N-acetylglucosamine-6-phosphate deacetylase

Overview
NameN-acetylglucosamine-6-phosphate deacetylase
Smed IDSMED30030834
Length (bp)231
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of N-acetylglucosamine-6-phosphate deacetylase (SMED30030834) t-SNE clustered cells

Violin plots show distribution of expression levels for N-acetylglucosamine-6-phosphate deacetylase (SMED30030834) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of N-acetylglucosamine-6-phosphate deacetylase (SMED30030834) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for N-acetylglucosamine-6-phosphate deacetylase (SMED30030834) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030834

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030834h1SMcG0019282 SmedASXL_017911SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Human
Match: AMDHD2 (amidohydrolase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:24262])

HSP 1 Score: 54.6842 bits (130), Expect = 7.624e-10
Identity = 28/71 (39.44%), Postives = 41/71 (57.75%), Query Frame = 1
Query:   16 SYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVMLSYDSM 228
            +YV  T  L+G    +D C+R+F  + G S   A+++ + HPA+ L L   KG L  G DAD V+L  DS+
Sbjct:  320 AYVAGTKTLSGSIAPMDVCVRHFLQATGCSMESALEAASLHPAQLLGLEKSKGTLDFGADADFVVLD-DSL 389          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Human
Match: AMDHD2 (amidohydrolase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:24262])

HSP 1 Score: 50.447 bits (119), Expect = 1.732e-8
Identity = 26/68 (38.24%), Postives = 39/68 (57.35%), Query Frame = 1
Query:   25 KSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVMLSYDSM 228
            + T  L+G    +D C+R+F  + G S   A+++ + HPA+ L L   KG L  G DAD V+L  DS+
Sbjct:  117 QGTKTLSGSIAPMDVCVRHFLQATGCSMESALEAASLHPAQLLGLEKSKGTLDFGADADFVVLD-DSL 183          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Human
Match: AMDHD2 (amidohydrolase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:24262])

HSP 1 Score: 50.447 bits (119), Expect = 1.805e-8
Identity = 26/68 (38.24%), Postives = 39/68 (57.35%), Query Frame = 1
Query:   25 KSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVMLSYDSM 228
            + T  L+G    +D C+R+F  + G S   A+++ + HPA+ L L   KG L  G DAD V+L  DS+
Sbjct:  353 QGTKTLSGSIAPMDVCVRHFLQATGCSMESALEAASLHPAQLLGLEKSKGTLDFGADADFVVLD-DSL 419          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Human
Match: AMDHD2 (amidohydrolase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:24262])

HSP 1 Score: 50.447 bits (119), Expect = 1.837e-8
Identity = 26/68 (38.24%), Postives = 39/68 (57.35%), Query Frame = 1
Query:   25 KSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVMLSYDSM 228
            + T  L+G    +D C+R+F  + G S   A+++ + HPA+ L L   KG L  G DAD V+L  DS+
Sbjct:  353 QGTKTLSGSIAPMDVCVRHFLQATGCSMESALEAASLHPAQLLGLEKSKGTLDFGADADFVVLD-DSL 419          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Fly
Match: CG17065 (gene:FBgn0031099 transcript:FBtr0345924)

HSP 1 Score: 53.1434 bits (126), Expect = 1.062e-9
Identity = 25/71 (35.21%), Postives = 40/71 (56.34%), Query Frame = 1
Query:    1 MKDFRSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            +K  ++++  T  L G    +D+C+R F  +   S   A+++ T HPA+ LK+   KG L  G DAD V+L
Sbjct:  326 VKQGKAFIAGTETLCGSIAPMDECVRIFQKATDCSVVYAIEAATLHPAQCLKIEKQKGTLDFGSDADFVLL 396          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Fly
Match: CG17065 (gene:FBgn0031099 transcript:FBtr0077340)

