ENTH domain-containing protein

Overview
NameENTH domain-containing protein
Smed IDSMED30030824
Length (bp)1818
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ENTH domain-containing protein (SMED30030824) t-SNE clustered cells

Violin plots show distribution of expression levels for ENTH domain-containing protein (SMED30030824) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ENTH domain-containing protein (SMED30030824) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ENTH domain-containing protein (SMED30030824) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of ENTH domain-containing protein vs. Ensembl Human
Match: CLINT1 (clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC:23186])

HSP 1 Score: 188.734 bits (478), Expect = 2.273e-51
Identity = 99/164 (60.37%), Postives = 123/164 (75.00%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHR 600
            +EL DK TN VMNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+   ++M MLW RM ++ K NWRR YKSLLLL+YL+RNGSER+V S +EHIYDLR LE+Y ++DE+GKDQGINIR K KEL+   +++ +L  ERKKA  N+ KY    S SV G R
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYVGVSSDSVGGFR 171          
BLAST of ENTH domain-containing protein vs. Ensembl Human
Match: CLINT1 (clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC:23186])

HSP 1 Score: 188.734 bits (478), Expect = 2.688e-51
Identity = 99/164 (60.37%), Postives = 123/164 (75.00%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHR 600
            +EL DK TN VMNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+   ++M MLW RM ++ K NWRR YKSLLLL+YL+RNGSER+V S +EHIYDLR LE+Y ++DE+GKDQGINIR K KEL+   +++ +L  ERKKA  N+ KY    S SV G R
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYVGVSSDSVGGFR 171          
BLAST of ENTH domain-containing protein vs. Ensembl Human
Match: CLINT1 (clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC:23186])

HSP 1 Score: 174.481 bits (441), Expect = 2.837e-46
Identity = 92/153 (60.13%), Postives = 115/153 (75.16%), Query Frame = 1
Query:  142 MNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHR 600
            MNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+   ++M MLW RM ++ K NWRR YKSLLLL+YL+RNGSER+V S +EHIYDLR LE+Y ++DE+GKDQGINIR K KEL+   +++ +L  ERKKA  N+ KY    S SV G R
Sbjct:    1 MNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYVGVSSDSVGGFR 153          
BLAST of ENTH domain-containing protein vs. Ensembl Human
Match: CLINT1 (clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC:23186])

HSP 1 Score: 174.481 bits (441), Expect = 2.837e-46
Identity = 92/153 (60.13%), Postives = 115/153 (75.16%), Query Frame = 1
Query:  142 MNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHR 600
            MNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+   ++M MLW RM ++ K NWRR YKSLLLL+YL+RNGSER+V S +EHIYDLR LE+Y ++DE+GKDQGINIR K KEL+   +++ +L  ERKKA  N+ KY    S SV G R
Sbjct:    1 MNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYVGVSSDSVGGFR 153          
BLAST of ENTH domain-containing protein vs. Ensembl Human
Match: EPN3 (epsin 3 [Source:HGNC Symbol;Acc:HGNC:18235])

HSP 1 Score: 143.28 bits (360), Expect = 9.060e-39
Identity = 87/204 (42.65%), Postives = 121/204 (59.31%), Query Frame = 1
Query:  115 LADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYK-AGI---SGSVNGHRRYWNSDDMKATERSTRERSCTPPSPSVNGSSRPPAKPP 714
            L  +V N V NY+E E KVR AT++DPWGP    M EIA+ T +    T+VMGMLWRR+    K NWR  YK+L LL YLL+ GSER+   C+E++Y ++ L+ +QYID +GKDQG+N+R K K+++ LL++E +L  ER  A   + +    GI   SG +   RRY   +D   +  S    +C  P+  V G     A  P
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNTVAFTEVMGMLWRRLNDSGK-NWRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQTLKDFQYIDRDGKDQGVNVREKVKQVMALLKDEERLRQERTHALKTKERMALEGIGIGSGQLGFSRRY--GEDYSRSRGSPSSYNC--PASDVRGRGTAAAAGP 204          
BLAST of ENTH domain-containing protein vs. Ensembl Celegans
Match: rsd-3 (pep chromosome:WBcel235:X:11798505:11803656:1 gene:WBGene00004682.1 transcript:C34E11.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rsd-3)

HSP 1 Score: 143.665 bits (361), Expect = 9.623e-37
Identity = 75/160 (46.88%), Postives = 110/160 (68.75%), Query Frame = 1
Query:  100 EMGKELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTK--HYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATS-NRSKYKA 570
            E  +++ + + +A+MNY +    VR ATN+DPWGP G  M++I E+T+  + +    V   L++RM +  K  WRR YKSL+LL YLL+NGSER V   +E  Y+LR LESY+YIDE GKDQGINIRH+ K+++ ++ ++  L  ER+KA S ++SKY+ 
Sbjct:   23 EYVRKVTESMNDAIMNYPKAMMDVREATNEDPWGPTGPQMKKICEYTRSRYMEDFYNVYTPLFQRMLENNKDAWRRVYKSLILLDYLLKNGSERFVQEAREKAYELRRLESYKYIDEKGKDQGINIRHRVKQILEMMNDDELLQAERQKANSDDKSKYRG 182          
BLAST of ENTH domain-containing protein vs. Ensembl Celegans
Match: epn-1 (EPsiN (Endocytic protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9BI72])

HSP 1 Score: 122.865 bits (307), Expect = 9.142e-30
Identity = 61/163 (37.42%), Postives = 104/163 (63.80%), Query Frame = 1
Query:  124 KVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRRYWN 612
            +V N   N+++ + KVR AT++DPWGP    M EIA+ T +    T++M ++W+R+    K NWR  YKSL+LL +L++ G E++   C+E+++ +  L+ +Q++++N +DQG+NIR K+K++  LL ++ +L NER +    R+K+K    G V    R  N
Sbjct:    9 QVKNVAYNFSDAQVKVREATSNDPWGPSTALMSEIADLTHNPMAFTEIMSIVWKRLNDSGK-NWRHVYKSLVLLDFLIKCGHEKVAQQCRENVFTIETLKDFQHVEDN-RDQGLNIREKAKQITSLLSDDERLKNERTRFILTRNKFKQNNPGPVGAESRRSN 169          
BLAST of ENTH domain-containing protein vs. Ensembl Celegans
Match: epn-1 (EPsiN (Endocytic protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9BI72])

