347          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA3 (glycine receptor alpha 3 [Source:NCBI gene;Acc:100488938])

HSP 1 Score: 184.496 bits (467), Expect = 1.546e-51
Identity = 113/286 (39.51%), Postives = 179/286 (62.59%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI + +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  DG +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W+ N  V  +  + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ +  L
Sbjct:   52 PVNVTCNIFVNSFGSIAETTMDYRLNIFLRQKWNDPRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQENGPVQIADGLTLPQFVLKEEKDLRYC--TKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELL 331          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA3 (glycine receptor alpha 3 [Source:NCBI gene;Acc:100488938])

HSP 1 Score: 184.496 bits (467), Expect = 1.627e-51
Identity = 113/286 (39.51%), Postives = 179/286 (62.59%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI + +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  DG +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W+ N  V  +  + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ +  L
Sbjct:   64 PVNVTCNIFVNSFGSIAETTMDYRLNIFLRQKWNDPRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQENGPVQIADGLTLPQFVLKEEKDLRYC--TKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELL 343          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA3 (glycine receptor alpha 3 [Source:NCBI gene;Acc:100488938])

HSP 1 Score: 184.496 bits (467), Expect = 1.692e-51
Identity = 113/286 (39.51%), Postives = 179/286 (62.59%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI + +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  DG +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W+ N  V  +  + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ +  L
Sbjct:   53 PVNVTCNIFVNSFGSIAETTMDYRLNIFLRQKWNDPRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQENGPVQIADGLTLPQFVLKEEKDLRYC--TKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELL 332          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:100498379])

HSP 1 Score: 184.496 bits (467), Expect = 1.991e-51
Identity = 126/351 (35.90%), Postives = 204/351 (58.12%), Query Frame = 3
Query:   48 CKLTVFSLLFFERILF-----SESINDKFLSLESIKNPS-IRDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            C L    +  +E +LF     S+ +     S   + +PS   DK++ +I   Y     P  +   P  V  NI I +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS ++T+  +C M L NFPMD Q C + + S+GYTM+DL F+W+   +V  ++ + + +F    E     C      STG ++C++  F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ +  L
Sbjct:    2 CSLNALGIYLWETVLFFSLAASKEVGASARSSAKLMSPSDFLDKLMGKI-SGYDARIRPNFKG-PPVNVSCNIFINSFGSIAETTMDYRLNIFLRQQWNDPRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHEITTDNKLLRIFKNGNVLYSIRLTLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWEEVGAVQVAEGLTLPQFILKEEKDLRYC--TKHYSTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELL 344          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA3 (glycine receptor alpha 3 [Source:NCBI gene;Acc:100488938])

HSP 1 Score: 184.496 bits (467), Expect = 2.272e-51
Identity = 113/286 (39.51%), Postives = 179/286 (62.59%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI + +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  DG +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W+ N  V  +  + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ +  L
Sbjct:   69 PVNVTCNIFVNSFGSIAETTMDYRLNIFLRQKWNDPRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQENGPVQIADGLTLPQFVLKEEKDLRYC--TKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELL 348          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra2 (glycine receptor, alpha 2 subunit [Source:MGI Symbol;Acc:MGI:95748])

HSP 1 Score: 186.037 bits (471), Expect = 3.809e-52
Identity = 111/285 (38.95%), Postives = 180/285 (63.16%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNF 1079
            P  V  NI I +  S+    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    + +T  N L+R+  +G++LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W ++  V  ++ + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ + F
Sbjct:   70 PVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYC--TKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEF 348          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra1 (glycine receptor, alpha 1 subunit [Source:MGI Symbol;Acc:MGI:95747])

HSP 1 Score: 181.03 bits (458), Expect = 2.486e-50
Identity = 98/250 (39.20%), Postives = 154/250 (61.60%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSY 974
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+ +   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS +IT+  +C M L NFPMD Q C + + S+GYTM+DL F+W+   +V  +  + + +F    E     C      +TG ++C++  F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY
Sbjct:   64 PVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYC--TKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSY 307          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra3 (glycine receptor, alpha 3 subunit [Source:MGI Symbol;Acc:MGI:95749])

HSP 1 Score: 181.8 bits (460), Expect = 2.564e-50
Identity = 112/286 (39.16%), Postives = 179/286 (62.59%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W+    V  ++ + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ +  L
Sbjct:   85 PVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYC--TKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELL 364          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra1 (glycine receptor, alpha 1 subunit [Source:MGI Symbol;Acc:MGI:95747])

HSP 1 Score: 181.03 bits (458), Expect = 2.914e-50
Identity = 98/250 (39.20%), Postives = 154/250 (61.60%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSY 974
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+ +   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS +IT+  +C M L NFPMD Q C + + S+GYTM+DL F+W+   +V  +  + + +F    E     C      +TG ++C++  F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY
Sbjct:   64 PVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYC--TKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSY 307          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra4 (glycine receptor, alpha 4 subunit [Source:MGI Symbol;Acc:MGI:95750])

HSP 1 Score: 179.104 bits (453), Expect = 1.947e-49
Identity = 114/290 (39.31%), Postives = 184/290 (63.45%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYT-PVEVLTMDCNLNSKT---STGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI I +  S+    M +  + +LRQ+W D RLA+ +   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W     +  +  +Q++E  T P  +L  + +L   T   +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ + F+
Sbjct:   69 PVNVTCNIFINSFGSVTETTMDYRVNVFLRQQWNDPRLAYRE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLMFEW-----LEDAPAVQVAEGLTLPQFILRDEKDLGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFM 349          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|Q94900|GLUCL_DROME (Glutamate-gated chloride channel OS=Drosophila melanogaster OX=7227 GN=GluClalpha PE=1 SV=2)

