cilia- and flagella-associated protein 299

Overview
Namecilia- and flagella-associated protein 299
Smed IDSMED30030837
Length (bp)862
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cilia- and flagella-associated protein 299 (SMED30030837) t-SNE clustered cells

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 299 (SMED30030837) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cilia- and flagella-associated protein 299 (SMED30030837) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 299 (SMED30030837) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030837

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30030837h1SMcG0015325 SmedASXL_002062SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30030837h1SMcG0015325 dd_Smed_v4_11277_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030837h1SMcG0015325 dd_Smed_v4_11277_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30030837h1SMcG0015325 dd_Smed_v6_11277_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030837h1SMcG0015325 dd_Smed_v4_11277_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Human
Match: CFAP299 (cilia and flagella associated protein 299 [Source:HGNC Symbol;Acc:HGNC:28554])

HSP 1 Score: 308.145 bits (788), Expect = 1.481e-105
Identity = 148/234 (63.25%), Postives = 181/234 (77.35%), Query Frame = 2
Query:   41 EESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            EE +  LDNI+T+FN YEDFLDSQIT +DL+YLEDE LARQLVELGYRG+GE +KRE+F+ARK   E +RLA +   K    TL S+G D+ D FL AL+ REE NRSGK++++IFIRD+N  GQEISGYIDYAHRLKTE+F  YF GK+++LPRP D+SFYNW+     SN +PNY V+A++  GLLF+ KRDRKILNVDP A  PGDNS R  I +  Y Q VI+DHI+RRK
Sbjct:    4 EEGLKALDNIVTQFNAYEDFLDSQITTVDLYYLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQK----TLTSAGKDLQDNFLTALAMREEDNRSGKLSSVIFIRDRNSHGQEISGYIDYAHRLKTEDFEVYFTGKKRLLPRPTDISFYNWDADIAVSNSSPNYQVIADNPEGLLFRYKRDRKILNVDPKA-QPGDNSTRITILTELYVQAVIFDHISRRK 232          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Human
Match: CFAP299 (cilia and flagella associated protein 299 [Source:HGNC Symbol;Acc:HGNC:28554])

HSP 1 Score: 298.13 bits (762), Expect = 2.038e-101
Identity = 148/251 (58.96%), Postives = 181/251 (72.11%), Query Frame = 2
Query:   41 EESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMT-----------------TIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            EE +  LDNI+T+FN YEDFLDSQIT +DL+YLEDE LARQLVELGYRG+GE +KRE+F+ARK   E +RLA +   K    TL S+G D+ D FL AL+ REE NRSGK++                 ++IFIRD+N  GQEISGYIDYAHRLKTE+F  YF GK+++LPRP D+SFYNW+     SN +PNY V+A++  GLLF+ KRDRKILNVDP A  PGDNS R  I +  Y Q VI+DHI+RRK
Sbjct:    4 EEGLKALDNIVTQFNAYEDFLDSQITTVDLYYLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQK----TLTSAGKDLQDNFLTALAMREEDNRSGKLSLNQQETDAAHILKKQLASVIFIRDRNSHGQEISGYIDYAHRLKTEDFEVYFTGKKRLLPRPTDISFYNWDADIAVSNSSPNYQVIADNPEGLLFRYKRDRKILNVDPKA-QPGDNSTRITILTELYVQAVIFDHISRRK 249          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Human
Match: CFAP299 (cilia and flagella associated protein 299 [Source:HGNC Symbol;Acc:HGNC:28554])

HSP 1 Score: 137.887 bits (346), Expect = 6.609e-40
Identity = 70/115 (60.87%), Postives = 87/115 (75.65%), Query Frame = 2
Query:   41 EESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTII 385
            EE +  LDNI+T+FN YEDFLDSQIT +DL+YLEDE LARQLVELGYRG+GE +KRE+F+ARK   E +RLA +   K    TL S+G D+ D FL AL+ REE NRSGK++  +
Sbjct:    4 EEGLKALDNIVTQFNAYEDFLDSQITTVDLYYLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQK----TLTSAGKDLQDNFLTALAMREEDNRSGKLSAGV 114          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Human
Match: CFAP299 (cilia and flagella associated protein 299 [Source:HGNC Symbol;Acc:HGNC:28554])

HSP 1 Score: 110.538 bits (275), Expect = 3.580e-30
Identity = 52/78 (66.67%), Postives = 63/78 (80.77%), Query Frame = 2
Query:   41 EESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTK 274
            EE +  LDNI+T+FN YEDFLDSQIT +DL+YLEDE LARQLVELGYRG+GE +KRE+F+ARK   E +RLA +   K
Sbjct:    4 EEGLKALDNIVTQFNAYEDFLDSQITTVDLYYLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQK 81          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Human
Match: CFAP299 (cilia and flagella associated protein 299 [Source:HGNC Symbol;Acc:HGNC:28554])

HSP 1 Score: 94.7449 bits (234), Expect = 2.690e-24
Identity = 45/75 (60.00%), Postives = 54/75 (72.00%), Query Frame = 2
Query:  518 SFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            SFYNW+     SN +PNY V+A++  GLLF+ KRDRKILNVDP A  PGDNS R  I +  Y Q VI+DHI+RRK
Sbjct:    1 SFYNWDADIAVSNSSPNYQVIADNPEGLLFRYKRDRKILNVDPKA-QPGDNSTRITILTELYVQAVIFDHISRRK 74          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Fly
Match: CG8138 (gene:FBgn0038122 transcript:FBtr0082732)