HSP 1 Score: 122.865 bits (307), Expect = 9.714e-30
Identity = 61/163 (37.42%), Postives = 104/163 (63.80%), Query Frame = 1
Query:  124 KVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRRYWN 612
            +V N   N+++ + KVR AT++DPWGP    M EIA+ T +    T++M ++W+R+    K NWR  YKSL+LL +L++ G E++   C+E+++ +  L+ +Q++++N +DQG+NIR K+K++  LL ++ +L NER +    R+K+K    G V    R  N
Sbjct:    9 QVKNVAYNFSDAQVKVREATSNDPWGPSTALMSEIADLTHNPMAFTEIMSIVWKRLNDSGK-NWRHVYKSLVLLDFLIKCGHEKVAQQCRENVFTIETLKDFQHVEDN-RDQGLNIREKAKQITSLLSDDERLKNERTRFILTRNKFKQNNPGPVGAESRRSN 169          
BLAST of ENTH domain-containing protein vs. Ensembl Fly
Match: lqfR (gene:FBgn0261279 transcript:FBtr0299515)

HSP 1 Score: 196.438 bits (498), Expect = 2.061e-54
Identity = 104/164 (63.41%), Postives = 126/164 (76.83%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHR 600
            +ELADKVTN VMNYTE E KVR ATNDDPWGP G  MQE+A  T  Y+T  +VM MLW+RM Q+ K+NWRRTYKSLLLL+YL+RNGSER+V S +EHIYDLR LE+Y + DE GKDQGIN+RHK +ELI  ++++ +L  ERKKA  N+ KY  G+S    G R
Sbjct:   12 RELADKVTNVVMNYTETEGKVREATNDDPWGPTGPLMQELAYSTFSYETFPEVMSMLWKRMLQDNKTNWRRTYKSLLLLNYLVRNGSERVVTSSREHIYDLRSLENYTFTDEGGKDQGINVRHKVRELIDFIQDDDRLREERKKAKKNKDKY-IGMSSDAMGMR 174          
BLAST of ENTH domain-containing protein vs. Ensembl Fly
Match: lqfR (gene:FBgn0261279 transcript:FBtr0299516)

HSP 1 Score: 194.126 bits (492), Expect = 3.932e-52
Identity = 104/164 (63.41%), Postives = 126/164 (76.83%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHR 600
            +ELADKVTN VMNYTE E KVR ATNDDPWGP G  MQE+A  T  Y+T  +VM MLW+RM Q+ K+NWRRTYKSLLLL+YL+RNGSER+V S +EHIYDLR LE+Y + DE GKDQGIN+RHK +ELI  ++++ +L  ERKKA  N+ KY  G+S    G R
Sbjct:   12 RELADKVTNVVMNYTETEGKVREATNDDPWGPTGPLMQELAYSTFSYETFPEVMSMLWKRMLQDNKTNWRRTYKSLLLLNYLVRNGSERVVTSSREHIYDLRSLENYTFTDEGGKDQGINVRHKVRELIDFIQDDDRLREERKKAKKNKDKY-IGMSSDAMGMR 174          
BLAST of ENTH domain-containing protein vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0076796)

HSP 1 Score: 127.102 bits (318), Expect = 3.080e-30
Identity = 64/156 (41.03%), Postives = 101/156 (64.74%), Query Frame = 1
Query:  115 LADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISG 582
            L   + N   NY++ + KVR AT++DPWGP    M EIAE T +    +++M M+W+R+    K NWR  YK+L+LL YL++ GSE++   CKE+I+ ++ L  + Y +E GKDQG ++R K+K+L+ LL+++ +L NER KA   + ++    SG
Sbjct:    8 LRRNIKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRLNDHGK-NWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEE-GKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKERFAQNPSG 161          
BLAST of ENTH domain-containing protein vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0076794)

HSP 1 Score: 127.102 bits (318), Expect = 3.080e-30
Identity = 64/156 (41.03%), Postives = 101/156 (64.74%), Query Frame = 1
Query:  115 LADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISG 582
            L   + N   NY++ + KVR AT++DPWGP    M EIAE T +    +++M M+W+R+    K NWR  YK+L+LL YL++ GSE++   CKE+I+ ++ L  + Y +E GKDQG ++R K+K+L+ LL+++ +L NER KA   + ++    SG
Sbjct:    8 LRRNIKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRLNDHGK-NWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEE-GKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKERFAQNPSG 161          
BLAST of ENTH domain-containing protein vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0076798)

HSP 1 Score: 127.102 bits (318), Expect = 3.169e-30
Identity = 64/156 (41.03%), Postives = 101/156 (64.74%), Query Frame = 1
Query:  115 LADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISG 582
            L   + N   NY++ + KVR AT++DPWGP    M EIAE T +    +++M M+W+R+    K NWR  YK+L+LL YL++ GSE++   CKE+I+ ++ L  + Y +E GKDQG ++R K+K+L+ LL+++ +L NER KA   + ++    SG
Sbjct:   15 LRRNIKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRLNDHGK-NWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEE-GKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKERFAQNPSG 168          
BLAST of ENTH domain-containing protein vs. Ensembl Zebrafish
Match: clint1a (clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2590])

HSP 1 Score: 200.675 bits (509), Expect = 8.077e-56
Identity = 100/164 (60.98%), Postives = 122/164 (74.39%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHR 600
            +EL DK TN VMNYTE E+KVR ATNDDPWGP GQ M EIA  T  Y+   +VM MLW RM ++ K NWRR YKSLLLL+YL+RNGSER+V S +EH+YDLR +ESY  +DENGKDQG+N+R K KELI  ++++ +L  ERKKA  NR KY    S S++G R
Sbjct:    8 RELVDKATNVVMNYTETESKVREATNDDPWGPSGQLMGEIARCTFMYEQFPEVMNMLWTRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHLYDLRSIESYHCVDENGKDQGVNVRQKVKELIEFVQDDDRLREERKKAKKNRDKYIGVSSDSMSGFR 171          
BLAST of ENTH domain-containing protein vs. Ensembl Zebrafish
Match: clint1a (clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2590])

