SMED30030841

Overview
NameSMED30030841
Smed IDSMED30030841
Length (bp)2501
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030841

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30030841SMESG000051968.1 Contig27302newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30030841SMESG000051968.1 Contig27302uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testis primordiumSMED30030841SMESG000051968.1 PL030016A10H04_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30030841 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000160:29051..31551 +12505
Homology
BLAST of SMED30030841 vs. TrEMBL
Match: A0A074ZSL9 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_03377 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 5.611e-28
Identity = 110/417 (26.38%), Postives = 208/417 (49.88%), Query Frame = 1
Query:   61 NLPIPPILSLRQDKGHSFKVPEFFGYESPATRWILAMLTNKVNLKRLIKCGKSHSELFSRYYQVPDRPMDLMPGDYSLETPAYHQQTVLYLTPLALAVYMKELYAVEMLLALKDEAGHKIIHPAE-------PCFVQKVFKKGARRVSNELSNTFPILLAIRRNFFDGIHMLLECGFTPQKQLSIICRM-PFKETINLYKDILDYMVELLRHKPCLNVTKIMKILT------DPSIGLTMFDIFVYDLE--LDDN----NKWDYVSIFRRVCRTGLGTKYFIEESAXXXXXXXXXXXXXGYFRGVTYLKVFYTTNPLTSGEKTLSQKTIEELQSERVSVIMDKIPTIIKASREDLFQLDPSELSTRINYDYQVCIGSLFLWYQRCQYNDRC--GHYMKLSRLMSKIILDTRIIEDFF 1245
            +L  PP+ + R        +P+++  +   TRW++  +  +  L  L+        L S Y+++ D+P   +        PAY  +TVLYLTPLA+A+Y++    + +LL   D +G +I   A         C+V++   +    + +E S T+P ++A+RR FF+GI++L+  GF PQ  + II R+   +ET + + D+LD+ V+LL  +P +++  +++ ++        ++ L+ +D  VYD+   L D+    N+  + S+F R+ + G    Y       +LI +LE I   G+FR     + +    P++    T ++K       +R++      P +I  +R    + + + L    + D  +C+  L LW +R +  +RC      +L RL++  + DT ++EDF 
Sbjct:   25 DLSEPPVDNTRD------SLPKYYPRDHEVTRWLVNQMRCRNGLHHLVNLANIQPSLLSAYFELFDQPHLYIDAKTGPGMPAYGIKTVLYLTPLAIAIYLRLKSVLRLLL---DTSGTRIHARARQEVDINATCYVRRTKPRPGPFIMDEYSTTYPAVIAVRREFFNGINLLMSFGFNPQAPIGIIDRLGTTRETTHWFVDLLDFCVKLLNTRPGVDIIGLLQTISYRTMTEGGNLSLSYYDPCVYDVRAVLQDSGRTTNEEVWCSVFHRLAKKGASRSY--SNCGNRLIGLLEHISVAGFFR-----QKYMPKGPVSYDAGTNTRK------GKRLAPARKLSPDMI--NRLTGQEKELARLCIAADRDSALCL--LTLWLERVR--NRCLDRQAQRLFRLLTSGLADTGLLEDFL 413          
BLAST of SMED30030841 vs. TrEMBL
Match: A0A4S2MHZ7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000776 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 3.357e-25
Identity = 112/425 (26.35%), Postives = 206/425 (48.47%), Query Frame = 1
Query:   37 SEELRYALNLPIPPILSLRQDKGHSFKVPEFFGYESPATRWILAMLTNKVNLKRLIKCGKSHSELFSRYYQVPDRPMDLMPGDYSLETPAYHQQTVLYLTPLALAVYMKELYAVEMLLALKDEAGHKIIHPAE-------PCFVQKVFKKGARRVSNELSNTFPILLAIRRNFFDGIHMLLECGFTPQKQLSIICRM-PFKETINLYKDILDYMVELLRHKPCLNVTKIMKILT------DPSIGLTMFDIFVYDLE--LDDN----NKWDYVSIFRRVCRTGLGTKYFIEESAXXXXXXXXXXXXXGYFRGVTYLKVFYTTNPLTSGEKTLSQKTIEELQSERVSVIMDKIPTIIKASREDLFQLDPSELSTRINYDYQVCIGSLFLWYQRCQYNDRC--GHYMKLSRLMSKIILDTRIIEDFF 1245