HSP 1 Score: 110.153 bits (274), Expect = 1.047e-28
Identity = 77/235 (32.77%), Postives = 116/235 (49.36%), Query Frame = 2
Query:   62 DNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFA-------PYFLGKRKIL-PRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            D  I +FN Y+++L S  T  D  YL   +    L +LGYR      + +EF   K+  E  +L   T +  I  +    G D   P L AL+ RE  N   +++TIIF+      G   SGYID+   L+   F             +RK+L P+P D+ FY+W+T+ + +N   NY+V+A    GL+F +K D K + V    +    N  R++I S  Y  I++YDH  R+K
Sbjct:    3 DFSIAKFNNYQEYLHSFTTVEDFRYLPFHKTVITLTKLGYREHRTFYEEDEFLNVKKQVE--QLLNPTVSAQIYYSQYFKGTD---PALWALAEREHGNVQQEISTIIFLEISGRSGFSKSGYIDFEASLRNYRFKGPNAVDWKAVFEERKLLKPQPSDIVFYDWKTRKIFANDNDNYTVVAHPEHGLMFAHKGDHKNIPVTTKKNPFSSNVRRSMIRSNLYGFIILYDHHVRKK 232          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Fly
Match: CG14013 (gene:FBgn0031720 transcript:FBtr0079121)

HSP 1 Score: 109.768 bits (273), Expect = 1.761e-28
Identity = 71/243 (29.22%), Postives = 121/243 (49.79%), Query Frame = 2
Query:   59 LDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGI--DIL-----DPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYID--------YAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            +D  + EF+ Y D++ S  T  D  YL ++   + +V+LGYR +      EE++ R ++A  +          I   LA  G+  D+L     DP L    +RE +N +  ++TI+F    +  G EISGYID        +   +K  ++   F G+ ++ P P  LS+ N     V    + NY V+ +   GL+F ++ D K+++V    +    N+ R+++ SPK+  +V YDH  R+K
Sbjct:    8 VDFSVLEFDNYNDYISSFATVTDHRYLGNQNTIKTIVQLGYRTTKIPYTAEEYEKRVDLALEA----------IRPKLAHVGLFSDLLSPTNRDPVLLEFKARELLNLNKILSTIVFTSYIHMDGSEISGYIDLDMSWRNCFREAIKHTDWRGVFQGRSRLKPMPHHLSYSNPRYNVVKYTDSDNYQVMHDHHFGLMFMHRGDHKMISVGGQFNIYSRNAKRSMVYSPKFGYVVFYDHFVRKK 240          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Fly
Match: CG14017 (gene:FBgn0031721 transcript:FBtr0079104)

HSP 1 Score: 103.99 bits (258), Expect = 2.994e-26
Identity = 56/150 (37.33%), Postives = 85/150 (56.67%), Query Frame = 2
Query:  317 DPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRL--------KTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            DP   AL  RE++N +  ++TI+F+  ++ KG  ISGYID  H L        K+  +A  F G+R++ P  QDLSF NW    V SN + NY V+ ++  GL F +K D  +L+++   +   ++     I+SPK+   V+YDH  RRK
Sbjct:   90 DPLTMALLEREKLNATKTISTIVFVSTRDSKGFNISGYIDLEHSLRRYKTAGSKSHPWADIFAGRRRLEPNHQDLSFINWSNGRVHSNDSDNYKVIPDAVKGLCFAHKGDGSMLSIEKYITE--EHPLCKFIESPKHGYTVVYDHYIRRK 237          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Fly
Match: CG3528 (gene:FBgn0031430 transcript:FBtr0077781)

HSP 1 Score: 101.293 bits (251), Expect = 2.521e-25
Identity = 68/237 (28.69%), Postives = 118/237 (49.79%), Query Frame = 2
Query:   71 ITEFNTYEDFLDSQITPLDLFYLEDEELARQLVE--LGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFA---------PYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNA-SSPGDNSNRTVIDSPKYTQIVIYDHITRRKN 745
            +  FN Y+D++DS IT  D  YL ++E+ R L++   G    G +L RE+F  RKE  +   L +    + ++  L    ++  D  L+  ++RE+     +++T++++  ++ KG EIS ++D    L+   F            F G+ K+ P    LS+++W    V+ N + N+ VL +    LL K+  D KI  V+ +       N +R    SP Y  ++ +DHI RR N
Sbjct:    3 LINFNHYQDYVDSFITIQDTRYLGNKEIQRNLIQNACGKNCLGNLLTREQFYQRKE--KELVLLKPRGLRGLQ--LFGDYLNNKDEVLQQFANREKKLLEKQISTVVYLVMRSKKGLEISSFLDLEQSLRESRFENSTSCVDWRAIFEGRTKLRPSNLHLSYFDWHQNRVSFNNSDNFRVLNKRPHSLLLKHVGDHKIFCVNASCDCEHSKNVSRKTYFSPIYGYVIFFDHIIRRIN 235          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Zebrafish
Match: cfap299 (cilia and flagella associated protein 299 [Source:NCBI gene;Acc:558475])

HSP 1 Score: 273.478 bits (698), Expect = 5.061e-92
Identity = 136/223 (60.99%), Postives = 167/223 (74.89%), Query Frame = 2
Query:   71 ITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRR 739
            + EF TYEDFLDSQI P+DLFYLED+ELARQLVELG + S   L+REEF+ RK  AEASRLA  +  K     LAS+G ++ D FL+AL+ REE NRSG+M +IIFIRD+N +GQEIS YIDY+HRLK+E+F PYF GK+++LP+  DLSFYNW TQ    N + NY V+ E+ SGLLFK K DRKILNVDP    PGD+S RT + S  Y  +VIYDH+ R+
Sbjct:   13 MDEFRTYEDFLDSQIKPVDLFYLEDQELARQLVELGLKDSS--LEREEFETRKAAAEASRLASGSQQKK----LASTGKELKDNFLRALAEREEANRSGEMNSIIFIRDQNARGQEISAYIDYSHRLKSEDFEPYFSGKKRLLPKTSDLSFYNWRTQKSKHNNSSNYEVITENPSGLLFKCKNDRKILNVDPE-KLPGDSSTRTPVQSDLYVHVVIYDHVIRK 228          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Zebrafish
Match: cfap299 (cilia and flagella associated protein 299 [Source:NCBI gene;Acc:558475])