HSP 1 Score: 191.815 bits (486), Expect = 1.322e-52
Identity = 96/157 (61.15%), Postives = 117/157 (74.52%), Query Frame = 1
Query:  130 TNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHR 600
            TN VMNYTE E+KVR ATNDDPWGP GQ M EIA  T  Y+   +VM MLW RM ++ K NWRR YKSLLLL+YL+RNGSER+V S +EH+YDLR +ESY  +DENGKDQG+N+R K KELI  ++++ +L  ERKKA  NR KY    S S++G R
Sbjct:   26 TNVVMNYTETESKVREATNDDPWGPSGQLMGEIARCTFMYEQFPEVMNMLWTRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHLYDLRSIESYHCVDENGKDQGVNVRQKVKELIEFVQDDDRLREERKKAKKNRDKYIGVSSDSMSGFR 182          
BLAST of ENTH domain-containing protein vs. Ensembl Zebrafish
Match: clint1b (clathrin interactor 1b [Source:ZFIN;Acc:ZDB-GENE-111011-3])

HSP 1 Score: 169.474 bits (428), Expect = 7.861e-45
Identity = 92/160 (57.50%), Postives = 119/160 (74.38%), Query Frame = 1
Query:  142 MNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRRYWNSDD 621
            MNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+   +VM MLW RM ++ K NWRR YK+LLLL+YL+RNGSER+V S +EHIYDLR LE+Y ++DENGKDQGIN+R K KE++  ++++ +L  ERKKA  N+ KY  G+S    G  R  NS +
Sbjct:    1 MNYSEIESKVREATNDDPWGPSGQLMGEIAKSTFMYEQFPEVMNMLWTRMLKDNKKNWRRVYKALLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDENGKDQGINVRQKVKEMVEFVQDDDRLREERKKAKKNKDKY-IGVSSDNMGSSRQSNSGE 159          
BLAST of ENTH domain-containing protein vs. Ensembl Zebrafish
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 141.739 bits (356), Expect = 2.287e-35
Identity = 70/160 (43.75%), Postives = 109/160 (68.12%), Query Frame = 1
Query:  124 KVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRR 603
            ++ N V NY+E E KVR AT++DPWGP    M EIA+ T +    +++M M+W+R+    K NWR  YK+L LL YL++ GSER+ + CKE+I+ ++ L+ +QYID +GKDQGIN+R KSK+L+ LL+++ +L  ER +A   + +  A ++ SV  + +
Sbjct:    9 QMKNVVNNYSEPEKKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGK-NWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVVLLKDDDRLKGERSQALKTKERM-AQVATSVGSNNQ 166          
BLAST of ENTH domain-containing protein vs. Ensembl Zebrafish
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 140.969 bits (354), Expect = 2.480e-35
Identity = 70/160 (43.75%), Postives = 109/160 (68.12%), Query Frame = 1
Query:  124 KVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRR 603
            ++ N V NY+E E KVR AT++DPWGP    M EIA+ T +    +++M M+W+R+    K NWR  YK+L LL YL++ GSER+ + CKE+I+ ++ L+ +QYID +GKDQGIN+R KSK+L+ LL+++ +L  ER +A   + +  A ++ SV  + +
Sbjct:    9 QMKNVVNNYSEPEKKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGK-NWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVVLLKDDDRLKGERSQALKTKERM-AQVATSVGSNNQ 166          
BLAST of ENTH domain-containing protein vs. Ensembl Xenopus
Match: cyct (cytochrome c, testis [Source:Xenbase;Acc:XB-GENE-5931974])

HSP 1 Score: 188.734 bits (478), Expect = 2.229e-51
Identity = 98/166 (59.04%), Postives = 124/166 (74.70%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRRY 606
            +EL DK TN VMNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+    +M MLW RM ++ K NWRR YKS+LLL+YL+RNGSER+V S +EHIYDLR LE+Y ++DENGKDQGINIR K KE++  ++++ +L  ERKKA  N+ KY  G+S    G  RY
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPDLMNMLWTRMLKDNKKNWRRVYKSMLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDENGKDQGINIRQKVKEMVEFIQDDDRLREERKKAKKNKDKY-IGVSSESAGGFRY 172          
BLAST of ENTH domain-containing protein vs. Ensembl Xenopus
Match: cyct (cytochrome c, testis [Source:Xenbase;Acc:XB-GENE-5931974])

HSP 1 Score: 179.874 bits (455), Expect = 2.364e-48
Identity = 94/159 (59.12%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  130 TNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRRY 606
            TN VMNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+    +M MLW RM ++ K NWRR YKS+LLL+YL+RNGSER+V S +EHIYDLR LE+Y ++DENGKDQGINIR K KE++  ++++ +L  ERKKA  N+ KY  G+S    G  RY
Sbjct:   20 TNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPDLMNMLWTRMLKDNKKNWRRVYKSMLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDENGKDQGINIRQKVKEMVEFIQDDDRLREERKKAKKNKDKY-IGVSSESAGGFRY 177          
BLAST of ENTH domain-containing protein vs. Ensembl Xenopus
Match: cyct (cytochrome c, testis [Source:Xenbase;Acc:XB-GENE-5931974])

HSP 1 Score: 179.874 bits (455), Expect = 3.059e-48
Identity = 94/159 (59.12%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  130 TNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRRY 606
            TN VMNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+    +M MLW RM ++ K NWRR YKS+LLL+YL+RNGSER+V S +EHIYDLR LE+Y ++DENGKDQGINIR K KE++  ++++ +L  ERKKA  N+ KY  G+S    G  RY
Sbjct:   20 TNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPDLMNMLWTRMLKDNKKNWRRVYKSMLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDENGKDQGINIRQKVKEMVEFIQDDDRLREERKKAKKNKDKY-IGVSSESAGGFRY 177          
BLAST of ENTH domain-containing protein vs. Ensembl Xenopus
Match: uvssa (UV stimulated scaffold protein A [Source:Xenbase;Acc:XB-GENE-5833232])