HSP 1 Score: 53.1434 bits (126), Expect = 1.062e-9
Identity = 25/71 (35.21%), Postives = 40/71 (56.34%), Query Frame = 1
Query:    1 MKDFRSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            +K  ++++  T  L G    +D+C+R F  +   S   A+++ T HPA+ LK+   KG L  G DAD V+L
Sbjct:  326 VKQGKAFIAGTETLCGSIAPMDECVRIFQKATDCSVVYAIEAATLHPAQCLKIEKQKGTLDFGSDADFVLL 396          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Fly
Match: CG17065 (gene:FBgn0031099 transcript:FBtr0301568)

HSP 1 Score: 53.1434 bits (126), Expect = 1.065e-9
Identity = 25/71 (35.21%), Postives = 40/71 (56.34%), Query Frame = 1
Query:    1 MKDFRSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            +K  ++++  T  L G    +D+C+R F  +   S   A+++ T HPA+ LK+   KG L  G DAD V+L
Sbjct:  340 VKQGKAFIAGTETLCGSIAPMDECVRIFQKATDCSVVYAIEAATLHPAQCLKIEKQKGTLDFGSDADFVLL 410          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Zebrafish
Match: amdhd2 (amidohydrolase domain containing 2 [Source:NCBI gene;Acc:402981])

HSP 1 Score: 56.6102 bits (135), Expect = 9.010e-11
Identity = 24/71 (33.80%), Postives = 45/71 (63.38%), Query Frame = 1
Query:    1 MKDFRSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            ++   +YV  T  L+G   ++D C+R+F  ++G +   A+++ + HPA+ L ++H KG L+ G DAD ++L
Sbjct:  315 IQGLHAYVAGTTTLSGSIATMDMCVRHFREASGCTVEAALEAASLHPAQLLGISHRKGTLEFGADADFIVL 385          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Xenopus
Match: amdhd2 (amidohydrolase domain containing 2 [Source:NCBI gene;Acc:100145339])

HSP 1 Score: 56.9954 bits (136), Expect = 8.980e-11
Identity = 26/71 (36.62%), Postives = 43/71 (60.56%), Query Frame = 1
Query:    1 MKDFRSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            ++   +YV  T+ LAG   ++D C+R+F  + G +  EA+++ + HPA+ L +   KG L  G DAD V+L
Sbjct:  327 IEGLNAYVAGTHTLAGSIATMDMCVRHFHEATGCTVEEALEAASLHPAQVLGIQDHKGTLDFGADADFVLL 397          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Xenopus
Match: amdhd2 (amidohydrolase domain containing 2 [Source:NCBI gene;Acc:100145339])

HSP 1 Score: 56.9954 bits (136), Expect = 1.026e-10
Identity = 26/71 (36.62%), Postives = 43/71 (60.56%), Query Frame = 1
Query:    1 MKDFRSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            ++   +YV  T+ LAG   ++D C+R+F  + G +  EA+++ + HPA+ L +   KG L  G DAD V+L
Sbjct:  362 IEGLNAYVAGTHTLAGSIATMDMCVRHFHEATGCTVEEALEAASLHPAQVLGIQDHKGTLDFGADADFVLL 432          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Mouse
Match: Amdhd2 (amidohydrolase domain containing 2 [Source:MGI Symbol;Acc:MGI:2443978])

HSP 1 Score: 52.7582 bits (125), Expect = 2.503e-9
Identity = 25/66 (37.88%), Postives = 37/66 (56.06%), Query Frame = 1
Query:   16 SYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            +Y+  T  L G    +D C+R+F  + G S   A+++ + HPA+ L L   KG L  G DAD V+L
Sbjct:  320 AYIAGTKTLGGSIAPMDVCVRHFLQATGCSVESALEAASLHPAQMLGLEKTKGSLDFGADADFVVL 385          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Mouse
Match: Amdhd2 (amidohydrolase domain containing 2 [Source:MGI Symbol;Acc:MGI:2443978])