HSP 1 Score: 257.299 bits (656), Expect = 3.930e-85
Identity = 136/261 (52.11%), Postives = 171/261 (65.52%), Query Frame = 2
Query:   71 ITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLA--------------------RQTTTKNIETT----LASSGIDILDPFLKALSSREEVNRSGKM--------------TTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRR 739
            + EF TYEDFLDSQI P+DLFYLED+ELARQLVELG + S   L+REEF+ RK  AEASRLA                    R+  +  +       LAS+G ++ D FL+AL+ REE NRSG+M              ++IIFIRD+N +GQEIS YIDY+HRLK+E+F PYF GK+++LP+  DLSFYNW TQ    N + NY V+ E+ SGLLFK K DRKILNVDP +  PGD+S RT + S  Y  +VIYDH+ R+
Sbjct:   14 MDEFRTYEDFLDSQIKPVDLFYLEDQELARQLVELGLKDSS--LEREEFETRKAAAEASRLASGSQQNPPTCHPVTGVWPEGRRDISNCLNVVFSRKLASTGKELKDNFLRALAEREEANRSGEMNHSICYVMGFPPNISSIIFIRDQNARGQEISAYIDYSHRLKSEDFEPYFSGKKRLLPKTSDLSFYNWRTQKSKHNNSSNYEVITENPSGLLFKCKNDRKILNVDPESKLPGDSSTRTPVQSDLYVHVVIYDHVIRK 272          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Zebrafish
Match: cfap299 (cilia and flagella associated protein 299 [Source:NCBI gene;Acc:558475])

HSP 1 Score: 248.054 bits (632), Expect = 7.578e-82
Identity = 122/192 (63.54%), Postives = 148/192 (77.08%), Query Frame = 2
Query:   71 ITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDP 646
            + EF TYEDFLDSQI P+DLFYLED+ELARQLVELG + S   L+REEF+ RK  AEASRLA  +  K     LAS+G ++ D FL+AL+ REE NRSG+M +IIFIRD+N +GQEIS YIDY+HRLK+E+F PYF GK+++LP+  DLSFYNW TQ    N + NY V+ E+ SGLLFK K DRKILNVDP
Sbjct:   13 MDEFRTYEDFLDSQIKPVDLFYLEDQELARQLVELGLKDSS--LEREEFETRKAAAEASRLASGSQQKK----LASTGKELKDNFLRALAEREEANRSGEMNSIIFIRDQNARGQEISAYIDYSHRLKSEDFEPYFSGKKRLLPKTSDLSFYNWRTQKSKHNNSSNYEVITENPSGLLFKCKNDRKILNVDP 198          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Xenopus
Match: gopc (golgi-associated PDZ and coiled-coil motif containing [Source:Xenbase;Acc:XB-GENE-5857191])

HSP 1 Score: 335.495 bits (859), Expect = 1.638e-116
Identity = 166/233 (71.24%), Postives = 191/233 (81.97%), Query Frame = 2
Query:   44 ESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            E+ S  D+IIT+FNTYEDFLDSQIT LDL YLEDEELARQLVELGYRGSGEVLKR+EF+A+K  AEASRL+++   K     L+S+G D  D FLKAL+ REE NR+GKMT++IFIRDKN  GQE+SGYID+AHRLKTE+F  YF  K+K+LPRP DLSFYNWE+   TSN +PNY V+AES+SGLLFKNKRDRKILNVDP A SPGDNS RT I +  Y Q VIYDHITRRK
Sbjct:    5 EAESATDSIITQFNTYEDFLDSQITALDLLYLEDEELARQLVELGYRGSGEVLKRDEFEAKKVAAEASRLSQRIQQK----ILSSAGKDPKDNFLKALAMREEANRNGKMTSVIFIRDKNAHGQEVSGYIDFAHRLKTEDFDVYFSAKKKLLPRPTDLSFYNWESHVSTSNSSPNYQVIAESSSGLLFKNKRDRKILNVDPKA-SPGDNSTRTPIQTDIYIQAVIYDHITRRK 232          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Xenopus
Match: gopc (golgi-associated PDZ and coiled-coil motif containing [Source:Xenbase;Acc:XB-GENE-5857191])

HSP 1 Score: 335.88 bits (860), Expect = 3.968e-116
Identity = 166/233 (71.24%), Postives = 191/233 (81.97%), Query Frame = 2
Query:   44 ESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            E+ S  D+IIT+FNTYEDFLDSQIT LDL YLEDEELARQLVELGYRGSGEVLKR+EF+A+K  AEASRL+++   K     L+S+G D  D FLKAL+ REE NR+GKMT++IFIRDKN  GQE+SGYID+AHRLKTE+F  YF  K+K+LPRP DLSFYNWE+   TSN +PNY V+AES+SGLLFKNKRDRKILNVDP A SPGDNS RT I +  Y Q VIYDHITRRK
Sbjct:   33 EAESATDSIITQFNTYEDFLDSQITALDLLYLEDEELARQLVELGYRGSGEVLKRDEFEAKKVAAEASRLSQRIQQK----ILSSAGKDPKDNFLKALAMREEANRNGKMTSVIFIRDKNAHGQEVSGYIDFAHRLKTEDFDVYFSAKKKLLPRPTDLSFYNWESHVSTSNSSPNYQVIAESSSGLLFKNKRDRKILNVDPKA-SPGDNSTRTPIQTDIYIQAVIYDHITRRK 260          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Mouse
Match: Cfap299 (cilia and flagella associated protein 299 [Source:MGI Symbol;Acc:MGI:1916571])