HSP 1 Score: 142.124 bits (357), Expect = 3.570e-35
Identity = 65/150 (43.33%), Postives = 101/150 (67.33%), Query Frame = 1
Query:  115 LADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKY 564
            L  ++ N V NY+E E KVR AT++DPWGP    M EIA+ T +    +++M M+W+R+    K NWR  YK++ L+ YL++ GSER+   CKE+IY ++ L+ +QY+D +GKDQG+N+R K+K+L+ LL+++ +L  ER  A   + K 
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGK-NWRHVYKAMTLMEYLIKTGSERVAQQCKENIYAIQTLKDFQYVDRDGKDQGVNVREKAKQLVSLLKDDERLKEERAHALKTKEKL 154          
BLAST of ENTH domain-containing protein vs. Ensembl Xenopus
Match: uvssa (UV stimulated scaffold protein A [Source:Xenbase;Acc:XB-GENE-5833232])

HSP 1 Score: 141.739 bits (356), Expect = 4.301e-35
Identity = 65/150 (43.33%), Postives = 101/150 (67.33%), Query Frame = 1
Query:  115 LADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKY 564
            L  ++ N V NY+E E KVR AT++DPWGP    M EIA+ T +    +++M M+W+R+    K NWR  YK++ L+ YL++ GSER+   CKE+IY ++ L+ +QY+D +GKDQG+N+R K+K+L+ LL+++ +L  ER  A   + K 
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGK-NWRHVYKAMTLMEYLIKTGSERVAQQCKENIYAIQTLKDFQYVDRDGKDQGVNVREKAKQLVSLLKDDERLKEERAHALKTKEKL 154          
BLAST of ENTH domain-containing protein vs. Ensembl Mouse
Match: Clint1 (clathrin interactor 1 [Source:MGI Symbol;Acc:MGI:2144243])

HSP 1 Score: 187.963 bits (476), Expect = 2.542e-51
Identity = 99/164 (60.37%), Postives = 123/164 (75.00%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHR 600
            +EL DK TN VMNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+   ++M MLW RM ++ K NWRR YKSLLLL+YL+RNGSER+V S +EHIYDLR LE+Y ++DE+GKDQGINIR K KEL+   +++ +L  ERKKA  N+ KY    S SV G R
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYVGVSSDSVGGFR 171          
BLAST of ENTH domain-containing protein vs. Ensembl Mouse
Match: Clint1 (clathrin interactor 1 [Source:MGI Symbol;Acc:MGI:2144243])

HSP 1 Score: 187.963 bits (476), Expect = 3.387e-51
Identity = 99/164 (60.37%), Postives = 123/164 (75.00%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHR 600
            +EL DK TN VMNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+   ++M MLW RM ++ K NWRR YKSLLLL+YL+RNGSER+V S +EHIYDLR LE+Y ++DE+GKDQGINIR K KEL+   +++ +L  ERKKA  N+ KY    S SV G R
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYVGVSSDSVGGFR 171          
BLAST of ENTH domain-containing protein vs. Ensembl Mouse
Match: Epn3 (epsin 3 [Source:MGI Symbol;Acc:MGI:1919139])

HSP 1 Score: 142.51 bits (358), Expect = 2.268e-35
Identity = 73/164 (44.51%), Postives = 104/164 (63.41%), Query Frame = 1
Query:  115 LADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRRY 606
            L  +V N V NY+E E KVR AT++DPWGP    M EIA+ T +     +VMGM+WRR+    K NWR  YK+L LL YLL+ GSER+   C+E++Y ++ L+ +QYID +GKDQG+N+R K K+++ LL++E +L  ER  A   + +      G  +G   Y
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNTVAFAEVMGMVWRRLNDSGK-NWRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQTLKDFQYIDRDGKDQGVNVREKVKQVMALLKDEERLRQERTHALKTKERMALEGMGIGSGQLGY 168          
BLAST of ENTH domain-containing protein vs. Ensembl Mouse
Match: Epn2 (epsin 2 [Source:MGI Symbol;Acc:MGI:1333766])

HSP 1 Score: 140.198 bits (352), Expect = 8.883e-35
Identity = 68/153 (44.44%), Postives = 103/153 (67.32%), Query Frame = 1
Query:  124 KVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISG 582
            ++ N V NY+E E KVR AT++DPWGP    M EIA+ T +    +++M M+W+R+    K NWR  YK+L LL YL++ GSER+   C+E+I+ ++ L+ +QYID +GKDQGIN+R KSK+L+ LL++E +L  ER +A   + +     +G
Sbjct:    9 QMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGK-NWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATG 160          
BLAST of ENTH domain-containing protein vs. Ensembl Mouse
Match: Epn2 (epsin 2 [Source:MGI Symbol;Acc:MGI:1333766])

HSP 1 Score: 139.813 bits (351), Expect = 9.779e-35
Identity = 68/153 (44.44%), Postives = 103/153 (67.32%), Query Frame = 1
Query:  124 KVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISG 582
            ++ N V NY+E E KVR AT++DPWGP    M EIA+ T +    +++M M+W+R+    K NWR  YK+L LL YL++ GSER+   C+E+I+ ++ L+ +QYID +GKDQGIN+R KSK+L+ LL++E +L  ER +A   + +     +G
Sbjct:    9 QMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGK-NWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATG 160          
BLAST of ENTH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q14677|EPN4_HUMAN (Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 1.091e-50
Identity = 99/164 (60.37%), Postives = 123/164 (75.00%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHR 600
            +EL DK TN VMNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+   ++M MLW RM ++ K NWRR YKSLLLL+YL+RNGSER+V S +EHIYDLR LE+Y ++DE+GKDQGINIR K KEL+   +++ +L  ERKKA  N+ KY    S SV G R
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYVGVSSDSVGGFR 171          
BLAST of ENTH domain-containing protein vs. UniProt/SwissProt
Match: sp|A7Z035|EPN4_BOVIN (Clathrin interactor 1 OS=Bos taurus OX=9913 GN=CLINT1 PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.559e-50
Identity = 99/164 (60.37%), Postives = 123/164 (75.00%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHR 600
            +EL DK TN VMNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+   ++M MLW RM ++ K NWRR YKSLLLL+YL+RNGSER+V S +EHIYDLR LE+Y ++DE+GKDQGINIR K KEL+   +++ +L  ERKKA  N+ KY    S SV G R
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYVGVSSDSVGGFR 171          
BLAST of ENTH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99KN9|EPN4_MOUSE (Clathrin interactor 1 OS=Mus musculus OX=10090 GN=Clint1 PE=1 SV=2)