HSP 1 Score: 194.126 bits (492), Expect = 3.655e-54
Identity = 119/285 (41.75%), Postives = 176/285 (61.75%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTD-QEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRN 1076
            P IV +N+ + +I +I  I M ++     R++W D RL + D Q   +  T      +  N++W+PDLFF N KEG  + + MPN  IR+  +G +LYS +I++  +C M+L  +P+D Q C + + SYG+T +DL F WK  + V   K++ +  F T  + LT  C  NSKT+TG YSCLK+    KR+ S YL+  YIP  ++V+VSW+SFW+   AVPARV+LG+ TLL + TQ  G++ +LP VSY KAID++   C+ F+ GA  EFA+ +  SR   N
Sbjct:   61 PAIVRINLFVRSIMTISDIKMEYSVQLTFREQWTDERLKFDDIQGRLKYLTL-----TEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF-TLEKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSN 337          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|G5EBR3|GLUCL_CAEEL (Glutamate-gated chloride channel alpha OS=Caenorhabditis elegans OX=6239 GN=glc-1 PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 5.758e-53
Identity = 122/316 (38.61%), Postives = 190/316 (60.13%), Query Frame = 3
Query:  135 IKNPSIRD-KIIVQIF-ENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRP-ISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQIS-EFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRR 1070
            I+ P   D KI+  +F   Y     P  +   P +V VN+ +  I+ IDV+NM ++A   LR+ W+D+RL++      +   +P   I ++ +++W+PD FF N K+ + + +  PN LIR+ +DG +LYS +I++  SC M+L  +PMD QQC I++ SY YT  D+ + WK +  +     +  S   +      T  C   S T+TG YSCL+    LKR+ S YL+  YIP+ ++V+VSW+SFW    A+PARVTLG+ TLL +  Q+ G++  LP VSYIKAID++I AC+ FI  A  EFA+ ++ + ++
Sbjct:   56 IEQPQTSDSKILAHLFTSGYDFRVRPPTDNGGPVVVSVNMLLRTISKIDVVNMEYSAQLTLRESWIDKRLSY----GVKGDGQPDFVILTVGHQIWMPDTFFPNEKQAYKHTIDKPNVLIRIHNDGTVLYSVRISLVLSCPMYLQYYPMDVQQCSIDLASYAYTTKDIEYLWKEHSPLQLKVGLSSSLPSFQLTNTSTTYC--TSVTNTGIYSCLRTTIQLKREFSFYLLQLYIPSCMLVIVSWVSFWFDRTAIPARVTLGVTTLLTMTAQSAGINSQLPPVSYIKAIDVWIGACMTFIFCALLEFALVNHIANKQ 365          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|P23416|GLRA2_HUMAN (Glycine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=GLRA2 PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 2.610e-51
Identity = 111/285 (38.95%), Postives = 180/285 (63.16%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNF 1079
            P  V  NI I +  S+    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    + +T  N L+R+  +G++LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W ++  V  ++ + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ + F
Sbjct:   70 PVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYC--TKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEF 348          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|Q7TNC8|GLRA2_MOUSE (Glycine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Glra2 PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 2.664e-51
Identity = 111/285 (38.95%), Postives = 180/285 (63.16%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNF 1079
            P  V  NI I +  S+    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    + +T  N L+R+  +G++LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W ++  V  ++ + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ + F
Sbjct:   70 PVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYC--TKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEF 348          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|P22771|GLRA2_RAT (Glycine receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Glra2 PE=1 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 5.243e-50
Identity = 110/285 (38.60%), Postives = 179/285 (62.81%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNF 1079
            P  V  NI I +  S+    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    + +T  N L+R+  +G++LYS ++T+  SC M L NFPMD Q C + + S+ YTM+DL F+W ++  V  ++ + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ + F
Sbjct:   70 PVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFEYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYC--TKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEF 348          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A0R3XAQ2 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS10612 PE=3 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 2.026e-115
Identity = 235/560 (41.96%), Postives = 322/560 (57.50%), Query Frame = 3
Query:   54 LTVFSLLFFERILFSESINDKFLSLESIKNPSIRDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWD---KNASKTDYDRIDPNRLKCNHNSKYENEKLNDEIFMGSEXXXXXXXXXXFCCTIPYVKTNSGKTCTVVSLDS------TPRKTRINELRKQVKVIQNQHVTEEEELKRLLLNSHYNVNTVYSNDSNTGSKYYSIRDKFKNNFNKTENIFRMNSLNDKL---NEDKTVDYNSCGDNIVMD----SDLDSYSRFLFPAFFLLYNCFYWLYYLVIT 1685
            L  FS+L  +RI  S   N   ++       S+R++I+  +FENY+ HE P   + +P++VIV I + AI S+DV  M + AD  LRQEW D RLAW     F+ FT+ +  P +  KLWLPDLFFRNGKEG ++KMT+PN+L R+  DG ILYSQKITMRFSCQM L+NFPMDSQ C +NIGSYGY   +L+F W+ +  ++ S  +QISEF +P  V++ DC+  S TSTG Y+CL++ FTL R+L S+L S YIP  LI++ SW SFW+ ++A PARVTLGLLTLL ILTQ  GVS +LPRVSYIKAID++ IACI+F +G   EF IAS+ +R  +   W    +NA + +  R                                      +C T   V    G + + + L S      +PRK  I+        ++   +   EE++R+L+        V+  +  + SK +   D  ++     +NI   ++LN  L    ED+        +         S++D YSRFLFPA FLLYNCFYWLYYLV+ 
Sbjct:    4 LATFSILLLQRI--SAQPNTTAVAFNGT---SMREQIMDYLFENYQSHERPGAAIKEPSVVIVYITVTAITSVDVRMMEYTADMMLRQEWRDPRLAWDRHPVFKQFTKNLVSPELKGKLWLPDLFFRNGKEGRLHKMTLPNYLTRISPDGNILYSQKITMRFSCQMDLANFPMDSQDCTMNIGSYGYEYSELQFVWRNDTPISMSPGMQISEFNSPENVVSYDCSAESSTSTGNYTCLEIRFTLSRELGSWLSSVYIPNFLIIVASWHSFWVDLDAKPARVTLGLLTLLSILTQASGVSSSLPRVSYIKAIDVWNIACIIFDVGVLIEFTIASHVARHIKAEDWKDDVRNAVRHELSR--------------------------------------WCATCQQVFYRRGPSASGIYLSSAGFPEASPRKF-IDSANATALALKRGKLEFCEEMERILIE-------VFLPEEMSKSKIFPA-DIGQSKAELQQNIIMTDALNAALLPCEEDREFPIPKSDELPTRKPKKISEIDGYSRFLFPACFLLYNCFYWLYYLVLV 511          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A068XZA7 (Glycine receptor subunit beta OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000506500 PE=3 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 1.006e-112
Identity = 224/529 (42.34%), Postives = 313/529 (59.17%), Query Frame = 3
Query:  147 SIRDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWD---KNASKTDYDRIDPNRLKCNHNSKYENEKLNDEIFMGSEXXXXXXXXXXFCCTIPYVKTNSGKTCTVVSL------DSTPRKTRINELRKQVKVIQNQHVTEEEELKRLLLNSHYNVNTVYSNDSNTGSKYYSIRDKFKNNFNKTENIFRMNSLNDK-LNEDKTVDYNSCGDNIVMD------SDLDSYSRFLFPAFFLLYNCFYWLYYLVIT 1685
            S+R++I+  +FENY+ HE P     +P++VIV I + AI S+DV  M + AD  LRQEW D RLAW     F+ FT+ +  P +  KLWLPDLFFRNGKEG ++KMT+PN+L R+  DG ILYSQKITMRFSCQM L+NFPMDSQ C +NIGSYGY   +L+F W+ +  ++ S  +QISEF +P  V++ DC+  S TSTG Y+CL++ FTL R+L S+L S YIP  LI++ SW SFW+ ++A PARVTLGLLTLL ILTQ  GV+ +LPRVSYIKAID++ IACI+F +G   EF IAS+ +RR +   W    +NA + +  R                                      +C T   V    G + + + L      +++PRK  I+        ++   +   EE++R+L+        V+  +  + SK +   D  ++     +N+   ++LN   L  ++  D+     + +        S++D YSRFLFPA FLLYNCFYWLYYLV+ 
Sbjct:   30 SMREQIMDYLFENYQSHERPGAANKEPSVVIVYITVTAITSVDVRMMEYTADMMLRQEWRDPRLAWDRHPVFKKFTKNLVSPELKGKLWLPDLFFRNGKEGRLHKMTLPNYLTRISPDGNILYSQKITMRFSCQMDLANFPMDSQDCTMNIGSYGYEYSELQFVWRNDTPISMSPGMQISEFNSPENVISYDCSAESSTSTGNYTCLEIRFTLTRELGSWLSSVYIPNFLIIVASWHSFWVDLDAKPARVTLGLLTLLSILTQASGVASSLPRVSYIKAIDVWNIACIIFDVGVLIEFTIASHVARRIKTEDWKDDVRNAVRHELSR--------------------------------------WCATCQQVFYQRGPSASGIYLSAAGFSEASPRKF-IDSANATALALKRGKLEFCEEMERILIE-------VFLPEEMSKSKIFP-ADIGQSKAELQQNMIMTDALNAALLPSEEWCDFPVPKSDELPTRKPKKISEIDGYSRFLFPACFLLYNCFYWLYYLVLV 511          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: W6UCW2 (Glycine receptor subunit alpha-3 OS=Echinococcus granulosus OX=6210 GN=EGR_06588 PE=3 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 2.861e-112
Identity = 223/529 (42.16%), Postives = 313/529 (59.17%), Query Frame = 3
Query:  147 SIRDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWD---KNASKTDYDRIDPNRLKCNHNSKYENEKLNDEIFMGSEXXXXXXXXXXFCCTIPYVKTNSGKTCTVVSL------DSTPRKTRINELRKQVKVIQNQHVTEEEELKRLLLNSHYNVNTVYSNDSNTGSKYYSIRDKFKNNFNKTENIFRMNSLNDK-LNEDKTVDYNSCGDNIVMD------SDLDSYSRFLFPAFFLLYNCFYWLYYLVIT 1685
            S+R++I+  +FENY+ HE P     +P++VIV I + AI S+DV  M + AD  LRQEW D RLAW     F+ FT+ +  P +  KLWLPDLFFRNGKEG ++KMT+PN+L R+  DG ILYSQKITMRFSCQM L+NFPMDSQ C +NIGSYGY   +L+F W+ +  ++ S  +QISEF +P  V++ DC+  S TSTG Y+CL++ FTL R+L S+L S YIP  LI++ SW SFW+ ++A PARVTLGLLTLL ILTQ  GV+ +LPRVSYIKAID++ IACI+F +G   EF +AS+ +RR +   W    +NA + +  R                                      +C T   V    G + + + L      +++PRK  I+        ++   +   EE++R+L+        V+  +  + SK +   D  ++     +N+   ++LN   L  ++  D+     + +        S++D YSRFLFPA FLLYNCFYWLYYLV+ 
Sbjct:   39 SMREQIMDYLFENYQSHERPGAANKEPSVVIVYITVTAITSVDVRMMEYTADMMLRQEWRDPRLAWDRHPVFKKFTKNLVSPELKGKLWLPDLFFRNGKEGRLHKMTLPNYLTRISPDGNILYSQKITMRFSCQMDLANFPMDSQDCTMNIGSYGYEYSELQFVWRNDTPISMSPGMQISEFNSPENVISYDCSAESSTSTGNYTCLEIRFTLTRELGSWLSSVYIPNFLIIVASWHSFWVDLDAKPARVTLGLLTLLSILTQASGVASSLPRVSYIKAIDVWNIACIIFDVGVLIEFTVASHVARRIKTEDWKDDVRNAVRHELSR--------------------------------------WCATCQQVFYQRGPSASGIYLSAAGFSEASPRKF-IDSANATALALKRGKLEFCEEMERILIE-------VFLPEEMSKSKIFPA-DIGQSKAELQQNMIMTDALNAALLPSEEWRDFPVPKSDELPTRKPKKISEIDGYSRFLFPACFLLYNCFYWLYYLVLV 520          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A068WQ06 (Glycine receptor subunit beta OS=Echinococcus granulosus OX=6210 GN=EgrG_000506500 PE=3 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 3.898e-112
Identity = 223/529 (42.16%), Postives = 313/529 (59.17%), Query Frame = 3
Query:  147 SIRDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWD---KNASKTDYDRIDPNRLKCNHNSKYENEKLNDEIFMGSEXXXXXXXXXXFCCTIPYVKTNSGKTCTVVSL------DSTPRKTRINELRKQVKVIQNQHVTEEEELKRLLLNSHYNVNTVYSNDSNTGSKYYSIRDKFKNNFNKTENIFRMNSLNDK-LNEDKTVDYNSCGDNIVMD------SDLDSYSRFLFPAFFLLYNCFYWLYYLVIT 1685
            S+R++I+  +FENY+ HE P     +P++VIV I + AI S+DV  M + AD  LRQEW D RLAW     F+ FT+ +  P +  KLWLPDLFFRNGKEG ++KMT+PN+L R+  DG ILYSQKITMRFSCQM L+NFPMDSQ C +NIGSYGY   +L+F W+ +  ++ S  +QISEF +P  V++ DC+  S TSTG Y+CL++ FTL R+L S+L S YIP  LI++ SW SFW+ ++A PARVTLGLLTLL ILTQ  GV+ +LPRVSYIKAID++ IACI+F +G   EF +AS+ +RR +   W    +NA + +  R                                      +C T   V    G + + + L      +++PRK  I+        ++   +   EE++R+L+        V+  +  + SK +   D  ++     +N+   ++LN   L  ++  D+     + +        S++D YSRFLFPA FLLYNCFYWLYYLV+ 
Sbjct:   30 SMREQIMDYLFENYQSHERPGAANKEPSVVIVYITVTAITSVDVRMMEYTADMMLRQEWRDPRLAWDRHPVFKKFTKNLVSPELKGKLWLPDLFFRNGKEGRLHKMTLPNYLTRISPDGNILYSQKITMRFSCQMDLANFPMDSQDCTMNIGSYGYEYSELQFVWRNDTPISMSPGMQISEFNSPENVISYDCSAESSTSTGNYTCLEIRFTLTRELGSWLSSVYIPNFLIIVASWHSFWVDLDAKPARVTLGLLTLLSILTQASGVASSLPRVSYIKAIDVWNIACIIFDVGVLIEFTVASHVARRIKTEDWKDDVRNAVRHELSR--------------------------------------WCATCQQVFYQRGPSASGIYLSAAGFSEASPRKF-IDSANATALALKRGKLEFCEEMERILIE-------VFLPEEMSKSKIFPA-DIGQSKAELQQNMIMTDALNAALLPSEEWRDFPVPKSDELPTRKPKKISEIDGYSRFLFPACFLLYNCFYWLYYLVLV 511          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A0R3S907 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS689 PE=3 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 9.532e-111
Identity = 231/537 (43.02%), Postives = 314/537 (58.47%), Query Frame = 3
Query:  123 SLESIKNPSIRDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWD---KNASKTDYDRIDPNRLKCNHNSKYENEKLNDEIFMGSEXXXXXXXXXXFCCTIPYVKTNSGKTCTVVSLDS------TPRKTRINELRKQVKVIQNQHVTEEEELKRLLLNSHYNVNTVYSNDSNTGSKYYSIRDKFKNNFNKTENIFRMNSLNDKL---NEDKTVDYNSCGDNIVMD----SDLDSYSRFLFPAFFLLYNCFYWLYYLVIT 1685
            ++ +I   S R+KI+  +F+NY+KHE P   + +PT+VIV I + AI S+DV  M + AD  LRQEW D RLAW     F+ +T+ +  P + ++LWLPDLFFRNGKEG ++KMTMPN+LIR+  DG ILYSQKITMRFSCQM L+NFPMDSQ C +NIGSYGY   +L+F W+ +  V+ S  +QISEF +P  V++ DC+  S TSTG Y+CL++ FTL R+L S+L S YIP  LI++ SW SFW+ ++A PARVTLGLLTLL ILTQ  GVS +LPRVSYIKAID++ IACI+F +G   EF IAS+ +RR +   W    +NA + +  R                                      +C T   V    G + + + L S      +PRK  I+        ++   +   EE++R+L+        V+  +  + SK +   D   +     +N+   + LN  L    ED         D         S++D YSRFLFPA F+LYNCFYWLYYLV+ 
Sbjct:  494 TMGAINATSTREKIMDYLFKNYQKHERPGAAIKEPTVVIVYITVTAITSVDVRMMEYTADMMLRQEWRDLRLAWDRHPIFKQYTKNLVAPQLKSELWLPDLFFRNGKEGRLHKMTMPNYLIRISPDGNILYSQKITMRFSCQMDLANFPMDSQDCNMNIGSYGYEYSELQFVWRNDTPVSMSSGMQISEFNSPENVISYDCSAESSTSTGNYTCLEMRFTLSRELGSWLSSVYIPNFLIIVASWHSFWVDLDAKPARVTLGLLTLLSILTQASGVSSSLPRVSYIKAIDVWNIACIIFDVGVLIEFTIASHVARRIKTEDWKDDVRNAVRHELSR--------------------------------------WCATCQQVFYQRGPSASGIYLSSAGYPEASPRKY-IDSANATALALKRGKLEFCEEMERILIE-------VFLPEEMSKSKIFPT-DIEHSKAELQQNMITTDGLNAALLPFEEDHDFPVPKSDDLPTRKPKKISEIDGYSRFLFPACFMLYNCFYWLYYLVLV 983          