HSP 1 Score: 306.22 bits (783), Expect = 4.698e-105
Identity = 142/234 (60.68%), Postives = 184/234 (78.63%), Query Frame = 2
Query:   41 EESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            +E ++ +DNI+T+FNTYEDFLDSQIT +DL+YLEDE LARQLVELGYRG+GE++KRE+F+ARK     +R A +T  K    TL S+G ++ D FLKAL+ REE NR+GK++T+IFIRD+NP GQE+SGYIDYAHRLK+E+F  YF GKR++LPR  D+SFYNW++     N +PNY V+A++  GLLFK KRDRKILNVDP A  PGDNS R  I +  Y  +V++DH++RRK
Sbjct:    4 DEGLTAVDNIVTQFNTYEDFLDSQITTVDLYYLEDESLARQLVELGYRGTGEIVKREDFEARKAAINIARQAERTQKK----TLTSAGKELHDDFLKALAMREEDNRAGKLSTVIFIRDRNPHGQEVSGYIDYAHRLKSEDFEVYFNGKRRLLPRTTDMSFYNWDSHIAVCNSSPNYQVIADNPEGLLFKYKRDRKILNVDPKA-HPGDNSTRIPIQTDLYAHVVLFDHVSRRK 232          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Mouse
Match: Cfap299 (cilia and flagella associated protein 299 [Source:MGI Symbol;Acc:MGI:1916571])

HSP 1 Score: 137.502 bits (345), Expect = 1.653e-40
Identity = 67/114 (58.77%), Postives = 89/114 (78.07%), Query Frame = 2
Query:   50 VSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFI 391
            ++ +DNI+T+FNTYEDFLDSQIT +DL+YLEDE LARQLVELGYRG+GE++KRE+F+ARK     +R A +T  K    TL S+G ++ D FLKAL+ REE NR+GK++  I +
Sbjct:    2 LTAVDNIVTQFNTYEDFLDSQITTVDLYYLEDESLARQLVELGYRGTGEIVKREDFEARKAAINIARQAERTQKK----TLTSAGKELHDDFLKALAMREEDNRAGKLSKKISV 111          
BLAST of cilia- and flagella-associated protein 299 vs. UniProt/SwissProt
Match: sp|Q5PQ44|CF299_XENLA (Cilia- and flagella-associated protein 299 OS=Xenopus laevis OX=8355 GN=cfap299 PE=2 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 1.569e-120
Identity = 170/234 (72.65%), Postives = 196/234 (83.76%), Query Frame = 2
Query:   44 ESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRKN 745
            E+ S  D+IIT+FNTYEDFLDSQIT LDL YLEDEELARQLVELGYRGSGEVLKR+EF+ARK  AEASRL+++T  K    TL+S+G D  D FLKAL+ REE NR+GKMT++IFIRDKN  GQE+SGYID+AHRLKTE+F  YF GK+K+LPRP DLSFYNWE+   TSNP+PNY V+AE++SGLLFKNKRDRKILNVDP A SPGDNS RT I +  Y Q VIYDHITRRK+
Sbjct:    5 EAGSAADSIITQFNTYEDFLDSQITALDLHYLEDEELARQLVELGYRGSGEVLKRDEFEARKAAAEASRLSQRTQQK----TLSSAGKDPKDNFLKALAMREEANRNGKMTSVIFIRDKNAHGQEVSGYIDFAHRLKTEDFEVYFSGKKKLLPRPTDLSFYNWESHVSTSNPSPNYQVIAETSSGLLFKNKRDRKILNVDPKA-SPGDNSTRTSIQTDIYIQAVIYDHITRRKS 233          
BLAST of cilia- and flagella-associated protein 299 vs. UniProt/SwissProt
Match: sp|Q2YDG2|CF299_BOVIN (Cilia- and flagella-associated protein 299 OS=Bos taurus OX=9913 GN=CFAP299 PE=2 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 3.747e-106
Identity = 152/234 (64.96%), Postives = 188/234 (80.34%), Query Frame = 2
Query:   41 EESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            +E+++ +DNI+T+FNTYEDFLDSQIT LDL+YLEDE LARQLVELGYRG+GEV+KRE+F+ARK   E +RLA +T  K    TL S+G D+ D FLKAL+ REE NRSGK  ++IFIRDKN  GQE+SGYIDYAHRLKTE+F  YF GK+++LPRP D+SFYNW++     N TPNY V+A++  GLLFK KRDRKILNVDP A  PGDNS R+ I +  YTQ+VI+DH++RRK
Sbjct:    4 DEALTTVDNIVTQFNTYEDFLDSQITTLDLYYLEDEGLARQLVELGYRGTGEVVKREDFEARKAAIEIARLAERTQKK----TLTSAGKDLHDNFLKALAVREEDNRSGK--SVIFIRDKNSHGQEVSGYIDYAHRLKTEDFEVYFSGKKRLLPRPTDMSFYNWDSHIAIWNSTPNYQVIADNPEGLLFKYKRDRKILNVDPKA-QPGDNSTRSPILTELYTQVVIFDHVSRRK 230          
BLAST of cilia- and flagella-associated protein 299 vs. UniProt/SwissProt
Match: sp|Q6V702|CF299_HUMAN (Cilia- and flagella-associated protein 299 OS=Homo sapiens OX=9606 GN=CFAP299 PE=2 SV=4)