HSP 1 Score: 179.489 bits (454), Expect = 2.450e-47
Identity = 95/157 (60.51%), Postives = 118/157 (75.16%), Query Frame = 1
Query:  130 TNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHR 600
            TN VMNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+   ++M MLW RM ++ K NWRR YKSLLLL+YL+RNGSER+V S +EHIYDLR LE+Y ++DE+GKDQGINIR K KEL+   +++ +L  ERKKA  N+ KY    S SV G R
Sbjct:   23 TNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYVGVSSDSVGGFR 179          
BLAST of ENTH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9H201|EPN3_HUMAN (Epsin-3 OS=Homo sapiens OX=9606 GN=EPN3 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.086e-36
Identity = 79/168 (47.02%), Postives = 109/168 (64.88%), Query Frame = 1
Query:  115 LADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYK-AGI---SGSVNGHRRY 606
            L  +V N V NY+E E KVR AT++DPWGP    M EIA+ T +    T+VMGMLWRR+    K NWR  YK+L LL YLL+ GSER+   C+E++Y ++ L+ +QYID +GKDQG+N+R K K+++ LL++E +L  ER  A   + +    GI   SG +   RRY
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNTVAFTEVMGMLWRRLNDSGK-NWRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQTLKDFQYIDRDGKDQGVNVREKVKQVMALLKDEERLRQERTHALKTKERMALEGIGIGSGQLGFSRRY 172          
BLAST of ENTH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91W69|EPN3_MOUSE (Epsin-3 OS=Mus musculus OX=10090 GN=Epn3 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.586e-34
Identity = 73/164 (44.51%), Postives = 104/164 (63.41%), Query Frame = 1
Query:  115 LADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRRY 606
            L  +V N V NY+E E KVR AT++DPWGP    M EIA+ T +     +VMGM+WRR+    K NWR  YK+L LL YLL+ GSER+   C+E++Y ++ L+ +QYID +GKDQG+N+R K K+++ LL++E +L  ER  A   + +      G  +G   Y
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNTVAFAEVMGMVWRRLNDSGK-NWRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQTLKDFQYIDRDGKDQGVNVREKVKQVMALLKDEERLRQERTHALKTKERMALEGMGIGSGQLGY 168          
BLAST of ENTH domain-containing protein vs. TrEMBL
Match: A0A1I8IYT0 (ENTH domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 6.154e-58
Identity = 103/161 (63.98%), Postives = 128/161 (79.50%), Query Frame = 1
Query:   82 MLREVFEMGKELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKY 564
            MLREVF  GK+LA+KVTN VMNYTE+E KVR ATND+ WGPHG+ MQE+A  T  Y+   +VMGMLW+RM  + K NWRR YKSLLLL+YL+R+GSER+V S +EHIYDLR LESYQ++DE GKD+GINIRHK+ EL+  ++++ +L  ERK A  NR KY
Sbjct:    1 MLREVFSKGKDLAEKVTNVVMNYTELEGKVREATNDEAWGPHGEVMQELANATMSYEQFPEVMGMLWKRMLFDNKRNWRRVYKSLLLLTYLIRHGSERVVTSAREHIYDLRGLESYQFVDERGKDEGINIRHKAHELVEFIQDDDKLREERKAARKNRDKY 161          
BLAST of ENTH domain-containing protein vs. TrEMBL
Match: A0A3M7SRR7 (Clathrin interactor 1-like (Fragment) OS=Brachionus plicatilis OX=10195 GN=BpHYR1_041562 PE=4 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 2.248e-57
Identity = 103/162 (63.58%), Postives = 128/162 (79.01%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNG 594
            KEL DKVTN VMNYTEVE KVR ATND+ WGPHG  MQEIA++T  Y+  ++VMGMLW+RMFQE K NWR  YKSLLLL+YLL+NGSE+ V S +EH+YDLR LE++ Y+DENGKDQGIN+R K KE+I L++++ ++  ERKKA  NR K+ +G S S  G
Sbjct:   14 KELKDKVTNVVMNYTEVEVKVREATNDEAWGPHGTLMQEIAQYTLTYEHYSEVMGMLWKRMFQENKENWRIAYKSLLLLTYLLKNGSEKCVTSAREHLYDLRSLETFAYVDENGKDQGINVRIKVKEIIELVQDDERIREERKKAKKNREKF-SGYSTSSMG 174          
BLAST of ENTH domain-containing protein vs. TrEMBL
Match: A0A267E6W1 (ENTH domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034596g1 PE=4 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 2.420e-57
Identity = 103/161 (63.98%), Postives = 128/161 (79.50%), Query Frame = 1
Query:   82 MLREVFEMGKELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKY 564
            MLREVF  GK+LA+KVTN VMNYTE+E KVR ATND+ WGPHG+ MQE+A  T  Y+   +VMGMLW+RM  + K NWRR YKSLLLL+YL+R+GSER+V S +EHIYDLR LESYQ++DE GKD+GINIRHK+ EL+  ++++ +L  ERK A  NR KY
Sbjct:    1 MLREVFSKGKDLAEKVTNVVMNYTELEGKVREATNDEAWGPHGEVMQELANATMSYEQFPEVMGMLWKRMLFDNKRNWRRVYKSLLLLTYLIRHGSERVVTSAREHIYDLRGLESYQFVDERGKDEGINIRHKAHELVEFIQDDDKLREERKAARKNRDKY 161          
BLAST of ENTH domain-containing protein vs. TrEMBL
Match: A7RIC8 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g82777 PE=4 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 5.070e-55
Identity = 100/171 (58.48%), Postives = 131/171 (76.61%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGS--VNGHRRYWNS 615
            +E++DKVTN VMNY+EVEAKVR ATNDD WGPHG  MQEIA++T  Y+   +VM MLW+RM QE K  WRR YKSLLLL YLL+NGS+R+V + ++HIYD+R LE++ + DENGKDQGIN+RHK KELI L++++ ++ +ERK+A  NR KY  G+S     + H   WN+
Sbjct:    8 REISDKVTNVVMNYSEVEAKVREATNDDTWGPHGSLMQEIAKYTFTYEHFPEVMSMLWKRMLQEPKKYWRRIYKSLLLLGYLLKNGSDRVVTNARDHIYDMRQLENFHHTDENGKDQGINVRHKVKELIELVQDDDRIRSERKRAKKNRDKY-TGVSSENYRDSHYSKWNN 177          
BLAST of ENTH domain-containing protein vs. TrEMBL
Match: K1Q680 (Clathrin interactor 1 OS=Crassostrea gigas OX=29159 GN=CGI_10022178 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 2.212e-54
Identity = 102/158 (64.56%), Postives = 125/158 (79.11%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISG 582
            +E+ DKVTN VMNYTEVE KVR ATNDD WGPHGQ MQEIA +T  Y+   +VMGMLW+RM  + K NWRRTYKSLLLL+YL+RNGSE+ V SC+EH+YDLR LESY + DE GKDQG+N+R K+KEL+  ++++ +L  ERKKA  NR KY  G+SG
Sbjct:    5 REITDKVTNVVMNYTEVETKVREATNDDAWGPHGQIMQEIARYTFTYEHFPEVMGMLWKRMLHDNKKNWRRTYKSLLLLAYLVRNGSEKSVTSCREHLYDLRGLESYTFTDELGKDQGLNVRTKAKELVDFIQDDERLREERKKAKKNRDKY-IGMSG 161          
BLAST of ENTH domain-containing protein vs. Ensembl Cavefish
Match: clint1a (clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2590])