HSP 2 Score: 269.626 bits (688), Expect = 1.367e-75
Identity = 157/302 (51.99%), Postives = 209/302 (69.21%), Query Frame = 3
Query:  150 IRDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASN 1055
            +R++++  +F+ Y+K+E+P       T+V V + I  I S+DV  M +     LRQEW D RLAW     FRNFT+ +S P + ++LWLPDLFFRNGKEG +++MT+PN+L R+  DG ILYSQKITMRFSCQM L  FPMD+Q C INIGS GY++++LRF W+ ++ +  ++ +QI+EF +P  V  +DCN  S       SCL   F L RQL S+  S YI   LIV+ SW SFW+ +EA PARV+LGLLTLLG++TQ  G+S  LPRVSYIKAID++ IACI F +    EFA+ASN
Sbjct:   30 LREQLMDHLFKGYQKYEIPGVFNKTTTVVTVYMTITEITSVDVRMMDYTTYLLLRQEWQDPRLAWNHIPRFRNFTKSLSSPKLKDQLWLPDLFFRNGKEGRIHQMTLPNYLTRISPDGNILYSQKITMRFSCQMDLKTFPMDAQTCYINIGSVGYSVNELRFIWRADQPIELAEGMQIAEFNSPESVEALDCNAFSTDENS--SCLTATFVLSRQLGSWFSSVYITTFLIVIASWHSFWVDIEAQPARVSLGLLTLLGLITQASGISATLPRVSYIKAIDVWNIACITFNVSVLIEFAVASN 329          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 185.652 bits (470), Expect = 3.482e-52
Identity = 117/296 (39.53%), Postives = 181/296 (61.15%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISI---PSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWDKNASK 1103
            P  V  NI I +  S+    M +  + +LRQ+W D RLA+++      +  P S+   PSM + +W PDLFF N K    + +T  N L+R+  DG +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W     V  ++ + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+++ FL  K   K
Sbjct:   58 PVNVTCNIFINSFGSVTETTMDYRVNIFLRQKWNDPRLAYSE------YPDP-SLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKDGTVLYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLDEGPVQVAEGLTLPQFIMREEKELGYC--TKHYNTGKFTCIEVKFKLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAGVNFVSRQQKEFLRLKRRQK 344          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 184.111 bits (466), Expect = 1.959e-51
Identity = 113/286 (39.51%), Postives = 179/286 (62.59%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W+ N  V  +  + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ +  L
Sbjct:   68 PVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQANGPVQVADGLTLPQFILKDESDLRYC--TKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELL 347          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:103026517])