HSP 1 Score: 308.145 bits (788), Expect = 7.114e-105
Identity = 148/234 (63.25%), Postives = 181/234 (77.35%), Query Frame = 2
Query:   41 EESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            EE +  LDNI+T+FN YEDFLDSQIT +DL+YLEDE LARQLVELGYRG+GE +KRE+F+ARK   E +RLA +   K    TL S+G D+ D FL AL+ REE NRSGK++++IFIRD+N  GQEISGYIDYAHRLKTE+F  YF GK+++LPRP D+SFYNW+     SN +PNY V+A++  GLLF+ KRDRKILNVDP A  PGDNS R  I +  Y Q VI+DHI+RRK
Sbjct:    4 EEGLKALDNIVTQFNAYEDFLDSQITTVDLYYLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQK----TLTSAGKDLQDNFLTALAMREEDNRSGKLSSVIFIRDRNSHGQEISGYIDYAHRLKTEDFEVYFTGKKRLLPRPTDISFYNWDADIAVSNSSPNYQVIADNPEGLLFRYKRDRKILNVDPKA-QPGDNSTRITILTELYVQAVIFDHISRRK 232          
BLAST of cilia- and flagella-associated protein 299 vs. UniProt/SwissProt
Match: sp|Q810M1|CF299_MOUSE (Cilia- and flagella-associated protein 299 OS=Mus musculus OX=10090 GN=Cfap299 PE=2 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 3.286e-104
Identity = 142/234 (60.68%), Postives = 184/234 (78.63%), Query Frame = 2
Query:   41 EESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            +E ++ +DNI+T+FNTYEDFLDSQIT +DL+YLEDE LARQLVELGYRG+GE++KRE+F+ARK     +R A +T  K    TL S+G ++ D FLKAL+ REE NR+GK++T+IFIRD+NP GQE+SGYIDYAHRLK+E+F  YF GKR++LPR  D+SFYNW++     N +PNY V+A++  GLLFK KRDRKILNVDP A  PGDNS R  I +  Y  +V++DH++RRK
Sbjct:    4 DEGLTAVDNIVTQFNTYEDFLDSQITTVDLYYLEDESLARQLVELGYRGTGEIVKREDFEARKAAINIARQAERTQKK----TLTSAGKELHDDFLKALAMREEDNRAGKLSTVIFIRDRNPHGQEVSGYIDYAHRLKSEDFEVYFNGKRRLLPRTTDMSFYNWDSHIAVCNSSPNYQVIADNPEGLLFKYKRDRKILNVDPKA-HPGDNSTRIPIQTDLYAHVVLFDHVSRRK 232          
BLAST of cilia- and flagella-associated protein 299 vs. UniProt/SwissProt
Match: sp|A2AVJ0|CF299_DANRE (Cilia- and flagella-associated protein 299 OS=Danio rerio OX=7955 GN=cfap299 PE=3 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 3.821e-91
Identity = 136/223 (60.99%), Postives = 167/223 (74.89%), Query Frame = 2
Query:   71 ITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRR 739
            + EF TYEDFLDSQI P+DLFYLED+ELARQLVELG + S   L+REEF+ RK  AEASRLA  +  K     LAS+G ++ D FL+AL+ REE NRSG+M +IIFIRD+N +GQEIS YIDY+HRLK+E+F PYF GK+++LP+  DLSFYNW TQ    N + NY V+ E+ SGLLFK K DRKILNVDP    PGD+S RT + S  Y  +VIYDH+ R+
Sbjct:   13 MDEFRTYEDFLDSQIKPVDLFYLEDQELARQLVELGLKDSS--LEREEFETRKAAAEASRLASGSQQKK----LASTGKELKDNFLRALAEREEANRSGEMNSIIFIRDQNARGQEISAYIDYSHRLKSEDFEPYFSGKKRLLPKTSDLSFYNWRTQKSKHNNSSNYEVITENPSGLLFKCKNDRKILNVDPE-KLPGDSSTRTPVQSDLYVHVVIYDHVIRK 228          
BLAST of cilia- and flagella-associated protein 299 vs. TrEMBL
Match: C3YFR7 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_122572 PE=4 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 2.937e-135
Identity = 187/236 (79.24%), Postives = 209/236 (88.56%), Query Frame = 2
Query:   35 MTEESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            M EE  SG DNI+TE+NTYEDFLDSQIT LDL+YLEDEELARQLVELGYRGSGEVLKREEF+ARK+ AEASRL++++  K     LASSG D+ +PFLK L+ REE NRSGKMTTIIFIRD N +GQEISGYIDYAHRLKTE+F PYF GK+++LPRP DLSFYNWETQT TSNPTPNY V+AESASGLLFKNKRDRKILNVDP A+SPGDNS RTV+DSP+YTQ+VIYDHITRRK
Sbjct:    1 MEEELPSGTDNIVTEYNTYEDFLDSQITSLDLYYLEDEELARQLVELGYRGSGEVLKREEFEARKQAAEASRLSKRSQQK----ALASSGKDLKNPFLKCLAQREEANRSGKMTTIIFIRDFNTRGQEISGYIDYAHRLKTEDFEPYFSGKKRLLPRPSDLSFYNWETQTSTSNPTPNYQVIAESASGLLFKNKRDRKILNVDPKAASPGDNSTRTVVDSPQYTQVVIYDHITRRK 232          
BLAST of cilia- and flagella-associated protein 299 vs. TrEMBL
Match: A7T0C7 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g227643 PE=4 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 3.929e-133
Identity = 184/236 (77.97%), Postives = 207/236 (87.71%), Query Frame = 2
Query:   35 MTEESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            M EE+V   DNI+TEF TYEDFLDSQITPLDL+YLEDEELARQLVELGYRGSGEVLKREEF+ARK+ AEASRL++++  K    TLASSG ++ DPFLKAL+ REE NRSGKMT+IIFIRDKNPKGQEISGYIDYAHRLKTE+F PYF G+R++LPRP DLSFYNWETQT TSNPTPNY V+AE++ GLLFKNKRDRKILNVDP A +PGDNS R  I+S KY Q+VIYDHITRRK
Sbjct:    1 MDEEAVGATDNIVTEFATYEDFLDSQITPLDLYYLEDEELARQLVELGYRGSGEVLKREEFEARKQAAEASRLSKRSQQK----TLASSGKELKDPFLKALAQREEANRSGKMTSIIFIRDKNPKGQEISGYIDYAHRLKTEDFEPYFNGRRRLLPRPSDLSFYNWETQTATSNPTPNYQVIAENSIGLLFKNKRDRKILNVDPKAPTPGDNSARITIESKKYIQVVIYDHITRRK 232          
BLAST of cilia- and flagella-associated protein 299 vs. TrEMBL
Match: V4ALN9 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_151687 PE=4 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 3.591e-132
Identity = 182/236 (77.12%), Postives = 207/236 (87.71%), Query Frame = 2
Query:   35 MTEESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            M EE  S  DNI+TEFNTYEDFLDSQIT LDL+YLEDEELARQLVELGYRGSGEVLKREEF+ARK+ AEASRL++++  K    TLASSG ++ DPF K L+ REE NRSGKMTTI+FIRDKN +GQEISGYID+AHRLKTE+F PYF G++++LPRP DLSFYNWETQT TSNPTPNY V+AE+ASGLLFKNKRDRKI+NVDP A SPGDNS RTV+++PKY QIVIYDHITRRK
Sbjct:    1 MEEEVASSGDNIVTEFNTYEDFLDSQITSLDLYYLEDEELARQLVELGYRGSGEVLKREEFEARKQAAEASRLSKRSQQK----TLASSGKELKDPFYKCLAQREEANRSGKMTTIVFIRDKNARGQEISGYIDFAHRLKTEDFEPYFSGRKRLLPRPSDLSFYNWETQTSTSNPTPNYQVIAENASGLLFKNKRDRKIINVDPKAPSPGDNSTRTVLETPKYIQIVIYDHITRRK 232          
BLAST of cilia- and flagella-associated protein 299 vs. TrEMBL
Match: A0A210PF90 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05406 PE=4 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 2.694e-131
Identity = 180/236 (76.27%), Postives = 206/236 (87.29%), Query Frame = 2
Query:   35 MTEESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            M EE  SG DNI+ EFNTYEDFLDSQI P+DLFYLEDEELARQ+VELGYRGSGEVLKREEF+ARK+ AEASRL++++  K    TLASSG ++ DPFLKAL+ REE NRSGKMTTIIFIRDKN +GQEISGY+DYAHRLKTE+F PYF  ++++LPRP DLSFYNWETQT TSNPTPNY V+AE+ASGLLFKNKRDRKI+NVDP  ++PGDNS RTVI++ KY Q VIYDHITRRK
Sbjct:    1 MEEEVTSGGDNIVAEFNTYEDFLDSQIKPIDLFYLEDEELARQVVELGYRGSGEVLKREEFEARKQAAEASRLSKRSQQK----TLASSGKELKDPFLKALAHREEANRSGKMTTIIFIRDKNARGQEISGYVDYAHRLKTEDFEPYFGARKRLLPRPSDLSFYNWETQTSTSNPTPNYQVIAENASGLLFKNKRDRKIINVDPKVTTPGDNSTRTVIETCKYVQAVIYDHITRRK 232          
BLAST of cilia- and flagella-associated protein 299 vs. TrEMBL
Match: A0A1S3KDS2 (uncharacterized protein C4orf22 homolog OS=Lingula unguis OX=7574 GN=LOC106180819 PE=4 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 2.408e-130
Identity = 180/236 (76.27%), Postives = 208/236 (88.14%), Query Frame = 2
Query:   35 MTEESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            M EE  SG DNI+TEFNTYEDFLDSQIT LDL+YLEDEELARQLVELGYRGSGEVLKREEF+ARK  AEASRL++++  K    TLASSG ++ DPFLKAL++REE NRSGKMT+IIFIRD+N + QEISGYID+AHRLKTE+F PYF GK+++LPRP DLSFYNWETQT TSNPTPNY V+AE+ASGLLFKNKRDRKI+NVDP A +PGDNS RT++++P+Y Q VIYDHITRRK
Sbjct:    1 MEEEVPSGGDNIVTEFNTYEDFLDSQITSLDLYYLEDEELARQLVELGYRGSGEVLKREEFEARKAAAEASRLSKRSQQK----TLASSGKELKDPFLKALANREEANRSGKMTSIIFIRDRNARSQEISGYIDFAHRLKTEDFEPYFNGKKRLLPRPSDLSFYNWETQTSTSNPTPNYQVIAENASGLLFKNKRDRKIINVDPKAPTPGDNSTRTIVETPRYIQAVIYDHITRRK 232          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Cavefish
Match: cfap299 (cilia and flagella associated protein 299 [Source:NCBI gene;Acc:103027705])