            +E  R   +L  PP+ + R        +P+++  +   TRW++  +  +  L  L+        L S Y+++ D+P   +        PAY  +TVLYLTPLA+A+Y++      +L  L D +G +I   A         C+V++   +    + +E S T+P ++A+RR FF GI++L+  GF PQ  + II R+   +ET + + D+LD+ V+LL  +P +++  +++ ++        ++ L  +D  VYD+   L D+    N+  + S+F R+ + G    Y       +LI +LE I   G+FR     + +    P++    T ++K      + ++S   D I  +    +E       + L    + D  +C+  L LW +R +  +RC      +L RL++  + DT ++EDF 
Sbjct:   17 TEFQRLPSDLSEPPVDNTRD------SLPKYYPRDHEVTRWLVNQMRCRNGLHHLVNLANIQPSLLSAYFELFDQPHLYIDAKTGPGMPAYGIKTVLYLTPLAIAIYLR---LRSVLRLLLDTSGTRIHARARQEVDINATCYVRRTKPRPGPFIMDEYSTTYPAVIAVRREFFTGINILMSFGFHPQAPIGIIDRLGTTRETTHWFVDLLDFCVKLLNTRPGVDIIGLLQTISYRTMTEGGNLSLCYYDPCVYDVRAVLQDSGRTTNEEVWCSVFHRLAKKGASRSY--SNCGNRLIGLLEHISVAGFFR-----QKYMPKGPVSYDAGTNTRKGKRLAPARKLSP--DTINRLTGPEKE------LARLCIAADRDSALCL--LTLWLERVR--NRCLDRQAQRLFRLLTSGLADTGLLEDFL 413          
BLAST of SMED30030841 vs. TrEMBL
Match: A0A183ACH9 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS4664 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 8.241e-25
Identity = 105/398 (26.38%), Postives = 186/398 (46.73%), Query Frame = 1
Query:  118 VPEFFGYESPATRWILAMLTNKVNLKRLIKCGKSHSELFSRYYQVPDRPMDLMPGDYSLETPAYHQQTVLYLTPLALAVYMKELYAVEMLLALKDEAGHKI-------IHPAEPCFVQKVFKKGARRVSNELSNTFPILLAIRRNFFDGIHMLLECGFTPQKQLSIICRM-PFKETINLYKDILDYMVELLRHKPCLNVTKIMKI-----LTDPSIGLTMFDIFVYDLE-------LDDNNKWDYVSIFRRVCRTGLGTKYFIEESAXXXXXXXXXXXXXGYFRGVTYLKVFYTTNPLTSGEKTLSQKTIEELQSERVSVIMDKIPTIIKASREDLFQLDPSELSTRINYDYQVCIGSLFLWYQRCQYNDRC--GHYMKLSRLMSKIILDTRIIEDFF 1245
            +P+++  +   TRW++  +  +  L  L+        L S Y+++ D+P   +        PAY  +TVLYLTPLA+A+Y        +L  L D +G +I       I     C+V++V  +    V +E S T P ++A+RR FF G+ +L+   F PQ  + II R+   +ET + + D+LD+ V+LL  +P ++V  +++      L+D +     +D  VYD+          D N+  + S+F R+ R G    Y       +LI +LE +   G+FR     + +    P+      L++K    + + +++   D+I  +    +E             I  D   C+  L LW +R +  +RC      +L RL++  + DT ++ DF 
Sbjct:   39 LPKYYPRDHEVTRWLVNQMRCRNGLHHLVNLANVQPSLLSAYFELYDQPHLYIDARTGPGMPAYGIKTVLYLTPLAIAIY---FRLRSVLRLLLDTSGTRIHARARQEIDVNATCYVRRVKPRPGPFVMDEYSTTHPAIIAVRREFFAGLTILMSANFHPQAPIGIIERLGTTRETTHWFVDLLDFCVKLLNTRPGVDVIGLLQTISYRSLSDSNSTACYYDPCVYDVRPAVPEPGRPDTNEEVWCSVFHRLARKGASRSY--SNCGNRLIGLLEHVAAAGFFR-----QKYMPKGPVQYDVDLLNRKGNRMVGARKMTP--DQINKLTGPEKE--------TARISIAADRDACLCLLTLWLERVR--NRCLDRQAQRLFRLLTTGLADTGLLSDFL 414          
BLAST of SMED30030841 vs. TrEMBL