HSP 1 Score: 182.57 bits (462), Expect = 5.795e-51
Identity = 120/347 (34.58%), Postives = 197/347 (56.77%), Query Frame = 3
Query:   48 CKLTVFSLLFFERILFSESINDKFLSLESIKNPSIRDKIIVQIFENYKKHELPTEELLK--PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            CKL    +  +E ILF      +  +     +P    + + ++      ++       K  P  V  NI I +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS +IT+  +C M L NFPMD Q C + + S+GYTM+DL F+W    +V  +  + + +F    E     C      +TG ++C++  F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  +R+ +  L
Sbjct:    2 CKLNALGIYLWETILFFSLAASQQAAARKAASPMPPSEFLDKLMGKVSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYC--TKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELL 342          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 183.341 bits (464), Expect = 8.042e-51
Identity = 99/250 (39.60%), Postives = 156/250 (62.40%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSY 974
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W+ N  V  +  + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY
Sbjct:   68 PVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQANGPVQVADGLTLPQFILKDESDLRYC--TKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSY 311          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 181.8 bits (460), Expect = 1.029e-50
Identity = 113/287 (39.37%), Postives = 182/287 (63.41%), Query Frame = 3
Query:  222 KPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKT---STGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRR 1073
             P  V  NI I +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W+ N  V  +  + + +F     +L  + +L   T   +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ +
Sbjct:   67 PPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQANGPVQVADGLTLPQF-----ILKDESDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK 344          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 189.119 bits (479), Expect = 1.291e-54
Identity = 114/286 (39.86%), Postives = 181/286 (63.29%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  DG +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+WK   +V  ++ + + +F    E   + C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ +  L
Sbjct:    5 PVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCAMQLESFGYTMNDLIFEWKQEGAVQVAEGLTLPQFVLKDEKDLVYC--TKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKELL 284          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 179.874 bits (455), Expect = 1.573e-52
Identity = 93/251 (37.05%), Postives = 154/251 (61.35%), Query Frame = 3
Query:  225 PTI-VIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTD-QEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVS 971
            PT+ V  +++I +  SI+   M +    +LRQ+W+D RL ++   E + +  +     S    +W PDLFF N K  + +++T  N ++R+  +G +L++ ++T+  SC M L NFPMD+Q C + + S+GYTM DL F W   E V  SK++ + +F    ++ T  C+    + TG +SC+   F L R++  YL+  Y+P+ LIV++SW+SFWI++EA PARV LG+ T+L + TQ+ G   +LP+V+
Sbjct:   28 PTVNVNCSVYIKSFGSIEETTMDYQVTIFLRQKWIDPRLTYSHYPEPYLDLDQ-----SNIQYIWRPDLFFDNEKSAYFHEVTTDNKMLRIFKNGLVLFTVRLTLTLSCPMDLRNFPMDTQMCYMFLESFGYTMADLSFHWDEEEPVIISKELVLPQFVLSSKIDTDSCDKLYSSGTGHFSCISARFVLHREMGFYLIQLYVPSALIVIISWVSFWINMEAAPARVALGITTVLTMTTQSTGARASLPKVT 273          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008467.1 (pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 gene:ENSPMAG00000007648.1 transcript:ENSPMAT00000008467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.014 bits (432), Expect = 2.964e-47
Identity = 108/299 (36.12%), Postives = 174/299 (58.19%), Query Frame = 3
Query:  234 VIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISI----PSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKT-STGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWDKNASKTDYD 1115
            V   + I +  SI      +    YLRQ W D RLA++          P+ +     S    +W PDLFF N K    +++T  N ++R+ ++G + Y+ ++T+  SC M L NFPMD+Q C + + S+GYT  D+ F W     V+  + + + +F    ++ T  C   +KT STG+++C+   FTL R++  YL+  Y+P+ILIV++SW+SFWI++EA PARV LG+ T+L + TQ+ G   +LP+VSYIKA+DI++  C+LF+  A  E+A  +  SR+ + F+     ++   D
Sbjct:   71 VSCGVFIRSFGSIQEATSDYRMTVYLRQRWTDPRLAYSHY--------PVPLLHLDQSNIKHIWKPDLFFDNEKSAHFHEITTDNKMLRIANNGVVDYAMRLTLTLSCPMDLHNFPMDTQMCSMYLESFGYTTADIVFHWNGPTPVSLFEGLTLPQFVLSNKISTGSC---TKTYSTGSFTCIFAKFTLHREMGFYLIQLYVPSILIVILSWVSFWINMEAAPARVALGITTVLTLTTQSTGARASLPKVSYIKAMDIWMATCLLFVFAALLEYAAVNVTSRQSQGFMKKGRGNQKPID 358          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: gabra6a (gamma-aminobutyric acid (GABA) A receptor, alpha 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1692])

HSP 1 Score: 154.451 bits (389), Expect = 8.580e-41
Identity = 100/286 (34.97%), Postives = 154/286 (53.85%), Query Frame = 3
Query:  228 TIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPS----MFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQW--KTNESVTQSKDIQISEFYTPVEVLTMDCNLNS---KTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNY 1058
            T V  +I++ +   +  + M +  D + RQ W+D RL          F  PI I      M N++W PD +FRNGK+   + MT PN L R+  +G +LY+ ++T+   C M L +FPMD   C +  GSY Y   ++ + W    N SV   +     E  + ++      N++S   K+  G Y  + + F LKR++  ++V TYIP I+ V++S +SFWI+ E+VPAR   G+ T+L + TQ+    G+LP+VSY  A+D +I     F+  A  EFA A NY
Sbjct:   69 TEVKTDIYVTSFGPVSDVEMDYTMDVFFRQTWVDERL---------KFDGPIEILRLNNLMVNRIWTPDTYFRNGKKSIAHNMTAPNKLFRIMQNGTVLYTMRLTINAECPMRLMDFPMDGHTCPLKFGSYAYPKSEIIYSWTKGANNSVEVPQ-----ESSSLLQYDLTGHNVSSEELKSKIGDYVVMTVSFYLKRKMGYFIVQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTQSISARGSLPKVSYATAMDWFIAVSFAFVFSALIEFA-AVNY 339          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000073.1 (pep scaffold:Pmarinus_7.0:GL476340:503477:541718:1 gene:ENSPMAG00000000064.1 transcript:ENSPMAT00000000073.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.828 bits (377), Expect = 7.770e-40
Identity = 82/250 (32.80%), Postives = 140/250 (56.00%), Query Frame = 3
Query:  165 IVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQW-KTNESVTQSKDIQISE-----FYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARV 896
            I  +   Y K+  P+ +   P  + +++ I +I++I  INM + A  +LRQ W D RL +   ++     R + +      LW+PD F  + K  F++ +T+ N LIR+  +G +LY+ +IT   +C M L+ +PMD Q C + + S+GY  +DL F W + N+SV     +++++     +YT V          +   TG Y  L   F L+R +  +++ TYIP++L+V++SW+SFWIS  +VPAR+
Sbjct:   37 IQNLMRGYNKYLRPSFDN-GPVAIGMSLDIASIDTISEINMDYTATIFLRQRWQDERLCFEGNKSLSLDGRLVEL------LWVPDTFIVDSKRSFLHDITVENRLIRIFPNGTVLYALRITTTVACNMDLTKYPMDKQTCTLQLESWGYNTNDLVFYWTRGNDSVRGLDTLKLAQYTVEGYYTSVS--------EAVYETGQYPKLVFHFKLRRNILYFILETYIPSVLLVVLSWVSFWISQSSVPARI 271          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO45677 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS31])