HSP 1 Score: 189.889 bits (481), Expect = 4.479e-52
Identity = 96/167 (57.49%), Postives = 123/167 (73.65%), Query Frame = 1
Query:  130 TNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRRYWNSDDMKA 630
            TN VMNYTE+E+KVR ATNDDPWGP GQ M EIA+ T  Y+   +VM MLW RM ++ K NWRR YKSLLLL+YL+RNGSER+V S +EH+YDLR +ESY  IDENGKDQG+N+R K KE++  ++++ +L  ERKKA  NR KY  G+S    G  +Y +  D ++
Sbjct:   21 TNVVMNYTEMESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPEVMNMLWYRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHLYDLRSIESYHCIDENGKDQGVNVRQKVKEMVEFVQDDDRLREERKKAKKNRDKY-IGVSSDSMGGFKYGDKYDSRS 186          
BLAST of ENTH domain-containing protein vs. Ensembl Cavefish
Match: epn3a (epsin 3 [Source:NCBI gene;Acc:103029089])

HSP 1 Score: 147.517 bits (371), Expect = 2.866e-37
Identity = 77/158 (48.73%), Postives = 105/158 (66.46%), Query Frame = 1
Query:  115 LADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSV 588
            L   V N V NYTE E KVR AT++DPWGP    M EIA+ T +    T+VMGM+W+R+    K NWR  YK+L LL YLL+ GSER+   C+E+IY ++ L  +QYID +G+DQG+N+R K+K+L+ LL +E +L  ER +A   R +  AG  GS+
Sbjct:    6 LRRSVKNIVNNYTEAEIKVREATSNDPWGPPSSLMMEIADLTFNVVAFTEVMGMVWKRLNDHGK-NWRHVYKALTLLEYLLKAGSERVAQQCRENIYAIQTLRDFQYIDRDGQDQGVNVREKAKQLVSLLRDEDRLKQERSQAHKTRERM-AGAYGSL 161          
BLAST of ENTH domain-containing protein vs. Ensembl Cavefish
Match: epn3a (epsin 3 [Source:NCBI gene;Acc:103029089])

HSP 1 Score: 147.517 bits (371), Expect = 3.428e-37
Identity = 77/158 (48.73%), Postives = 105/158 (66.46%), Query Frame = 1
Query:  115 LADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSV 588
            L   V N V NYTE E KVR AT++DPWGP    M EIA+ T +    T+VMGM+W+R+    K NWR  YK+L LL YLL+ GSER+   C+E+IY ++ L  +QYID +G+DQG+N+R K+K+L+ LL +E +L  ER +A   R +  AG  GS+
Sbjct:    6 LRRSVKNIVNNYTEAEIKVREATSNDPWGPPSSLMMEIADLTFNVVAFTEVMGMVWKRLNDHGK-NWRHVYKALTLLEYLLKAGSERVAQQCRENIYAIQTLRDFQYIDRDGQDQGVNVREKAKQLVSLLRDEDRLKQERSQAHKTRERM-AGAYGSL 161          
BLAST of ENTH domain-containing protein vs. Ensembl Cavefish
Match: epn3a (epsin 3 [Source:NCBI gene;Acc:103029089])

HSP 1 Score: 147.517 bits (371), Expect = 3.428e-37
Identity = 77/158 (48.73%), Postives = 105/158 (66.46%), Query Frame = 1
Query:  115 LADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSV 588
            L   V N V NYTE E KVR AT++DPWGP    M EIA+ T +    T+VMGM+W+R+    K NWR  YK+L LL YLL+ GSER+   C+E+IY ++ L  +QYID +G+DQG+N+R K+K+L+ LL +E +L  ER +A   R +  AG  GS+
Sbjct:    6 LRRSVKNIVNNYTEAEIKVREATSNDPWGPPSSLMMEIADLTFNVVAFTEVMGMVWKRLNDHGK-NWRHVYKALTLLEYLLKAGSERVAQQCRENIYAIQTLRDFQYIDRDGQDQGVNVREKAKQLVSLLRDEDRLKQERSQAHKTRERM-AGAYGSL 161          
BLAST of ENTH domain-containing protein vs. Ensembl Cavefish
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 141.739 bits (356), Expect = 1.216e-35
Identity = 68/160 (42.50%), Postives = 109/160 (68.12%), Query Frame = 1
Query:  124 KVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRR 603
            ++ N V NY+E E KVR AT++DPWGP    M EI++ T +    +++M M+W+R+  +   NWR  YK+L LL YL++ GSER+ + CKE+I+ ++ L+ +QYID +GKDQGIN+R KSK+L+ LL+++ +L  ER +A   + +  A ++ SV  + +
Sbjct:    9 QMKNVVNNYSEAEKKVREATSNDPWGPSSSLMSEISDLTYNVVAFSEIMSMIWKRL-NDHGKNWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVVLLKDDDRLKGERSQALKTKERM-AQVATSVGSNHQ 166          
BLAST of ENTH domain-containing protein vs. Ensembl Sea Lamprey
Match: clint1a (clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2590])