Match: A0A419PG67 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_623s PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.270e-24
Identity = 110/425 (25.88%), Postives = 208/425 (48.94%), Query Frame = 1
Query:   37 SEELRYALNLPIPPILSLRQDKGHSFKVPEFFGYESPATRWILAMLTNKVNLKRLIKCGKSHSELFSRYYQVPDRPMDLMPGDYSLETPAYHQQTVLYLTPLALAVYMKELYAVEMLLALKDEAGHKIIHPAE-------PCFVQKVFKKGARRVSNELSNTFPILLAIRRNFFDGIHMLLECGFTPQKQLSIICRM-PFKETINLYKDILDYMVELLRHKPCLNVTKIMKILT------DPSIGLTMFDIFVYDLE--LDDN----NKWDYVSIFRRVCRTGLGTKYFIEESAXXXXXXXXXXXXXGYFRGVTYLKVFYTTNPLTSGEKTLSQKTIEELQSERVSVIMDKIPTIIKASREDLFQLDPSELSTRINYDYQVCIGSLFLWYQRCQYNDRC--GHYMKLSRLMSKIILDTRIIEDFF 1245
            +E  R   ++  PP+ + R        +P+++  +   TRW++  +  +  L  L+        L S Y+++ D+P   +        PAY  +TVLYLTPLA+A+Y++      +L  L D +G +I   A         C+V++   +    + +E S T+P ++A+RR FF GI++L+  GF PQ  + II R+   +ET + + D+LD+ V+LL  +P +++  +++ ++        ++ L  +D  VYD+   + D+    N+  + S+F R+ + G    Y       +LI +LE I   G+FR     + +    P++    T ++K       +R++      P +I  +R    + + + L    + D  +C+  L LW +R +  +RC      +L RL++  + DT ++EDF 
Sbjct:   17 TEFQRLPSDISEPPVDNTRD------SLPKYYPRDHEVTRWLVNQMRCRNGLHHLVNLANVQPSLLSAYFELFDQPHLYIDAKTGPGMPAYGIKTVLYLTPLAIAIYLR---LRSVLRLLLDTSGTRIHARARQEVDINATCYVRRTKPRPGPFIMDEYSTTYPAVIAMRREFFTGINLLMSFGFNPQAPIGIIDRLGTTRETTHWFVDLLDFCVKLLNTRPGVDIIGLLQTISYRTMTEGGNLSLCYYDPCVYDVRAVVQDSGRTTNEEVWCSVFHRLAKKGASRSY--SNCGNRLIGLLEHISVAGFFR-----QKYMPKGPVSYDAGTNTRK------GKRLAPARKLSPDMI--NRLTGPEKELARLCIAADRDSALCL--LTLWLERVR--NRCLDRQAQRLFRLLTSGLADTGLLEDFL 413          
BLAST of SMED30030841 vs. TrEMBL
Match: A0A504YKX7 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_09658 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.576e-24
Identity = 109/408 (26.72%), Postives = 190/408 (46.57%), Query Frame = 1
Query:   97 DKGHSFKVPEFFGYESPATRWILAMLTNKVNLKRLIKCGKSHSELFSRYYQVPDRPMDLMPGDYSLETPAYHQQTVLYLTPLALAVYMKELYAVEMLLALKDEAGHKI-------IHPAEPCFVQKVFKKGARRVSNELSNTFPILLAIRRNFFDGIHMLLECGFTPQKQLSIICRM-PFKETINLYKDILDYMVELLRHKPCLNVTKIM-----KILTDPSIGLTMFDIFVYDLE-------LDDNNKWDYVSIFRRVCRTGLGTKYFIEESAXXXXXXXXXXXXXGYFRGVTYLKVFYTTNPLTSGEKTLSQKTIEELQSERVSVIMDKIPTIIKASREDLFQLDPSELSTR---INYDYQVCIGSLFLWYQRCQYNDRC--GHYMKLSRLMSKIILDTRIIEDFF 1245
            D  +   +P+++  +   TRW++  +  +  L  L+        L S Y+++ D+P   +        PAY  +TVLYLTPLA+A+Y        +L  L D +G +I       I     C+V++V  +    V +E S T P ++A+RR FF G+ +L+   F PQ  + II R+   +ET + + D+LD+ V+LL  +P ++V  ++     + LTD +     +D  VYD+          D+++  + S+F R+ R G    Y       +LI +LE +   G+FR     + +    P+             +  +E VS   +++    K + E + +L   E  T    I  D   C+  L LW +R +  +RC      +L RL++  + DT ++ DF 