HSP 1 Score: 52.7582 bits (125), Expect = 2.522e-9
Identity = 25/66 (37.88%), Postives = 37/66 (56.06%), Query Frame = 1
Query:   16 SYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            +Y+  T  L G    +D C+R+F  + G S   A+++ + HPA+ L L   KG L  G DAD V+L
Sbjct:  364 AYIAGTKTLGGSIAPMDVCVRHFLQATGCSVESALEAASLHPAQMLGLEKTKGSLDFGADADFVVL 429          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Mouse
Match: Amdhd2 (amidohydrolase domain containing 2 [Source:MGI Symbol;Acc:MGI:2443978])

HSP 1 Score: 46.595 bits (109), Expect = 3.559e-7
Identity = 22/61 (36.07%), Postives = 33/61 (54.10%), Query Frame = 1
Query:   16 SYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDA 198
            +Y+  T  L G    +D C+R+F  + G S   A+++ + HPA+ L L   KG L  G DA
Sbjct:  364 AYIAGTKTLGGSIAPMDVCVRHFLQATGCSVESALEAASLHPAQMLGLEKTKGSLDFGADA 424          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. UniProt/SwissProt
Match: sp|Q6P0U0|NAGA_DANRE (N-acetylglucosamine-6-phosphate deacetylase OS=Danio rerio OX=7955 GN=amdhd2 PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 6.801e-10
Identity = 24/71 (33.80%), Postives = 45/71 (63.38%), Query Frame = 1
Query:    1 MKDFRSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            ++   +YV  T  L+G   ++D C+R+F  ++G +   A+++ + HPA+ L ++H KG L+ G DAD ++L
Sbjct:  315 IQGLHAYVAGTTTLSGSIATMDMCVRHFREASGCTVEAALEAASLHPAQLLGISHRKGTLEFGADADFIVL 385          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. UniProt/SwissProt
Match: sp|A7MBC0|NAGA_BOVIN (N-acetylglucosamine-6-phosphate deacetylase OS=Bos taurus OX=9913 GN=AMDHD2 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 9.498e-10
Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 1
Query:   16 SYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVMLSYDSM 228
            +YV  TN L+G    +D C+R+F  + G S   A+++ + HPA+ L L   KG L  G DAD V+L  DS+
Sbjct:  320 AYVAGTNTLSGSIAPMDTCVRHFLQATGCSVESALEAASLHPAQLLGLEKRKGTLDFGADADFVVLD-DSL 389          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. UniProt/SwissProt
Match: sp|Q9Y303|NAGA_HUMAN (N-acetylglucosamine-6-phosphate deacetylase OS=Homo sapiens OX=9606 GN=AMDHD2 PE=1 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 3.661e-9
Identity = 28/71 (39.44%), Postives = 41/71 (57.75%), Query Frame = 1
Query:   16 SYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVMLSYDSM 228
            +YV  T  L+G    +D C+R+F  + G S   A+++ + HPA+ L L   KG L  G DAD V+L  DS+
Sbjct:  320 AYVAGTKTLSGSIAPMDVCVRHFLQATGCSMESALEAASLHPAQLLGLEKSKGTLDFGADADFVVLD-DSL 389          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. UniProt/SwissProt
Match: sp|Q9VR81|NAGA_DROME (N-acetylglucosamine-6-phosphate deacetylase OS=Drosophila melanogaster OX=7227 GN=CG17065 PE=2 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.065e-8
Identity = 25/71 (35.21%), Postives = 40/71 (56.34%), Query Frame = 1
Query:    1 MKDFRSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            +K  ++++  T  L G    +D+C+R F  +   S   A+++ T HPA+ LK+   KG L  G DAD V+L
Sbjct:  326 VKQGKAFIAGTETLCGSIAPMDECVRIFQKATDCSVVYAIEAATLHPAQCLKIEKQKGTLDFGSDADFVLL 396          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. UniProt/SwissProt
Match: sp|Q5BJY6|NAGA_RAT (N-acetylglucosamine-6-phosphate deacetylase OS=Rattus norvegicus OX=10116 GN=Amdhd2 PE=3 SV=2)