HSP 1 Score: 188.348 bits (477), Expect = 4.248e-52
Identity = 95/170 (55.88%), Postives = 124/170 (72.94%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRRYWNSD 618
            K L D  TN VMNYTE+EAKVR ATND+PWGP G+ M EIA+ T  Y+   +VM MLW RM +E K+NWRR YK LLLL+YLLRNGSER+V S +EH+YDLR LE Y ++DENGKDQG+N+R K KE+I  ++++ ++  ERKKA  +R KY    S +  G+   ++S+
Sbjct:    7 KALVDLKTNIVMNYTEMEAKVREATNDEPWGPSGKLMGEIAKATFMYELFPEVMNMLWARMLRENKNNWRRAYKGLLLLTYLLRNGSERVVTSAREHLYDLRSLEDYHFVDENGKDQGVNVRQKVKEMIDFVQDDERVREERKKAKKHRDKYIGVSSDTRFGYNDRYDSE 176          
BLAST of ENTH domain-containing protein vs. Ensembl Sea Lamprey
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 143.28 bits (360), Expect = 1.326e-36
Identity = 68/156 (43.59%), Postives = 104/156 (66.67%), Query Frame = 1
Query:  115 LADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISG 582
            L  ++ N V N++E E KVR AT++DPWGP    M EIA+ T +    +++M M+W+R+    K NWR  YK+L LL YL++ GSER+   CKE+I+ ++ L+ +QY+D +GKDQG+N+R KSK+L+ LL +E +L  ER+ A   + +   G +G
Sbjct:    6 LRRQMKNIVNNFSEAEVKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGK-NWRHVYKALTLLDYLIKTGSERVAQQCKENIFAIQTLKDFQYVDRDGKDQGVNVREKSKQLVALLRDEDRLRGEREHALKTKERLAQGATG 160          
BLAST of ENTH domain-containing protein vs. Ensembl Yeast
Match: ENT3 (Protein containing an N-terminal epsin-like domain; involved in clathrin recruitment and traffic between the Golgi and endosomes; associates with the clathrin adaptor Gga2p [Source:SGD;Acc:S000003886])

HSP 1 Score: 131.724 bits (330), Expect = 8.781e-34
Identity = 70/165 (42.42%), Postives = 106/165 (64.24%), Query Frame = 1
Query:  106 GKELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYK--AGISGSVNG 594
             K+   K  N V NYTE+E KVR ATN++PWG     M +I++ T ++    +++ M++RR  ++  S WR+ YK+L LL YL+++GSER +   +  I  +R+LE++ YID  G+DQGIN+R + K LI LL +++++  ERKKA     KYK  AG S S +G
Sbjct:   15 AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGINVRTRVKALIELLSDDNKIRAERKKARETAKKYKGVAGGSASADG 179          
BLAST of ENTH domain-containing protein vs. Ensembl Yeast
Match: ENT1 (Epsin-like protein involved in endocytosis and actin patch assembly; functionally redundant with Ent2p; binds clathrin via a clathrin-binding domain motif at C-terminus; relocalizes from bud neck to cytoplasm upon DNA replication stress; ENT1 has a paralog, ENT2, that arose from the whole genome duplication [Source:SGD;Acc:S000002320])

HSP 1 Score: 77.0258 bits (188), Expect = 1.698e-15
Identity = 50/146 (34.25%), Postives = 85/146 (58.22%), Query Frame = 1
Query:  103 MGKELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDT--LTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNER 534
            M K+      N V  Y+  +  VR AT++D        + E+AE  K YD+    ++M ML +R+  ++   WR   K+L ++ YL+R GSE  V+ C+E++Y ++ L+ +++ D+ G DQG  +R K+KEL  LL ++ +L+ ER
Sbjct:    1 MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAE--KSYDSADFFEIMDMLDKRL-NDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRVKAKELTALLSDDERLNEER 143          
BLAST of ENTH domain-containing protein vs. Ensembl Yeast
Match: ENT2 (Epsin-like protein required for endocytosis and actin patch assembly; functionally redundant with Ent1p; contains clathrin-binding motif at C-terminus; ENT2 has a paralog, ENT1, that arose from the whole genome duplication [Source:SGD;Acc:S000004196])

HSP 1 Score: 75.8702 bits (185), Expect = 6.019e-15
Identity = 50/146 (34.25%), Postives = 85/146 (58.22%), Query Frame = 1
Query:  103 MGKELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLT--QVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNER 534
            M K+      N +  Y+  +  VR AT +D   P    + ++A+  + YD++   ++M ML +R+  ++   WR   KSL +L YL+R GSE  V+ C+E+ Y ++ L  +++ +E+G D+G  IR K+KEL+ LL +E +L  ER
Sbjct:    1 MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQ--RSYDSVDFFEIMDMLDKRL-NDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKELVSLLNDEERLREER 143          
BLAST of ENTH domain-containing protein vs. Ensembl Nematostella
Match: EDO48788 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIC8])

HSP 1 Score: 194.512 bits (493), Expect = 6.866e-59
Identity = 100/171 (58.48%), Postives = 131/171 (76.61%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGS--VNGHRRYWNS 615
            +E++DKVTN VMNY+EVEAKVR ATNDD WGPHG  MQEIA++T  Y+   +VM MLW+RM QE K  WRR YKSLLLL YLL+NGS+R+V + ++HIYD+R LE++ + DENGKDQGIN+RHK KELI L++++ ++ +ERK+A  NR KY  G+S     + H   WN+
Sbjct:    8 REISDKVTNVVMNYSEVEAKVREATNDDTWGPHGSLMQEIAKYTFTYEHFPEVMSMLWKRMLQEPKKYWRRIYKSLLLLGYLLKNGSDRVVTNARDHIYDMRQLENFHHTDENGKDQGINVRHKVKELIELVQDDDRIRSERKRAKKNRDKY-TGVSSENYRDSHYSKWNN 177          
BLAST of ENTH domain-containing protein vs. Ensembl Nematostella
Match: EDO36992 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH59])