HSP 1 Score: 165.622 bits (418), Expect = 1.415e-46
Identity = 105/277 (37.91%), Postives = 165/277 (59.57%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISI--PSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVS-GNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAI 1046
            P +V   +++++I+     +M F A+ Y RQ W D RLA+       N T P+      + + LW PD +F N  +G ++++T+ N  +R+ SDG ++ S ++T+  SC M    FPMD Q C I+  SYGYT  D+ +QW  +E VT + D +I++F   +E +  + NL  +  TG +S L +   L R+L  YL   Y+PA+LIVM+SWLSF++   + PARV+LG+ T+L + T   G+  G+LP VSY+KA+D Y+      + GAF E+A+
Sbjct:    1 PVLVTTELNLVSISQFREADMEFTAEMYFRQAWHDPRLAFG--VTMGNSTVPVITLYGDLSDSLWQPDTYFENEVQGKIHELTIKNKYMRVYSDGRVMTSLRVTLSCSCAMDFRKFPMDKQNCGISFASYGYTTADIVYQW-ADERVTWAHDQEIAQFV--LEKIETE-NLTRRYITGDFSALGIRLRLNRRLGHYLTRVYVPAVLIVMLSWLSFYLDRHSAPARVSLGITTVLTMTTLLIGIGQGSLPVVSYVKALDWYLFVSYCMVFGAFAEYAV 271          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO38597 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCG0])

HSP 1 Score: 159.073 bits (401), Expect = 2.133e-44
Identity = 92/250 (36.80%), Postives = 139/250 (55.60%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSY 974
            P IV V  ++ +I +ID   M F+ D + RQ W + RL +  Q    +  R I  P +    W PD+F +N KE   +++   N +  +  DG IL S +IT   SCQM+   FPMD Q+C    GSYG+T DD+  + +  + +  S +++IS+ Y+  EV + D       +TG +S       LKR+L  Y+   Y+PA L+V +SW+SFWI   +VPARV+LG++T+L + +   G  G  P VSY
Sbjct:    3 PVIVDVEAYVASIGAIDEKKMEFSVDIFFRQRWREERLCYLPQAGKGSGQRLILNPVLLKNTWRPDVFIKNSKEARFHEVPSDNVMYGISPDGNILLSSRITTTLSCQMNFRRFPMDVQKCHFQTGSYGHTEDDIVIRCRGGKGLIISDEVEISQ-YSITEVTSRD--FKGVYNTGVFSEPIATIVLKRRLMYYVYGYYLPAGLVVFLSWISFWIDPRSVPARVSLGVITILAMGSFLHG--GKGPSVSY 247          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO40478 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S763])

HSP 1 Score: 154.836 bits (390), Expect = 5.961e-43
Identity = 89/254 (35.04%), Postives = 150/254 (59.06%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPS-MFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQIS-EFYTPVEVLT--MDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSY 974
            P IV  ++ +L I  I   +M F   F+ RQ W D RLA+     +  + + +++ + M + +W+PD++F N K G  + +T  N ++R+  DG + +S +++M  SC M L ++PMD Q C+++  S+ Y   +L F+W  N     +K++Q+S E   P  +LT     +  +  +TG+YS L +LF  +R +  +L+ TYIPA LIVM+SW++FWI+  + PAR+ LG+ T+L + T       +LP+VSY
Sbjct:    5 PVIVYTDMFVLDIGDISEADMEFRVMFFYRQYWQDTRLAYD----YTGYNKRLALNARMVDYMWIPDIYFVNEKSGIKHDLTKQNEVVRVWPDGRVFHSIRLSMTASCPMKLHSYPMDKQTCKLSFESFSYPSTELIFKWNKNRG---NKEVQVSDELQIPQFILTEYKTTSEFANFTTGSYSRLTVLFRFERSIGFFLIQTYIPAYLIVMLSWIAFWINHTSTPARIGLGITTVLTMTTLTNSARASLPKVSY 251          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO35410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK4])

HSP 1 Score: 154.451 bits (389), Expect = 2.336e-42
Identity = 92/277 (33.21%), Postives = 157/277 (56.68%), Query Frame = 3
Query:  162 IIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNK-LWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQW----KTNESVTQSKDIQISEFYTPVEVLTMDCNLN-SKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSY 974
            ++  + E Y +   P  +  +P +V V++++  I ++  +NM F  D YLRQ W D RL +  Q      T    + S  NK +W+P  +F   K+ + + +T  N+L+++K DG + YS ++T+  SC++ L +FP D+Q C +++ SYGY   D+ + W        ++    D+++ +F    EVL +  +   +K + G +S L   F +KR++  +L+ TYIP+ +IV++SW+SFWI  E  PARV LG+ T+L + T       NLP+VSY
Sbjct:   25 VLKNLLEGYDRRIRPGSKG-EPVVVYVDMYVSNIWAMQEMNMDFTIDIYLRQYWRDERLQFETQTPGAMLT----LSSDINKQIWVPSTYFLATKKAYFHDVTTDNYLLQVKPDGSLFYSIRLTITTSCRLDLRDFPHDTQSCSLSLESYGYQSTDVLYVWNERLDNTSAIYIHDDLELPQF----EVLGVSRSAKMNKYNIGNHSSLVANFRMKRRIGYFLIDTYIPSTIIVIISWISFWIDPETAPARVALGITTVLTMTTLISSARANLPKVSY 292          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO30047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1W8])

HSP 1 Score: 152.91 bits (385), Expect = 5.113e-42
Identity = 96/280 (34.29%), Postives = 161/280 (57.50%), Query Frame = 3
Query:  150 IRDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNES-----VTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSY 974
            I D I+    E Y K   P      P IV V   +L+I++I+V++M +  D +LRQ W+D RL+        N T  +S  ++ +K+WLPD +F N K+G  +K+T  N ++ ++ DG++ Y+ ++T+R SC M+L  FPMD+Q C + + SYGY+ D + F+W+  +      V +S  +       P E  +  C +      G +S +K LFT +R  S +++  Y P  LIV+VSW+SF +  E  PAR+TLG+ ++L ++T    ++ ++P+V+Y
Sbjct:    4 ILDSILTA--EKYDKRLRPNYGA-GPVIVTVGFWVLSIDTINVVDMDYTLDIFLRQSWVDERLSHD-----LNTTMFLS-NTVMDKIWLPDSYFVNAKQGSFHKVTKDNMMVMIQPDGQVQYNARVTIRASCPMNLRKFPMDTQHCPLTLESYGYSSDHIVFKWEIEDGDGLGFVPESLKMLPQYKLAPNEPRSELCFV----IPGNWSGIKALFTFERMYSYFVIHVYGPCALIVVVSWVSFLLPKEQAPARITLGVTSVLTVVTILNMLNNSMPKVNY 270          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: ENSORLT00000025211.2 (glycine receptor subunit alpha-3 [Source:NCBI gene;Acc:101174559])

HSP 1 Score: 186.808 bits (473), Expect = 1.589e-52
Identity = 117/295 (39.66%), Postives = 185/295 (62.71%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL-WDKNASKT 1106
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+ +   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL FQW+ N  V  ++ + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ +  L + ++ SKT
Sbjct:   61 PVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYAE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFQWQENGPVQVAEGLTLPQFILKDESDLRYC--TKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRHKSKT 349          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra4a (glycine receptor subunit alpha-4-like [Source:NCBI gene;Acc:101156095])