HSP 1 Score: 323.939 bits (829), Expect = 5.394e-112
Identity = 159/236 (67.37%), Postives = 187/236 (79.24%), Query Frame = 2
Query:   35 MTEESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            M EE  + +D IITEFN YED+L+S I P DL+Y+EDE+LARQLVELGYR SGEVLKREEF+ RK  AEA RL+ +T  K    TLAS+G ++ D FL+AL+ REE NRSGKMT+IIFIRD+N  GQEISGYIDY+HRL++E+F PYF GK+++LPRP DLSFYNW+TQ  TSN T NY  +AE+ +GLLFKNKRDRKILNVDP A SPGDNS RT I S  Y Q VIYDH TR K
Sbjct:   11 MEEEGSTAMDGIITEFNIYEDYLNSWIGPKDLYYIEDEKLARQLVELGYRSSGEVLKREEFETRKAAAEALRLSNKTQQK----TLASAGKELKDNFLRALAEREEANRSGKMTSIIFIRDQNSHGQEISGYIDYSHRLRSEDFEPYFSGKKRLLPRPTDLSFYNWKTQVATSNDTTNYQAIAENPTGLLFKNKRDRKILNVDPKA-SPGDNSFRTTISSDLYLQCVIYDHNTRMK 241          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Cavefish
Match: cfap299 (cilia and flagella associated protein 299 [Source:NCBI gene;Acc:103027705])