HSP 1 Score: 52.7582 bits (125), Expect = 1.305e-8
Identity = 25/66 (37.88%), Postives = 38/66 (57.58%), Query Frame = 1
Query:   16 SYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            +Y+  T  L+G    +D C+R+F  + G S   A+++ + HPA+ L L   KG L  G DAD V+L
Sbjct:  320 AYIAGTKTLSGSIAPMDVCIRHFLQATGCSVESALEAASLHPAQLLGLEKTKGSLDFGADADFVVL 385          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. TrEMBL
Match: A0A2S2QXH3 (N-acetylglucosamine-6-phosphate deacetylase OS=Sipha flava OX=143950 GN=AMDHD2 PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.265e-14
Identity = 34/71 (47.89%), Postives = 47/71 (66.20%), Query Frame = 1
Query:    1 MKDFRSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            +K+ ++Y+ +TN L G  T LD+CMR F  S   S  EA+++VT HPA+ L + HCKG L  G DAD V+L
Sbjct:  300 VKNSKAYIANTNTLCGSMTFLDECMRYFISSTNCSIVEAIEAVTLHPAQVLGIQHCKGTLNYGADADFVLL 370          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. TrEMBL
Match: A0A2P2IBP7 (N-acetylglucosamine-6-phosphate deacetylase OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.475e-14
Identity = 32/72 (44.44%), Postives = 48/72 (66.67%), Query Frame = 1
Query:    1 MKDFRSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVMLS 216
            ++D R+++  T  LAG   ++D+C+R F  +AG+S  EA+ + T HPA+ L +  CKG L PG DAD +MLS
Sbjct:  307 VRDRRAFLPGTATLAGSIATMDECIRRFIKAAGVSVVEAITAATLHPAQLLSITDCKGSLNPGTDADFLMLS 378          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. TrEMBL
Match: A0A1X2HN32 (N-acetylglucosamine-6-phosphate deacetylase OS=Syncephalastrum racemosum OX=13706 GN=BCR43DRAFT_561178 PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 7.670e-14
Identity = 35/69 (50.72%), Postives = 45/69 (65.22%), Query Frame = 1
Query:   16 SYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVMLSYD 222
            +YVK T+ LAG TTS+D C+RNF      S  EA+++ T HPA+ L + H KG L+PG DAD V L  D
Sbjct:  337 AYVKGTDTLAGSTTSIDTCVRNFKKFTSCSTVEALEAATLHPAQMLGIQHRKGTLRPGSDADFVFLDDD 405          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. TrEMBL
Match: A0A168NXJ6 (Amidohydro-rel domain-containing protein OS=Absidia glauca OX=4829 GN=ABSGL_07136.1 scaffold 8717 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.344e-13
Identity = 33/69 (47.83%), Postives = 46/69 (66.67%), Query Frame = 1
Query:   16 SYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVMLSYD 222
            +YVK T+ LAG T ++DQC+RNFW     +R EA+++ T HPA++L + H KG    G DAD+V L  D
Sbjct:  344 AYVKGTDTLAGSTVTIDQCVRNFWKFTRCTRVEALEAATLHPAQSLGITHRKGTFTTGADADMVFLDDD 412          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. TrEMBL
Match: A0A1X2IJV9 (N-acetylglucosamine-6-phosphate deacetylase OS=Absidia repens OX=90262 GN=BCR42DRAFT_412561 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 3.041e-13
Identity = 32/69 (46.38%), Postives = 45/69 (65.22%), Query Frame = 1
Query:   16 SYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVMLSYD 222
            +Y+K TN LAG T ++DQ +RNFW     ++ EA+++ T HPA++L +   KG   PG DADLV L  D
Sbjct:  344 AYIKGTNTLAGSTVTIDQAVRNFWKFTRCTKVEALEAATLHPAQSLGIQDRKGTFTPGADADLVFLDDD 412          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Sea Lamprey
Match: amdhd2 (amidohydrolase domain containing 2 [Source:NCBI gene;Acc:402981])