HSP 1 Score: 185.267 bits (469), Expect = 6.098e-52
Identity = 116/289 (40.14%), Postives = 184/289 (63.67%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKT---STGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI I +  SI    M +  + +LRQ W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  DG +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W ++  V  + D+ + +F     VL  + +L   T   +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ + F+
Sbjct:   69 PVNVTCNIFINSFGSITETTMDYRLNVFLRQNWNDPRLAYSE---YPDNSLDLD-PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQDGSVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLIFEWLSDNPVQVADDLTLPQF-----VLKEEKDLGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFI 348          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra2 (glycine receptor alpha 2 [Source:NCBI gene;Acc:101169154])

HSP 1 Score: 184.496 bits (467), Expect = 1.243e-51
Identity = 114/285 (40.00%), Postives = 178/285 (62.46%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNF 1079
            P  V  NI I +  SI    M +  + +LRQ+W D RLA++    + + +  +  PSM + +W PDLFF N K    + +T  N L+R+  DG +LYS ++T+  SC M L NFPMD Q C + + S+GYTM+DL F+W    +V  S+ + + +F    E     C      +TG ++C+++ F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+++ F
Sbjct:   71 PVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSK---YPDSSLDLD-PSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRIFKDGTVLYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMNDLVFEWLEYGAVQVSEGLTLPQFIMKEEKELGYC--TKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAGVNFVSRQQKEF 349          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra4b (glycine receptor subunit alpha-2 [Source:NCBI gene;Acc:101174852])

HSP 1 Score: 183.726 bits (465), Expect = 4.546e-51
Identity = 149/488 (30.53%), Postives = 239/488 (48.98%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKT---STGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWDKNASKTDYDRIDPNRLKCNHNSKYENEKLNDEIFMGSEXXXXXXXXXXFCCTIPYVKTNSGKTCTVVSLDSTPRKTRINELRKQVKVIQNQHVTEEEELKRLLLNSHYNVNTVYSNDSNTGSKYYSIRDKFKNNFNKTENIFRMNSLNDKLNEDKTVDYNSCGDNIVMDSDLDSYSRFLFPAFFLLYNCFYWLYYLV 1679
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+ +   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS ++T+  SC M L NFPMDSQ C + + S+GYTM+DL F+W    +V  + D+ + +F     VL  +  L   T   +TG ++C+++ F L+RQ+  YL+  YIP++L V++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  SR+ + F   +   K      +  RL+        + K+      G+                   + N  + C+  +        R  EL +Q  ++Q+  +    E          +   V++ D   G  +Y IR +F     + + I                                  SR LFP  FL++N  YWL Y V
Sbjct:   65 PVNVTCNIFINSFGSITETTMDYRLNVFLRQQWNDPRLAYKE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQNGNVLYSIRLTLILSCPMDLKNFPMDSQMCTMQLESFGYTMNDLIFEWLDVGAVQVADDLMLPQF-----VLKEEKGLGYCTKYYNTGKFTCIEVKFYLERQMGYYLIQMYIPSLLTVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFFRMRKKLK------EQQRLRTGS----ADSKVKGNNTPGNSA----------------AQGNVNQRCSACA--------REEELAQQGYLLQSFGLALSTE-----RGPEMDATPVFA-DLPPGLGFYEIRRRFVERAKRIDTI----------------------------------SRALFPMTFLVFNVLYWLTYKV 469          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:101173557])

HSP 1 Score: 180.259 bits (456), Expect = 2.901e-50
Identity = 111/286 (38.81%), Postives = 177/286 (61.89%), Query Frame = 3
Query:  225 PTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFL 1082
            P  V  NI I +  SI    M +  + +LRQ+W D RLA+++   + + +  +  PSM + +W PDLFF N K    +++T  N L+R+  +G +LYS +IT+  +C M L NFPMD Q C + + S+GYTM+DL F+W    +V  +  + + +F    E     C      +TG ++C++  F L+RQ+  YL+  YIP++LIV++SW+SFWI+++A PARV LG+ T+L + TQ+ G   +LP+VSY+KAIDI++  C+LF+  A  E+A  +  +R+ +  L
Sbjct:   53 PVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSE---YPDDSLDLD-PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLILACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYC--TKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELL 332          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000071005.1 (SMESG000071005.1)

HSP 1 Score: 1003.43 bits (2593), Expect = 0.000e+0
Identity = 545/548 (99.45%), Postives = 547/548 (99.82%), Query Frame = 3
Query:   42 MHCKLTVFSLLFFERILFSESINDKFLSLESIKNPSIRDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWDKNASKTDYDRIDPNRLKCNHNSKYENEKLNDEIFMGSEXXXXXXXXXXFCCTIPYVKTNSGKTCTVVSLDSTPRKTRINELRKQVKVIQNQHVTEEEELKRLLLNSHYNVNTVYSNDSNTGSKYYSIRDKFKNNFNKTENIFRMNSLNDKLNEDKTVDYNSCGDNIVMDSDLDSYSRFLFPAFFLLYNCFYWLYYLVIT 1685
            MHCKLTVFSLLFFERILFSESINDKFLSLESIKNPSIRDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVTLGLLTLLGILTQNKGVSGNLPRVSYIKAIDIYIIACILFIIGAFTEFAIASNYSRRRRNFLWDKNASKT YDRIDPNRLKCNHNSKYE+EKLNDEIFMGSEKLVLKKRKKKFCCTIPYVKTNSGKTCTVVSLDSTPRKTRINELRKQVKVIQNQHVTEEEELKRLLLNSHYNVNTVYSNDSNTGSK+YSIRDKFKNNFNKTENIFRMNSLNDKLNEDKTVDYNSCGDNIVMDSDLDSYSRFLFPAFFLLYNCFYWLYYLVIT
Sbjct:    1 MHCKLTVFSLLFFERILFSESINDKFLSLESIKNPSIRDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVTLGLLTLLGILTQNKGVSGNLPRVSYIKAIDIYIIACILFIIGAFTEFAIASNYSRRRRNFLWDKNASKTVYDRIDPNRLKCNHNSKYESEKLNDEIFMGSEKLVLKKRKKKFCCTIPYVKTNSGKTCTVVSLDSTPRKTRINELRKQVKVIQNQHVTEEEELKRLLLNSHYNVNTVYSNDSNTGSKFYSIRDKFKNNFNKTENIFRMNSLNDKLNEDKTVDYNSCGDNIVMDSDLDSYSRFLFPAFFLLYNCFYWLYYLVIT 548          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000037124.1 (SMESG000037124.1)

HSP 1 Score: 329.717 bits (844), Expect = 6.252e-107
Identity = 186/315 (59.05%), Postives = 242/315 (76.83%), Query Frame = 3
Query:  153 RDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWDKNA 1097
            R++I   IF+ YK +E P+E   K TIV V + +LAINS+DVI M ++ D YLRQEW+D RLAW   E FR++   +  P    K+WLPDLFFRNGK+G+++ MT PN+L+RL+ +GE+LYSQKITM+FSCQM L  FPMD+Q+C ++IGSYGYT+D L+F+W++ E +     +QI EF  P  V T+DC+  S TSTG Y+C+K  F L+RQL SYL STYIP +LIVMVSWL+FW+S++AVPAR+TLGLLTLLGILTQ  G+S NLPRVSYIKAID++IIACILF+IGA  EFAIAS  SR+ ++ LW ++ 
Sbjct:   14 REQIQNHIFKGYKSNERPSEN--KQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARITLGLLTLLGILTQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDV 326          

HSP 2 Score: 63.1586 bits (152), Expect = 2.544e-10
Identity = 23/34 (67.65%), Postives = 31/34 (91.18%), Query Frame = 3
Query: 1584 IVMDSDLDSYSRFLFPAFFLLYNCFYWLYYLVIT 1685
            + +DS++D YS+FLFPAFF+LYNCFYWLYYL++ 
Sbjct:  415 VQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILV 448          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000061905.1 (SMESG000061905.1)