HSP 1 Score: 323.168 bits (827), Expect = 1.063e-111
Identity = 159/236 (67.37%), Postives = 187/236 (79.24%), Query Frame = 2
Query:   35 MTEESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            M EE  + +D IITEFN YED+L+S I P DL+Y+EDE+LARQLVELGYR SGEVLKREEF+ RK  AEA RL+ +T  K    TLAS+G ++ D FL+AL+ REE NRSGKMT+IIFIRD+N  GQEISGYIDY+HRL++E+F PYF GK+++LPRP DLSFYNW+TQ  TSN T NY  +AE+ +GLLFKNKRDRKILNVDP A SPGDNS RT I S  Y Q VIYDH TR K
Sbjct:    5 MEEEGSTAMDGIITEFNIYEDYLNSWIGPKDLYYIEDEKLARQLVELGYRSSGEVLKREEFETRKAAAEALRLSNKTQQK----TLASAGKELKDNFLRALAEREEANRSGKMTSIIFIRDQNSHGQEISGYIDYSHRLRSEDFEPYFSGKKRLLPRPTDLSFYNWKTQVATSNDTTNYQAIAENPTGLLFKNKRDRKILNVDPKA-SPGDNSFRTTISSDLYLQCVIYDHNTRMK 235          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Nematostella
Match: EDO30578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0C7])

HSP 1 Score: 385.956 bits (990), Expect = 5.434e-137
Identity = 184/236 (77.97%), Postives = 207/236 (87.71%), Query Frame = 2
Query:   35 MTEESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            M EE+V   DNI+TEF TYEDFLDSQITPLDL+YLEDEELARQLVELGYRGSGEVLKREEF+ARK+ AEASRL++++  K    TLASSG ++ DPFLKAL+ REE NRSGKMT+IIFIRDKNPKGQEISGYIDYAHRLKTE+F PYF G+R++LPRP DLSFYNWETQT TSNPTPNY V+AE++ GLLFKNKRDRKILNVDP A +PGDNS R  I+S KY Q+VIYDHITRRK
Sbjct:    1 MDEEAVGATDNIVTEFATYEDFLDSQITPLDLYYLEDEELARQLVELGYRGSGEVLKREEFEARKQAAEASRLSKRSQQK----TLASSGKELKDPFLKALAQREEANRSGKMTSIIFIRDKNPKGQEISGYIDYAHRLKTEDFEPYFNGRRRLLPRPSDLSFYNWETQTATSNPTPNYQVIAENSIGLLFKNKRDRKILNVDPKAPTPGDNSARITIESKKYIQVVIYDHITRRK 232          
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Nematostella
Match: EDO27641 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8P4])

HSP 1 Score: 296.975 bits (759), Expect = 1.933e-102
Identity = 153/237 (64.56%), Postives = 173/237 (73.00%), Query Frame = 2
Query:   32 QMTEESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRK 742
            +M EE+V   DNI+TEF TYEDFLDSQITPLDL+YLEDEELARQLVELGYRGSGEVLKREEF+ARK+ AEASRL++++  K    TLASSG ++ DPFLKAL+ REE NRSGKMT+IIFIRDKNPKGQEISGYIDYAHRLK                                        V+AE++ GLLFKNKRDRKILNVDP A +PGDNS R  I+S KY Q+VIYDHITRRK
Sbjct:    6 KMDEEAVGATDNIVTEFATYEDFLDSQITPLDLYYLEDEELARQLVELGYRGSGEVLKREEFEARKQAAEASRLSKRSQQK----TLASSGKELKDPFLKALAQREEANRSGKMTSIIFIRDKNPKGQEISGYIDYAHRLK----------------------------------------VIAENSIGLLFKNKRDRKILNVDPKAPTPGDNSARITIESKKYIQVVIYDHITRRK 198          
BLAST of cilia- and flagella-associated protein 299 vs. Planmine SMEST
Match: SMESG000052708.1 (SMESG000052708.1)