Sbjct:   32 DVNNRDSLPKYYPRDHEVTRWLVNQMRCRNGLHHLVNLANVQPSLLSAYFELYDQPHLYIDARTGPGMPAYGIKTVLYLTPLAIAIY---FRLRSVLRLLLDTSGTRIHARARQEIDVNATCYVRRVKPRPGPFVMDEYSTTHPAIIAVRREFFVGLTILMSANFHPQAPIGIIERLGTARETTHWFVDLLDFCVKLLNTRPGVDVIGLLQTISYRTLTDNNTSSCYYDPCVYDVRPIAPEPGKPDSDEEIWCSVFHRLARKGASRSY--SNCGNRLIGLLEHVAAAGFFR-----QKYMPKGPV-------------QYDAELVSRKGNRMVGARKMTPEQITKLTGPEKDTARVCIAADRDACLCLLTLWLERVR--NRCLDRQAQRLFRLLTTGLADTGLLHDFL 414          
BLAST of SMED30030841 vs. Planmine SMEST
Match: SMESG000051968.1 (SMESG000051968.1)

HSP 1 Score: 1567.36 bits (4057), Expect = 0.000e+0
Identity = 801/801 (100.00%), Postives = 801/801 (100.00%), Query Frame = 1
Query:   25 MKFLSEELRYALNLPIPPILSLRQDKGHSFKVPEFFGYESPATRWILAMLTNKVNLKRLIKCGKSHSELFSRYYQVPDRPMDLMPGDYSLETPAYHQQTVLYLTPLALAVYMKELYAVEMLLALKDEAGHKIIHPAEPCFVQKVFKKGARRVSNELSNTFPILLAIRRNFFDGIHMLLECGFTPQKQLSIICRMPFKETINLYKDILDYMVELLRHKPCLNVTKIMKILTDPSIGLTMFDIFVYDLELDDNNKWDYVSIFRRVCRTGLGTKYFIEESAXXXXXXXXXXXXXGYFRGVTYLKVFYTTNPLTSGEKTLSQKTIEELQSERVSVIMDKIPTIIKASREDLFQLDPSELSTRINYDYQVCIGSLFLWYQRCQYNDRCGHYMKLSRLMSKIILDTRIIEDFFVKSDESLALVFSEWCLTIIKPITVSDFRIRMQDYILYTDFLCITFINRYDKIPNVLLNAPILHGRDPAYSPIVRELLQLNRSSLTDVLSTVXXXXXXXXVGINPMVFTVVDKENHCSLKFIPANHARHFSLDNYNDPYLLLANRNTNSCKDSEGHSNNIRSFPKSMKRPQSVTRKSIPIKPKRFXXXXXXXXXXXXXXXHDERNFLLTPPGNCQHVSGIKSPNADLYNSIVALATKPKRKSSRSTILSSKKPPYHRITRTRSSCELLQKPIKPAEILQKFPKYSNQNNFQTDISDDELKTRLKNLLASNAKYRDVDFDMQKNKVPLKSLRSEICKFKSVENIIRKMQAKISIQLDCLSNNIIASSMIRIMEELSMVNKSKSSNPDFFRVFKKKT 2427
            MKFLSEELRYALNLPIPPILSLRQDKGHSFKVPEFFGYESPATRWILAMLTNKVNLKRLIKCGKSHSELFSRYYQVPDRPMDLMPGDYSLETPAYHQQTVLYLTPLALAVYMKELYAVEMLLALKDEAGHKIIHPAEPCFVQKVFKKGARRVSNELSNTFPILLAIRRNFFDGIHMLLECGFTPQKQLSIICRMPFKETINLYKDILDYMVELLRHKPCLNVTKIMKILTDPSIGLTMFDIFVYDLELDDNNKWDYVSIFRRVCRTGLGTKYFIEESAIQLINILEQIQNIGYFRGVTYLKVFYTTNPLTSGEKTLSQKTIEELQSERVSVIMDKIPTIIKASREDLFQLDPSELSTRINYDYQVCIGSLFLWYQRCQYNDRCGHYMKLSRLMSKIILDTRIIEDFFVKSDESLALVFSEWCLTIIKPITVSDFRIRMQDYILYTDFLCITFINRYDKIPNVLLNAPILHGRDPAYSPIVRELLQLNRSSLTDVLSTVNNNNNQNNVGINPMVFTVVDKENHCSLKFIPANHARHFSLDNYNDPYLLLANRNTNSCKDSEGHSNNIRSFPKSMKRPQSVTRKSIPIKPKRFSNNSNSLENLQSISQHDERNFLLTPPGNCQHVSGIKSPNADLYNSIVALATKPKRKSSRSTILSSKKPPYHRITRTRSSCELLQKPIKPAEILQKFPKYSNQNNFQTDISDDELKTRLKNLLASNAKYRDVDFDMQKNKVPLKSLRSEICKFKSVENIIRKMQAKISIQLDCLSNNIIASSMIRIMEELSMVNKSKSSNPDFFRVFKKKT
Sbjct:    1 