HSP 1 Score: 328.946 bits (842), Expect = 1.474e-106
Identity = 187/320 (58.44%), Postives = 243/320 (75.94%), Query Frame = 3
Query:  138 KNPSIRDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWDKNA 1097
            +N   R+ I+  +FENY  HE P+E  +K T V+V + +LAINS+DV+ M ++ D  LRQEWLD RL W       ++ + IS P++  K+WLPDLFFRNGK+G+++ MT+PN+L+RL S+G ILYSQKITMRFSCQM+LS FPMDSQ+C ++IGSYGYT+D L+F W+  E +  + +IQI EF    +  T DC+  + TSTG Y+CLK  F L+RQL SYL STYIP +LIVMVSWL+FW+SVEA+PAR+TLGLLTLLGILTQ  G+S +LPRVSYIKAIDI+IIACI+F+IGA  EFA+AS  +RRR++  W K  
Sbjct:   44 ENNVTREDILKIVFENYNLHERPSE--VKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARITLGLLTLLGILTQATGMSNSLPRVSYIKAIDIWIIACIIFVIGALIEFAMASMIARRRKSEDWQKQV 361          

HSP 2 Score: 61.2326 bits (147), Expect = 1.240e-9
Identity = 24/32 (75.00%), Postives = 29/32 (90.62%), Query Frame = 3
Query: 1590 MDSDLDSYSRFLFPAFFLLYNCFYWLYYLVIT 1685
            +DS++D YSRFLFPA F+LYNCFYWLYYLV+ 
Sbjct:  433 VDSEIDCYSRFLFPACFVLYNCFYWLYYLVLV 464          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000041885.1 (SMESG000041885.1)

HSP 1 Score: 324.709 bits (831), Expect = 3.692e-105
Identity = 182/317 (57.41%), Postives = 246/317 (77.60%), Query Frame = 3
Query:  153 RDKIIVQIFEN--YKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWDKNA 1097
            RD I+ +I +   YKK E P+E  +  T V+V + +LAINS+ V  M ++ D YLRQEW D RL W + E FR+F   I  PS+   LWLPDLFFRNGKEG+++KMT+PN+L+RL+ +G ILYSQKITMRFSC+M+L  FPMDSQ+C ++IGSYGYT+D+L+F W+  + +  S  +QISEF +P +V T+DC  +S TSTG Y+CLK  F L+RQL SYLVST++P+ILIVMVSWL+FWI+V++VPARVTLGL+TLLG+LTQ  G+S  LPRVSYIKAID+++IACI+F+IGA  E+ +AS  +R++++  W+K+ 
Sbjct:   32 RDLIMERIVDKKRYKKDERPSE--IYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARVTLGLVTLLGMLTQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDV 346          

HSP 2 Score: 65.0846 bits (157), Expect = 6.208e-11
Identity = 27/31 (87.10%), Postives = 29/31 (93.55%), Query Frame = 3
Query: 1593 DSDLDSYSRFLFPAFFLLYNCFYWLYYLVIT 1685
            DSD+DSYSRFLFPA FLLYNCFYWLYYLV+ 
Sbjct:  411 DSDIDSYSRFLFPACFLLYNCFYWLYYLVLV 441          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000032691.1 (SMESG000032691.1)

HSP 1 Score: 320.857 bits (821), Expect = 1.170e-103
Identity = 185/337 (54.90%), Postives = 248/337 (73.59%), Query Frame = 3
Query:  153 RDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVXXXXXXXXXXXXQNKGVSGNLPRVSYXXXXXXXXXXXXXXXXXXFTEFAIASNYSRRRRNFLWD---KNASKTDYDR--IDPNRLKCNH 1148
            R++I+ +I +NY  +E P E     T V+V + +LAINS++V NM ++ D YLRQ W+D RL W +   F++F   +  PS+ ++LWLPDLFFRNGKEG+++ MT PN+L+RL  +GE+LYSQKITMRFSCQM L  +PMD+Q CE+NIGSYGYT+D L+F W     +    ++QI EF  P +V T DC  +S T TG YSCLK LF L+RQL SYLVST+IP  LIV+VSWL+FW+SVEAVPAR+TLGLLTLLGILTQ  G+SGNLPRVSYIKAID+++IACI+F+IGA  EFA+AS  +++++ + W    ++  + +  R  +  NR K +H
Sbjct:   31 RERIMDKILQNYSLNERPIES--NQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDARLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARITLGLLTLLGILTQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHH 365          
The following BLAST results are available for this feature:
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLRA23.539e-5239.30glycine receptor alpha 2 [Source:HGNC Symbol;Acc:H... [more]
GLRA25.436e-5238.95glycine receptor alpha 2 [Source:HGNC Symbol;Acc:H... [more]
GLRA34.089e-5137.83glycine receptor alpha 3 [Source:HGNC Symbol;Acc:H... [more]
GLRA31.479e-5039.16glycine receptor alpha 3 [Source:HGNC Symbol;Acc:H... [more]
GLRA22.056e-5039.62glycine receptor alpha 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
avr-142.605e-5639.67pep chromosome:WBcel235:I:5967250:5973320:-1 gene:... [more]
glc-36.029e-5644.68Glutamate-gated ChLoride channel; Glutamate-gated ... [more]
avr-141.854e-5440.69pep chromosome:WBcel235:I:5968009:5973320:-1 gene:... [more]
avr-141.854e-5440.69pep chromosome:WBcel235:I:5967250:5973320:-1 gene:... [more]
glc-14.526e-5438.61Glutamate-gated chloride channel alpha [Source:Un... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GluClalpha4.262e-5742.55gene:FBgn0024963 transcript:FBtr0301379[more]
GluClalpha1.596e-5642.25gene:FBgn0024963 transcript:FBtr0343789[more]
GluClalpha2.027e-5642.11gene:FBgn0024963 transcript:FBtr0343790[more]
GluClalpha2.247e-5642.55gene:FBgn0024963 transcript:FBtr0335416[more]
GluClalpha2.247e-5642.11gene:FBgn0024963 transcript:FBtr0335417[more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra4a6.632e-5240.00glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
glra4a6.825e-5240.00glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
glra4a6.825e-5240.00glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
glra4a8.361e-5240.00glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
glra23.323e-5139.51glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLRA31.546e-5139.51glycine receptor alpha 3 [Source:NCBI gene;Acc:100... [more]
GLRA31.627e-5139.51glycine receptor alpha 3 [Source:NCBI gene;Acc:100... [more]
GLRA31.692e-5139.51glycine receptor alpha 3 [Source:NCBI gene;Acc:100... [more]
GLRA11.991e-5135.90glycine receptor alpha 1 [Source:NCBI gene;Acc:100... [more]
GLRA32.272e-5139.51glycine receptor alpha 3 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glra23.809e-5238.95glycine receptor, alpha 2 subunit [Source:MGI Symb... [more]
Glra12.486e-5039.20glycine receptor, alpha 1 subunit [Source:MGI Symb... [more]
Glra32.564e-5039.16glycine receptor, alpha 3 subunit [Source:MGI Symb... [more]
Glra12.914e-5039.20glycine receptor, alpha 1 subunit [Source:MGI Symb... [more]
Glra41.947e-4939.31glycine receptor, alpha 4 subunit [Source:MGI Symb... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q94900|GLUCL_DROME3.655e-5441.75Glutamate-gated chloride channel OS=Drosophila mel... [more]
sp|G5EBR3|GLUCL_CAEEL5.758e-5338.61Glutamate-gated chloride channel alpha OS=Caenorha... [more]
sp|P23416|GLRA2_HUMAN2.610e-5138.95Glycine receptor subunit alpha-2 OS=Homo sapiens O... [more]
sp|Q7TNC8|GLRA2_MOUSE2.664e-5138.95Glycine receptor subunit alpha-2 OS=Mus musculus O... [more]
sp|P22771|GLRA2_RAT5.243e-5038.60Glycine receptor subunit alpha-2 OS=Rattus norvegi... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3XAQ22.026e-11541.96Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A068XZA71.006e-11242.34Glycine receptor subunit beta OS=Echinococcus mult... [more]
W6UCW22.861e-11242.16Glycine receptor subunit alpha-3 OS=Echinococcus g... [more]
A0A068WQ063.898e-11242.16Glycine receptor subunit beta OS=Echinococcus gran... [more]
A0A0R3S9079.532e-11143.02Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra23.482e-5239.53glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra31.959e-5139.51glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra15.795e-5134.58glycine receptor alpha 1 [Source:NCBI gene;Acc:103... [more]
glra38.042e-5139.60glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra31.029e-5039.37glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra21.291e-5439.86glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra11.573e-5237.05glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
ENSPMAT00000008467.12.964e-4736.12pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 ge... [more]
gabra6a8.580e-4134.97gamma-aminobutyric acid (GABA) A receptor, alpha 6... [more]
ENSPMAT00000000073.17.770e-4032.80pep scaffold:Pmarinus_7.0:GL476340:503477:541718:1... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO456771.415e-4637.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385972.133e-4436.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404785.961e-4335.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354102.336e-4233.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO300475.113e-4234.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000025211.21.589e-5239.66glycine receptor subunit alpha-3 [Source:NCBI gene... [more]
glra4a6.098e-5240.14glycine receptor subunit alpha-4-like [Source:NCBI... [more]
glra21.243e-5140.00glycine receptor alpha 2 [Source:NCBI gene;Acc:101... [more]
glra4b4.546e-5130.53glycine receptor subunit alpha-2 [Source:NCBI gene... [more]
glra12.901e-5038.81glycine receptor alpha 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071005.10.000e+099.45SMESG000071005.1[more]
SMESG000037124.16.252e-10759.05SMESG000037124.1[more]
SMESG000061905.11.474e-10658.44SMESG000061905.1[more]
SMESG000041885.13.692e-10557.41SMESG000041885.1[more]
SMESG000032691.11.170e-10354.90SMESG000032691.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030843 ID=SMED30030843|Name=Glycine receptor subunit alpha-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1769bp
CAGAATTCTGAAATGATTCTTTACATAAATCGTTTCAAATTATGCATTGC
AAATTAACGGTTTTTTCATTATTATTCTTCGAAAGAATTCTTTTCTCGGA
ATCTATAAATGATAAGTTTTTGTCTCTGGAATCGATAAAAAATCCATCGA
TTCGTGACAAAATAATCGTTCAAATTTTTGAAAACTATAAAAAGCACGAG
CTTCCAACAGAGGAGTTGCTGAAACCGACCATAGTAATAGTGAATATTCA
CATTCTGGCCATCAATTCCATAGATGTGATAAACATGGCATTCAATGCCG
ATTTCTATCTCAGACAGGAATGGCTCGACCGCAGGTTGGCTTGGACTGAT
CAGGAAGCATTCAGAAATTTCACCCGTCCAATCTCGATTCCGTCTATGTT
CAATAAACTATGGCTACCGGATTTATTTTTTAGAAATGGCAAGGAGGGAT
TTATGTATAAAATGACAATGCCTAACTTTCTAATACGCCTGAAGTCGGAC
GGAGAAATATTATACAGTCAAAAAATAACCATGAGATTTTCTTGTCAAAT
GCATCTGAGCAATTTTCCTATGGACAGTCAACAATGCGAAATAAATATCG
GCAGCTATGGATATACTATGGATGATTTGAGGTTTCAATGGAAAACCAAC
GAATCTGTAACTCAGTCTAAGGATATTCAAATTTCAGAATTTTACACGCC
AGTAGAAGTTTTAACTATGGATTGCAACCTGAACTCAAAGACAAGTACTG
GAACCTATTCATGCTTGAAACTTCTATTTACATTGAAAAGACAGTTGAGT
TCATATTTAGTGAGTACTTATATTCCGGCAATACTGATTGTCATGGTATC
ATGGCTCAGCTTTTGGATTAGTGTTGAGGCCGTTCCAGCAAGGGTTACTC
TAGGATTGTTAACACTTTTAGGTATCCTAACACAAAATAAAGGTGTCAGT
GGAAACCTTCCAAGAGTCAGCTATATCAAGGCGATTGACATTTATATTAT
AGCATGCATATTATTCATTATTGGGGCGTTTACGGAGTTCGCCATTGCAA
GTAACTACAGTAGACGTCGTAGAAATTTTCTTTGGGATAAAAATGCGAGT
AAAACAGACTACGACAGAATTGACCCTAACAGGTTAAAATGCAACCATAA
TAGCAAATATGAGAATGAAAAATTAAATGATGAAATATTCATGGGATCGG
AGAAATTAGTATTGAAAAAGCGGAAAAAGAAATTTTGTTGTACTATCCCA
TATGTGAAAACCAATTCAGGAAAAACTTGTACCGTAGTAAGTCTTGATTC
AACGCCAAGAAAAACAAGAATCAATGAGTTGAGAAAGCAAGTAAAGGTAA
TTCAAAATCAACATGTAACTGAAGAAGAAGAGCTGAAGAGGTTATTGCTT
AACAGTCATTATAATGTAAATACGGTATACTCAAACGACAGTAATACCGG
AAGTAAATATTATTCAATTCGGGACAAATTCAAGAATAATTTTAATAAAA
CTGAAAATATCTTCAGAATGAATTCCTTAAATGATAAACTAAACGAAGAT
AAAACGGTGGATTACAATTCATGTGGTGATAATATAGTTATGGATTCAGA
TTTGGACTCCTACAGTAGATTTCTATTTCCTGCTTTCTTTTTGTTGTATA
ATTGTTTTTATTGGTTATATTATTTGGTTATCACGTAGAGTAAACTTTCA
CAATGAAATAATTCATTTTTTATTCTTACCGATTTCCTTTCTATTTAATA
TTTTAATATATAGATGTGC
back to top