HSP 1 Score: 51.6026 bits (122), Expect = 8.552e-10
Identity = 24/72 (33.33%), Postives = 43/72 (59.72%), Query Frame = 1
Query:    1 MKDFRSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVMLS 216
            ++   +YV  T  L+G   ++D C+R+   ++G S   A+++ + HPA+ L ++  KG L  G DAD V++S
Sbjct:  315 IEGLHAYVAGTKTLSGSIATMDMCVRHLRQASGCSVECALEAASLHPAQMLGISDRKGTLDYGTDADFVLVS 386          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Nematostella
Match: EDO38980 (N-acetylglucosamine-6-phosphate deacetylase [Source:UniProtKB/TrEMBL;Acc:A7SBC9])

HSP 1 Score: 59.3066 bits (142), Expect = 3.256e-12
Identity = 29/67 (43.28%), Postives = 40/67 (59.70%), Query Frame = 1
Query:   13 RSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            ++ +  TN LAG   SLD C++ F   +G S  EA++  T HPA+ L + H KG L  G DADL+ L
Sbjct:  309 KAVLAGTNTLAGSVASLDFCVQRFMEMSGCSMVEAIEGATLHPAQLLNIQHRKGTLDFGSDADLIFL 375          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Medaka
Match: amdhd2 (amidohydrolase domain containing 2 [Source:NCBI gene;Acc:101164646])

HSP 1 Score: 61.2326 bits (147), Expect = 1.844e-12
Identity = 28/71 (39.44%), Postives = 46/71 (64.79%), Query Frame = 1
Query:    1 MKDFRSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            ++   +YV  T  L+G   ++D C+R+F  ++G    EA+++ + HPA+AL ++H KG L  G DADLV+L
Sbjct:  315 IQGLHAYVAGTQTLSGSIATMDMCVRHFRQASGCKVEEALEAASLHPAQALGISHRKGRLDYGSDADLVLL 385          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Medaka
Match: amdhd2 (amidohydrolase domain containing 2 [Source:NCBI gene;Acc:101164646])

HSP 1 Score: 58.151 bits (139), Expect = 2.172e-11
Identity = 27/67 (40.30%), Postives = 44/67 (65.67%), Query Frame = 1
Query:   13 RSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVML 213
            R++   T  L+G   ++D C+R+F  ++G    EA+++ + HPA+AL ++H KG L  G DADLV+L
Sbjct:  283 RAHPSGTQTLSGSIATMDMCVRHFRQASGCKVEEALEAASLHPAQALGISHRKGRLDYGSDADLVLL 349          
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Planmine SMEST
Match: SMESG000067035.1 (SMESG000067035.1)