MKFLSEELRYALNLPIPPILSLRQDKGHSFKVPEFFGYESPATRWILAMLTNKVNLKRLIKCGKSHSELFSRYYQVPDRPMDLMPGDYSLETPAYHQQTVLYLTPLALAVYMKELYAVEMLLALKDEAGHKIIHPAEPCFVQKVFKKGARRVSNELSNTFPILLAIRRNFFDGIHMLLECGFTPQKQLSIICRMPFKETINLYKDILDYMVELLRHKPCLNVTKIMKILTDPSIGLTMFDIFVYDLELDDNNKWDYVSIFRRVCRTGLGTKYFIEESAIQLINILEQIQNIGYFRGVTYLKVFYTTNPLTSGEKTLSQKTIEELQSERVSVIMDKIPTIIKASREDLFQLDPSELSTRINYDYQVCIGSLFLWYQRCQYNDRCGHYMKLSRLMSKIILDTRIIEDFFVKSDESLALVFSEWCLTIIKPITVSDFRIRMQDYILYTDFLCITFINRYDKIPNVLLNAPILHGRDPAYSPIVRELLQLNRSSLTDVLSTVNNNNNQNNVGINPMVFTVVDKENHCSLKFIPANHARHFSLDNYNDPYLLLANRNTNSCKDSEGHSNNIRSFPKSMKRPQSVTRKSIPIKPKRFSNNSNSLENLQSISQHDERNFLLTPPGNCQHVSGIKSPNADLYNSIVALATKPKRKSSRSTILSSKKPPYHRITRTRSSCELLQKPIKPAEILQKFPKYSNQNNFQTDISDDELKTRLKNLLASNAKYRDVDFDMQKNKVPLKSLRSEICKFKSVENIIRKMQAKISIQLDCLSNNIIASSMIRIMEELSMVNKSKSSNPDFFRVFKKKT 801          
BLAST of SMED30030841 vs. Planmine SMEST
Match: SMESG000013691.1 (SMESG000013691.1)

HSP 1 Score: 235.343 bits (599), Expect = 9.635e-67
Identity = 143/460 (31.09%), Postives = 247/460 (53.70%), Query Frame = 1
Query:   64 LPIPPILSLRQDKGHSFKVPEFFGYESPATRWILAMLTNKVNLKRLIKCGKSHSELFSRYYQVPDRPMDLMPGDYSLETPAYHQQTVLYLTPLALAVYMKELYAVEMLLALKDEAGHKIIHPAEPCFVQKVFKKGARRVSNELSNTFPILLAIRRNFFDGIHMLLECGFTPQKQLSIICRMPFKETINLYKDILDYMVELLRHKPCLNVTKIMKILTDPSI-GLTMFDIFVYDLELDDNNKWDYVSIFRRVCRTGLGTKYFIEESAXXXXXXXXXXXXXGYFRGVTYLKVFYTTNPLTSGEKTLSQKTIEELQSERVSVIMDKIPTIIKASREDLFQLDPSELSTRINYDYQVCIGSLFLWYQRCQYNDRCGHYMKLSRLMSKIILDTRIIEDFFVKSDESLALVFSEWC--------LTIIKPITVSDFRIRMQDYILYTDFLCITFINRYDKIPNVLL 1416
             P PP       K  +F+VP+++G++ P T+WIL  + +   L RL+K   ++S +  RY+QVPD P  ++   ++ E  A+ +Q +LYLTP A+++YMK   A+  L+ LKD  G+ I++P + CFVQ  ++KG  R   +L +T+P ++AIRRN+F G   LL  G+ P     I  R P +E +  Y+D++DY+++ L+ +P  NV+K+M +L  P+I G    +IF +D+  D +     +S+F R+ R  L      EES + ++NILE+IQ  G+F GV +           S     S   + EL       I DK   + K   +DL +L+  +L++ ++ DY  CI +L +W Q      +    + L +L+ KI+ D ++IE FF ++  +++++             L I     ++++ I++      +D +   F++RY   P  +L
Sbjct:    8 FPNPPKFKSGSSK-ENFEVPKYYGFDHPCTKWILGSIVSNQALFRLMKVAANYSCILKRYHQVPDIPSLIVKDPFNTERAAFDKQAILYLTPFAISIYMKYEDALNQLVGLKDSDGNSIVNPNDLCFVQNFWRKGETRYFTDLISTYPAIIAIRRNYFSGFRFLLMAGYCPNDSFYITYRKPHREIVVFYRDLIDYVIDYLKRRPAFNVSKLMNVLLQPTIEGTNCLEIFCFDIYTDSDPS--LISLFHRITRNVLEEDNLSEESGMHVLNILEKIQEGGFFLGVRF-----------SNAAQNSTSDVNEL-------IKDK--GLNKVKMKDLQKLNEDKLNSLLSTDYNYCISNLIIWLQNKSLKRKTEQTVHLFKLLVKIMFDMKLIEIFFKENSSTISILHERLSELPHLNGNLEIKTTTIIANYIIQIYQ---QSDVMIAAFLSRYKLEPTDIL 441          
BLAST of SMED30030841 vs. Planmine SMEST
Match: SMESG000028505.1 (SMESG000028505.1)

HSP 1 Score: 110.538 bits (275), Expect = 1.897e-25
Identity = 77/259 (29.73%), Postives = 133/259 (51.35%), Query Frame = 1
Query:   64 LPIPPILSLRQDKGHSFKVPEFFGYESPATRWILAML--TNKVNLKRLIKCGKSHSELFSRYYQVPDRPMDLMPGDYSLETPAYHQQTVLYLTPLALAVYMKELYAVEMLLALKDEAGHKIIHPAEPCFVQKVFKKGARRVSNELSNTFPILLAIRRNFFDGIHMLLECGFTPQKQLSIICRMPFKETINLYKDILDYMVELLRHKPCLNVTKIMKILTDP---SIGLTMFDIFVYDLELDDNNKW--DYVSIFRRVCR 819