protein sequence of SMED30030843-orf-1

>SMED30030843-orf-1 ID=SMED30030843-orf-1|Name=SMED30030843-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=549bp
MHCKLTVFSLLFFERILFSESINDKFLSLESIKNPSIRDKIIVQIFENYK
KHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLA
WTDQEAFRNFTRPISIPSMFNKLWLPDLFFRNGKEGFMYKMTMPNFLIRL
KSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQW
KTNESVTQSKDIQISEFYTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKR
QLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVTLGLLTLLGILTQNK
GVSGNLPRVSYIKAIDIYIIACILFIIGAFTEFAIASNYSRRRRNFLWDK
NASKTDYDRIDPNRLKCNHNSKYENEKLNDEIFMGSEKLVLKKRKKKFCC
TIPYVKTNSGKTCTVVSLDSTPRKTRINELRKQVKVIQNQHVTEEEELKR
LLLNSHYNVNTVYSNDSNTGSKYYSIRDKFKNNFNKTENIFRMNSLNDKL
NEDKTVDYNSCGDNIVMDSDLDSYSRFLFPAFFLLYNCFYWLYYLVIT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006201Neur_channel
IPR006028GABAA/Glycine_rcpt
IPR006029Neurotrans-gated_channel_TM
IPR006202Neur_chan_lig-bd
IPR018000Neurotransmitter_ion_chnl_CS
IPR007110Ig-like_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 427..454
NoneNo IPR availablePANTHERPTHR18945:SF835GAMMA-AMINOBUTYRIC ACID RECEPTOR ALPHA-LIKEcoord: 43..464
NoneNo IPR availableCDDcd19058LGIC_TM_GABAAR_picoord: 519..547
e-value: 8.56088E-5
score: 40.2207
NoneNo IPR availableCDDcd19049LGIC_TM_anioncoord: 255..343
e-value: 2.90534E-30
score: 112.16
NoneNo IPR availableCDDcd18987LGIC_ECD_anioncoord: 63..251
e-value: 7.1114E-69
score: 217.932
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.543
NoneNo IPR availableTMHMMTMhelixcoord: 525..547
NoneNo IPR availableTMHMMTMhelixcoord: 314..336
NoneNo IPR availableTMHMMTMhelixcoord: 252..274
NoneNo IPR availableTMHMMTMhelixcoord: 281..299
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 122..133
score: 46.49
coord: 246..258
score: 28.37
coord: 85..101
score: 38.12
coord: 168..182
score: 48.99
IPR006201Neurotransmitter-gated ion-channelTIGRFAMTIGR00860TIGR00860coord: 37..544
e-value: 2.9E-100
score: 334.1
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 43..464
IPR006028Gamma-aminobutyric acid A receptor/Glycine receptor alphaPRINTSPR00253GABAARECEPTRcoord: 255..275
score: 51.62
coord: 281..302
score: 42.28
coord: 315..336
score: 34.59
coord: 524..544
score: 47.45
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 40..251
e-value: 7.6E-47
score: 159.5
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 259..541
e-value: 4.3E-26
score: 92.4
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 27..249
e-value: 9.4E-65
score: 219.7
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 39..251
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 168..182
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 144..241
score: 6.705
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 255..546