HSP 1 Score: 154.066 bits (388), Expect = 7.395e-47
Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   13 RSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVMLSYDSME 231
            +SYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVMLSYDSME
Sbjct:  325 KSYVKSTNILAGGTTSLDQCMRNFWISAGISRAEAVDSVTRHPAEALKLNHCKGILKPGFDADLVMLSYDSME 397          
The following BLAST results are available for this feature:
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
AMDHD27.624e-1039.44amidohydrolase domain containing 2 [Source:HGNC Sy... [more]
AMDHD21.732e-838.24amidohydrolase domain containing 2 [Source:HGNC Sy... [more]
AMDHD21.805e-838.24amidohydrolase domain containing 2 [Source:HGNC Sy... [more]
AMDHD21.837e-838.24amidohydrolase domain containing 2 [Source:HGNC Sy... [more]
back to top
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG170651.062e-935.21gene:FBgn0031099 transcript:FBtr0345924[more]
CG170651.062e-935.21gene:FBgn0031099 transcript:FBtr0077340[more]
CG170651.065e-935.21gene:FBgn0031099 transcript:FBtr0301568[more]
back to top
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
amdhd29.010e-1133.80amidohydrolase domain containing 2 [Source:NCBI ge... [more]
back to top
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
amdhd28.980e-1136.62amidohydrolase domain containing 2 [Source:NCBI ge... [more]
amdhd21.026e-1036.62amidohydrolase domain containing 2 [Source:NCBI ge... [more]
back to top
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Amdhd22.503e-937.88amidohydrolase domain containing 2 [Source:MGI Sym... [more]
Amdhd22.522e-937.88amidohydrolase domain containing 2 [Source:MGI Sym... [more]
Amdhd23.559e-736.07amidohydrolase domain containing 2 [Source:MGI Sym... [more]
back to top
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P0U0|NAGA_DANRE6.801e-1033.80N-acetylglucosamine-6-phosphate deacetylase OS=Dan... [more]
sp|A7MBC0|NAGA_BOVIN9.498e-1040.85N-acetylglucosamine-6-phosphate deacetylase OS=Bos... [more]
sp|Q9Y303|NAGA_HUMAN3.661e-939.44N-acetylglucosamine-6-phosphate deacetylase OS=Hom... [more]
sp|Q9VR81|NAGA_DROME1.065e-835.21N-acetylglucosamine-6-phosphate deacetylase OS=Dro... [more]
sp|Q5BJY6|NAGA_RAT1.305e-837.88N-acetylglucosamine-6-phosphate deacetylase OS=Rat... [more]
back to top
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2S2QXH34.265e-1447.89N-acetylglucosamine-6-phosphate deacetylase OS=Sip... [more]
A0A2P2IBP75.475e-1444.44N-acetylglucosamine-6-phosphate deacetylase OS=Hir... [more]
A0A1X2HN327.670e-1450.72N-acetylglucosamine-6-phosphate deacetylase OS=Syn... [more]
A0A168NXJ61.344e-1347.83Amidohydro-rel domain-containing protein OS=Absidi... [more]
A0A1X2IJV93.041e-1346.38N-acetylglucosamine-6-phosphate deacetylase OS=Abs... [more]
back to top
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
amdhd28.552e-1033.33amidohydrolase domain containing 2 [Source:NCBI ge... [more]
back to top
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO389803.256e-1243.28N-acetylglucosamine-6-phosphate deacetylase [Sour... [more]
back to top
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
amdhd21.844e-1239.44amidohydrolase domain containing 2 [Source:NCBI ge... [more]
amdhd22.172e-1140.30amidohydrolase domain containing 2 [Source:NCBI ge... [more]
back to top
BLAST of N-acetylglucosamine-6-phosphate deacetylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000067035.17.395e-4798.63SMESG000067035.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030834 ID=SMED30030834|Name=N-acetylglucosamine-6-phosphate deacetylase|organism=Schmidtea mediterranea sexual|type=transcript|length=231bp
ATGAAAGATTTCAGATCATATGTAAAAAGCACAAATATATTAGCGGGTGG
AACAACATCTCTTGATCAGTGCATGAGAAACTTTTGGATATCTGCAGGAA
TTAGTCGAGCGGAAGCTGTTGATTCTGTCACTCGACATCCAGCGGAAGCG
CTAAAACTTAATCATTGTAAAGGAATCCTGAAACCCGGTTTCGACGCTGA
TCTGGTGATGTTGAGCTACGATTCTATGGAG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0047419N-acetylgalactosamine-6-phosphate deacetylase activity
GO:0016810hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
GO:0008448N-acetylglucosamine-6-phosphate deacetylase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR011059Metal-dep_hydrolase_composite
IPR013108Amidohydro_3
IPR032466Metal_Hydrolase
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0006044N-acetylglucosamine metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013108Amidohydrolase 3PFAMPF07969Amidohydro_3coord: 26..75
e-value: 1.4E-9
score: 38.0
IPR011059Metal-dependent hydrolase, composite domain superfamilyGENE3DG3DSA:2.30.40.10coord: 56..75
e-value: 5.8E-8
score: 34.2
NoneNo IPR availableGENE3DG3DSA:3.20.20.140coord: 30..55
e-value: 5.8E-8
score: 34.2
NoneNo IPR availablePANTHERPTHR11113N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASEcoord: 3..73
IPR032466Metal-dependent hydrolaseSUPERFAMILYSSF51556Metallo-dependent hydrolasescoord: 9..58