            LP PPI ++   KG  + VP ++ +    T+WI+ M+   N   + R+I C + +  L + Y Q PD P  L      L  P YH++ +LYLTPLA+A+Y+++   V  ++   +  G  I+   + CFV    ++   R  N++   +P  +  RR  F+ +  +L  G+ PQ+ + +  R  F+     YKDI++Y +  +  +P L ++K+++        S  L  F+  +Y    D+NNK   D VSI RR+ +
Sbjct:   22 LPDPPIFNV---KGFKYTVPPYYSFNHSETQWIINMVKGNNWERIFRVISCNQDY--LNNTYCQYPDSPEPL------LGQPMYHRKAILYLTPLAMAIYLRKHKLVSKMIEYVNNCGEGIVDVNQQCFVTNYLERFENR--NDIMVIYPFCIVFRRECFECVKPMLTHGWKPQEGIELPYRRIFQIFYFNYKDIIEYCLAQMVTRPNLRLSKLVENFLQSFHDSFTLLKFEKVLYK---DENNKEVVDMVSIPRRLLK 264          
BLAST of SMED30030841 vs. Planmine SMEST
Match: SMESG000064316.1 (SMESG000064316.1)

HSP 1 Score: 107.071 bits (266), Expect = 7.882e-24
Identity = 75/262 (28.63%), Postives = 131/262 (50.00%), Query Frame = 1
Query:   46 LRYALNLPIPPILSLRQDKGHSFKVPEFFGYESPATRWILAMLTNKVNLKRLIKCGKSHSELF-SRYYQVPDRPMDLMPGDYSLETPAYHQQTVLYLTPLALAVYMKELYAVEMLLALKDEAGHKIIHPAEPCFVQKVFKKGARRVSNELSNTFPILLAIRRNFFDGIHMLLECGFTPQKQLSIICRMPFKETINLYKDILDYMVELLRHKPCLNVTKIMKILT---DPSIGLTMFDIFVYDLELDDNNKWDYVSIFRRVCR 819
            ++ + N+P PP      D G  F VP+++ +E   T+WI+ M   K NL R+ +    +   F   Y+Q+PD P  L         P  H++ V+YLTPLALAVY+     V+ L++ +D+ G +++   +PC++  VF      +++ +    P ++ +R++F     +LL+  ++P K  S + R PFK     YKDI++Y++  L  +  L + K +  +         L  F+  +         +W  VSI RR+ R
Sbjct:   25 MKISGNIPKPPSFKNGFD-GKVFTVPQYYPFEHSETQWIINMFRTK-NLDRIQRIAFVNPNYFRCSYFQIPDSPGPLY------GQPMLHERVVMYLTPLALAVYLNLDALVDDLISFRDQNGKRLLSIYQPCYLTNVFINSYDNINDLMQIYIPCIIVLRQSFECVRPVLLKGKWSPLKSFSFLYRRPFKICKFSYKDIIEYVLSQLVLRTGLKLPKFIDFMITSLSDQFSLLYFEQIISQYYNHQIEEW--VSIPRRLLR 276          
BLAST of SMED30030841 vs. Planmine SMEST
Match: SMESG000054822.1 (SMESG000054822.1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.791e-19
Identity = 74/269 (27.51%), Postives = 133/269 (49.44%), Query Frame = 1
Query:   64 LPIPPILSLRQDKGHSFKVPEFFGYESPATRWILAMLTNKVNLKRLIKCGKSHSELFSRYYQVPDRPMDLMPGDYSLETPAYHQQTVLYLTPLALAVYMKELYAVEMLLALKDEAGHKIIHPAEPCFVQKVFKKGARRVSNELSNTFPILLAIRRNFFDGIHMLLECGFTPQKQLSIICRMPFKETINL------------YKDILDYMVELLRHKPCLNVTKIMK--ILTDPSIGLTMFDIFVYDLELDDNNKWDYVSIFRRVCRTGL 828
            LP PP        G +  +P FF    P T+W+L ML    +  R+    K   ELF + YQ+PD P DL+  +    T  +++ TVL+L PL LAVYMK+  + E++L    ++G  + +  + C+  +VF + ++    +L   +PI +AIRR  F+ I +L+ C       LS   +    E I +            Y+D L Y ++ L+ +  L ++++++  I+  P+    +F+ +    +LD++   +  S+F R+ +   
Sbjct:    8 LPAPPRFI-----GSNITIPPFFHCGHPYTKWMLNMLRGGASF-RISTMIKERPELFQQIYQIPDCP-DLVRNENRDMTSMFNRHTVLFLNPLCLAVYMKKEKSAELIL----KSG--LNNANQKCWASEVFSR-SQSSRGDLLEIYPICIAIRREHFEVIPILIHCEVKNFGLLSKYSKFDVTEKIEIHYENGEGRKVFRYRDSLQYAIDTLKRRGNLPLSRLLELFIIDCPN----LFNPY----KLDEDKNGNAYSLFNRIAKVAF 254          
The following BLAST results are available for this feature:
BLAST of SMED30030841 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030841 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030841 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030841 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030841 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030841 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030841 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030841 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074ZSL95.611e-2826.38Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2MHZ73.357e-2526.35Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A183ACH98.241e-2526.38Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A419PG671.270e-2425.88Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A504YKX71.576e-2426.72Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
back to top
BLAST of SMED30030841 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030841 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030841 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030841 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030841 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030841 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051968.10.000e+0100.00SMESG000051968.1[more]
SMESG000013691.19.635e-6731.09SMESG000013691.1[more]
SMESG000028505.11.897e-2529.73SMESG000028505.1[more]
SMESG000064316.17.882e-2428.63SMESG000064316.1[more]
SMESG000054822.11.791e-1927.51SMESG000054822.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030841 ID=SMED30030841|Name=SMED30030841|organism=Schmidtea mediterranea sexual|type=transcript|length=2501bp
TAAATCAATCGGTTAATTAATATCATGAAGTTTTTATCAGAGGAATTGAG
ATATGCCTTGAATCTACCGATCCCACCAATATTAAGTCTTCGTCAAGACA
AAGGTCATTCTTTCAAGGTACCTGAATTTTTCGGGTATGAAAGTCCTGCA
ACAAGATGGATTTTAGCGATGCTCACTAATAAGGTCAACTTGAAAAGATT
GATTAAATGCGGAAAGTCCCATAGTGAACTGTTTTCAAGGTATTATCAAG
TACCCGATAGGCCGATGGATCTTATGCCTGGTGATTATTCTTTGGAAACT
CCAGCATATCATCAACAAACAGTTTTATATCTTACTCCATTGGCTTTGGC
AGTTTATATGAAAGAATTATATGCAGTAGAAATGTTGCTAGCTTTGAAAG
ATGAGGCTGGACATAAAATAATTCATCCTGCGGAGCCTTGTTTCGTACAA
AAAGTATTTAAAAAAGGTGCACGTCGGGTTTCTAATGAATTATCCAATAC
TTTCCCTATTTTGTTAGCTATTCGGAGAAACTTTTTTGATGGAATTCACA
TGCTGTTAGAATGCGGATTTACACCTCAGAAGCAACTCTCTATAATTTGT
AGGATGCCATTTAAAGAGACCATCAACTTATATAAAGATATATTAGATTA
TATGGTGGAATTATTGCGCCATAAACCTTGTTTAAATGTTACAAAAATAA
TGAAAATTTTAACCGATCCATCAATCGGTTTGACAATGTTCGACATATTT
GTATATGACCTCGAATTGGATGACAACAACAAATGGGACTATGTCAGTAT
TTTCCGCCGAGTCTGTCGAACTGGGTTAGGAACAAAATATTTCATAGAAG
AAAGTGCAATACAACTCATAAACATTCTTGAACAAATCCAAAATATTGGA
TATTTTCGAGGTGTCACCTATTTGAAAGTATTTTATACAACAAATCCTCT