HSP 1 Score: 471.085 bits (1211), Expect = 2.301e-170
Identity = 233/237 (98.31%), Postives = 233/237 (98.31%), Query Frame = 2
Query:   35 MTEESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRKN 745
            MTEESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTK    TLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRKN
Sbjct:    1 MTEESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYRGSGEVLKREEFQARKEIAEASRLARQTTTK----TLASSGIDILDPFLKALSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLGKRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKILNVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRKN 233          
The following BLAST results are available for this feature:
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CFAP2991.481e-10563.25cilia and flagella associated protein 299 [Source:... [more]
CFAP2992.038e-10158.96cilia and flagella associated protein 299 [Source:... [more]
CFAP2996.609e-4060.87cilia and flagella associated protein 299 [Source:... [more]
CFAP2993.580e-3066.67cilia and flagella associated protein 299 [Source:... [more]
CFAP2992.690e-2460.00cilia and flagella associated protein 299 [Source:... [more]
back to top
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG81381.047e-2832.77gene:FBgn0038122 transcript:FBtr0082732[more]
CG140131.761e-2829.22gene:FBgn0031720 transcript:FBtr0079121[more]
CG140172.994e-2637.33gene:FBgn0031721 transcript:FBtr0079104[more]
CG35282.521e-2528.69gene:FBgn0031430 transcript:FBtr0077781[more]
back to top
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cfap2995.061e-9260.99cilia and flagella associated protein 299 [Source:... [more]
cfap2993.930e-8552.11cilia and flagella associated protein 299 [Source:... [more]
cfap2997.578e-8263.54cilia and flagella associated protein 299 [Source:... [more]
back to top
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gopc1.638e-11671.24golgi-associated PDZ and coiled-coil motif contain... [more]
gopc3.968e-11671.24golgi-associated PDZ and coiled-coil motif contain... [more]
back to top
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cfap2994.698e-10560.68cilia and flagella associated protein 299 [Source:... [more]
Cfap2991.653e-4058.77cilia and flagella associated protein 299 [Source:... [more]
back to top
BLAST of cilia- and flagella-associated protein 299 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5PQ44|CF299_XENLA1.569e-12072.65Cilia- and flagella-associated protein 299 OS=Xeno... [more]
sp|Q2YDG2|CF299_BOVIN3.747e-10664.96Cilia- and flagella-associated protein 299 OS=Bos ... [more]
sp|Q6V702|CF299_HUMAN7.114e-10563.25Cilia- and flagella-associated protein 299 OS=Homo... [more]
sp|Q810M1|CF299_MOUSE3.286e-10460.68Cilia- and flagella-associated protein 299 OS=Mus ... [more]
sp|A2AVJ0|CF299_DANRE3.821e-9160.99Cilia- and flagella-associated protein 299 OS=Dani... [more]
back to top
BLAST of cilia- and flagella-associated protein 299 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3YFR72.937e-13579.24Uncharacterized protein OS=Branchiostoma floridae ... [more]
A7T0C73.929e-13377.97Predicted protein OS=Nematostella vectensis OX=453... [more]
V4ALN93.591e-13277.12Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A210PF902.694e-13176.27Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
A0A1S3KDS22.408e-13076.27uncharacterized protein C4orf22 homolog OS=Lingula... [more]
back to top
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cfap2995.394e-11267.37cilia and flagella associated protein 299 [Source:... [more]
cfap2991.063e-11167.37cilia and flagella associated protein 299 [Source:... [more]
back to top
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO305785.434e-13777.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276411.933e-10264.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cilia- and flagella-associated protein 299 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 299 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000052708.12.301e-17098.31SMESG000052708.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030837 ID=SMED30030837|Name=cilia- and flagella-associated protein 299|organism=Schmidtea mediterranea sexual|type=transcript|length=862bp
CGATACTATAGTAACCTTAAAATACTTATAACAAATGACTGAAGAATCTG
TTAGTGGGCTCGATAATATAATTACAGAATTCAACACATATGAAGATTTT
TTGGACTCTCAAATAACACCATTAGATTTATTTTATTTAGAAGATGAAGA
GTTAGCCAGACAATTAGTTGAATTAGGATACCGAGGGAGTGGAGAAGTAT
TAAAAAGAGAAGAATTTCAAGCAAGAAAAGAAATTGCTGAAGCTTCAAGA
CTAGCTAGACAAACAACAACAAAAAATATTGAGACAACACTAGCAAGTAG
TGGAATAGATATTTTAGACCCCTTTCTTAAAGCTTTATCAAGTAGAGAAG
AAGTGAATCGAAGCGGGAAAATGACTACCATAATATTTATTCGAGATAAA
AATCCTAAAGGTCAAGAAATATCCGGTTATATTGATTATGCACACAGATT
GAAAACGGAAGAGTTTGCCCCATATTTCCTTGGGAAACGCAAAATTCTCC
CAAGACCGCAAGATTTGAGTTTCTACAATTGGGAAACTCAAACTGTCACC
TCAAATCCAACACCAAATTATAGCGTCTTAGCTGAAAGCGCTTCTGGACT
TCTTTTCAAAAATAAACGCGACAGAAAAATATTAAATGTCGATCCAAATG
CATCATCTCCAGGTGACAACTCCAACAGAACGGTTATTGACTCACCAAAA
TATACGCAAATCGTTATATATGATCACATTACTCGACGGAAAAATTGATT
CTCAAAATCATCAGAATTGATTTTTTTTTCGTTTGAAGATAATTTATTCT
TATTTCAAATGTAGGTGGTTACGTTTGGTTAAATATGATACAATGCGACG
AGTTTTAGCCAG
back to top

protein sequence of SMED30030837-orf-1

>SMED30030837-orf-1 ID=SMED30030837-orf-1|Name=SMED30030837-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=238bp
MTEESVSGLDNIITEFNTYEDFLDSQITPLDLFYLEDEELARQLVELGYR
GSGEVLKREEFQARKEIAEASRLARQTTTKNIETTLASSGIDILDPFLKA
LSSREEVNRSGKMTTIIFIRDKNPKGQEISGYIDYAHRLKTEEFAPYFLG
KRKILPRPQDLSFYNWETQTVTSNPTPNYSVLAESASGLLFKNKRDRKIL
NVDPNASSPGDNSNRTVIDSPKYTQIVIYDHITRRKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR027887DUF4464
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR027887Protein of unknown function DUF4464PFAMPF14713DUF4464coord: 12..236
e-value: 8.9E-95
score: 316.5
IPR027887Protein of unknown function DUF4464PANTHERPTHR33588FAMILY NOT NAMEDcoord: 2..237