TACGAGCGGTGAAAAAACCTTATCACAGAAGACAATCGAAGAACTGCAGT
CAGAGCGCGTCAGTGTTATAATGGACAAAATTCCTACTATCATAAAAGCG
AGTAGAGAAGATTTATTTCAACTTGATCCAAGTGAATTATCCACAAGAAT
AAACTATGACTATCAGGTTTGCATAGGATCTCTATTTTTATGGTACCAAC
GATGCCAATACAATGATAGATGTGGTCATTATATGAAACTGAGCCGATTA
ATGTCGAAAATTATTTTAGATACTCGAATAATTGAAGACTTTTTCGTTAA
ATCAGACGAAAGTTTAGCTTTAGTTTTCTCTGAATGGTGCCTGACTATCA
TTAAGCCAATCACAGTTTCAGATTTTCGGATCCGAATGCAGGACTACATT
TTGTATACAGATTTCTTGTGCATAACATTCATCAATCGGTACGATAAAAT
TCCAAATGTTTTGTTAAATGCCCCGATATTACATGGAAGGGATCCAGCAT
ATTCACCAATTGTACGGGAACTCTTGCAACTTAATAGATCAAGCTTGACA
GATGTTCTTTCTACCGTCAACAATAATAATAACCAGAATAACGTTGGAAT
AAATCCCATGGTGTTTACGGTTGTCGATAAAGAAAATCATTGTTCCTTGA
AATTTATTCCAGCCAATCACGCGAGACACTTTTCATTGGATAATTATAAT
GATCCGTATTTGCTGTTAGCCAATAGGAATACAAACTCTTGTAAAGACTC
TGAAGGTCATTCAAATAATATTCGATCGTTTCCGAAGTCAATGAAACGAC
CACAATCTGTAACCAGGAAATCAATACCTATCAAACCGAAACGATTTTCA
AATAACTCTAATTCATTAGAAAATCTTCAATCGATATCACAGCACGATGA
AAGGAATTTTTTATTGACTCCGCCCGGTAACTGTCAACACGTGTCGGGAA
TAAAGTCTCCAAATGCAGATTTGTACAACTCAATTGTTGCGTTGGCCACG
AAACCGAAACGAAAATCATCCAGATCAACTATTCTATCAAGCAAAAAACC
ACCATATCACCGCATAACAAGAACGAGAAGTTCTTGTGAGTTGCTTCAAA
AACCGATAAAGCCAGCGGAAATCCTGCAGAAATTCCCAAAATATTCCAAT
CAAAACAACTTCCAAACCGACATAAGCGATGATGAATTGAAAACGAGATT
AAAAAACTTGCTCGCATCGAACGCTAAATACCGAGACGTCGACTTTGATA
TGCAAAAGAATAAAGTTCCACTGAAATCTTTGCGATCGGAAATATGCAAA
TTCAAATCTGTGGAAAACATCATCAGAAAAATGCAGGCGAAAATCTCTAT
TCAACTTGACTGTTTGTCAAACAACATAATTGCTTCTTCAATGATTCGAA
TAATGGAAGAACTGTCCATGGTCAATAAATCCAAATCTTCAAATCCCGAT
TTTTTTCGAGTATTCAAAAAAAAGACTTGAACAGTTTTTGAAAGTTTTCT
TAACTTTCTTTAGTATTAAAATTTTAATTTAAAATGACCAAATAATTGCT
G
back to top

protein sequence of SMED30030841-orf-1

>SMED30030841-orf-1 ID=SMED30030841-orf-1|Name=SMED30030841-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=802bp
MKFLSEELRYALNLPIPPILSLRQDKGHSFKVPEFFGYESPATRWILAML
TNKVNLKRLIKCGKSHSELFSRYYQVPDRPMDLMPGDYSLETPAYHQQTV
LYLTPLALAVYMKELYAVEMLLALKDEAGHKIIHPAEPCFVQKVFKKGAR
RVSNELSNTFPILLAIRRNFFDGIHMLLECGFTPQKQLSIICRMPFKETI
NLYKDILDYMVELLRHKPCLNVTKIMKILTDPSIGLTMFDIFVYDLELDD
NNKWDYVSIFRRVCRTGLGTKYFIEESAIQLINILEQIQNIGYFRGVTYL
KVFYTTNPLTSGEKTLSQKTIEELQSERVSVIMDKIPTIIKASREDLFQL
DPSELSTRINYDYQVCIGSLFLWYQRCQYNDRCGHYMKLSRLMSKIILDT
RIIEDFFVKSDESLALVFSEWCLTIIKPITVSDFRIRMQDYILYTDFLCI
TFINRYDKIPNVLLNAPILHGRDPAYSPIVRELLQLNRSSLTDVLSTVNN
NNNQNNVGINPMVFTVVDKENHCSLKFIPANHARHFSLDNYNDPYLLLAN
RNTNSCKDSEGHSNNIRSFPKSMKRPQSVTRKSIPIKPKRFSNNSNSLEN
LQSISQHDERNFLLTPPGNCQHVSGIKSPNADLYNSIVALATKPKRKSSR
STILSSKKPPYHRITRTRSSCELLQKPIKPAEILQKFPKYSNQNNFQTDI
SDDELKTRLKNLLASNAKYRDVDFDMQKNKVPLKSLRSEICKFKSVENII
RKMQAKISIQLDCLSNNIIASSMIRIMEELSMVNKSKSSNPDFFRVFKKK
T*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR011528NERD