HSP 1 Score: 133.65 bits (335), Expect = 1.159e-36
Identity = 63/147 (42.86%), Postives = 105/147 (71.43%), Query Frame = 1
Query:  124 KVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKY 564
            ++ N V NY+  E KVR AT++DPWGP    M EIA+ T +    +++M M+WRR+  +   NWR  YKSL+LL Y+++ GSER+   C+E+I+ ++ L+ +Q+ID++GKDQG+N+R K+K+L+ LL++E +L +ER++A   + ++
Sbjct:    6 QLKNVVNNYSNSEVKVREATSNDPWGPSSSLMSEIADATYNVVAFSEIMAMIWRRL-NDHGKNWRHVYKSLVLLDYIIKTGSERVAQQCRENIFVIQTLKDFQFIDKDGKDQGMNVREKAKQLVALLKDEERLKSERQRALKAKERF 151          
BLAST of ENTH domain-containing protein vs. Ensembl Medaka
Match: clint1a (clathrin interactor 1 [Source:NCBI gene;Acc:101169791])

HSP 1 Score: 190.66 bits (483), Expect = 1.175e-52
Identity = 98/166 (59.04%), Postives = 125/166 (75.30%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRRY 606
            +EL DK TN VMNY+EVE+KVR ATNDDPWGP GQ M EI+  T  Y+   +VM MLW RM ++ K NWRR YKSLLLL++L+RNGSER+V S +EH+YDLR LESY ++DENGKDQGIN+R K KE++  ++++ +L  ERKKA  N+ KY  G+S    G+R Y
Sbjct:    8 RELVDKATNVVMNYSEVESKVREATNDDPWGPSGQMMTEISRATFMYEQFPEVMNMLWARMLRDNKKNWRRVYKSLLLLAHLIRNGSERVVTSAREHLYDLRSLESYHFVDENGKDQGINVRQKVKEMVDFIQDDDRLREERKKAKKNKDKY-IGVSSDSMGYRGY 172          
BLAST of ENTH domain-containing protein vs. Ensembl Medaka
Match: CLINT1 (clathrin interactor 1 [Source:NCBI gene;Acc:101160502])

HSP 1 Score: 180.644 bits (457), Expect = 1.380e-48
Identity = 94/152 (61.84%), Postives = 119/152 (78.29%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKY 564
            +EL DK TN VMNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+   +VM MLW RM ++ K NWRR YK+LLLL+YL+RNGSER+V S +EHIYDLR LE+Y +IDENGKDQGIN+R K KE++  ++++ +L  ERKKA  N+ KY
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKSTFMYEQFPEVMNMLWTRMLKDNKKNWRRVYKALLLLAYLIRNGSERVVTSSREHIYDLRSLENYNFIDENGKDQGINVRQKVKEMVEFIQDDDRLREERKKAKKNKDKY 159          
BLAST of ENTH domain-containing protein vs. Ensembl Medaka
Match: CLINT1 (clathrin interactor 1 [Source:NCBI gene;Acc:101160502])

HSP 1 Score: 179.874 bits (455), Expect = 1.411e-48
Identity = 94/152 (61.84%), Postives = 119/152 (78.29%), Query Frame = 1
Query:  109 KELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKY 564
            +EL DK TN VMNY+E+E+KVR ATNDDPWGP GQ M EIA+ T  Y+   +VM MLW RM ++ K NWRR YK+LLLL+YL+RNGSER+V S +EHIYDLR LE+Y +IDENGKDQGIN+R K KE++  ++++ +L  ERKKA  N+ KY
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKSTFMYEQFPEVMNMLWTRMLKDNKKNWRRVYKALLLLAYLIRNGSERVVTSSREHIYDLRSLENYNFIDENGKDQGINVRQKVKEMVEFIQDDDRLREERKKAKKNKDKY 159          
BLAST of ENTH domain-containing protein vs. Ensembl Medaka
Match: epn2 (epsin 2 [Source:NCBI gene;Acc:101161060])

HSP 1 Score: 141.739 bits (356), Expect = 2.021e-35
Identity = 67/154 (43.51%), Postives = 105/154 (68.18%), Query Frame = 1
Query:  124 KVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGS 585
            ++ N V NY++ E KVR AT++DPWGP    M E+A+ T +    +++M M+W+R+    K NWR  YK+L LL YL++ GSER+ + CKE+I+ ++ L+ +QY+D +GKDQGIN+R KSK+L+ LL++E +L  ER +A   + +     +GS
Sbjct:    8 QMKNMVNNYSDAEKKVREATSNDPWGPSSSLMSEVADLTYNVVAFSEIMNMIWKRLNDHGK-NWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYVDRDGKDQGINVREKSKQLVVLLKDEERLKAERSQALKTKERMAQVSTGS 160          
BLAST of ENTH domain-containing protein vs. Ensembl Medaka
Match: epn1 (epsin-1 [Source:NCBI gene;Acc:101167232])

HSP 1 Score: 140.969 bits (354), Expect = 4.245e-35
Identity = 67/149 (44.97%), Postives = 101/149 (67.79%), Query Frame = 1
Query:  115 LADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSK 561
            L  +V N V NY+E E KVR AT++DPWGP    M EIA+ T +    +++M M+W+R+    K NWR  YK++ L+ YL++ GSER+   C+E+IY ++ L+ +QYID +GKDQG+N+R K+K+L+ LL++E +L  ER  A   + K
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGK-NWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGLNVREKAKQLVTLLKDEEKLREERIHALKTKEK 153          
BLAST of ENTH domain-containing protein vs. Planmine SMEST
Match: SMESG000019746.1 (SMESG000019746.1)

HSP 1 Score: 866.685 bits (2238), Expect = 0.000e+0
Identity = 473/476 (99.37%), Postives = 473/476 (99.37%), Query Frame = 1
Query:   82 MLREVFEMGKELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRRYWNSDDMKATERSTRERSCTPPSPSVNGSSRPPAKPPVDLKPVAVVSKPAEPIADLLDLNVPMADSTNLPPLNHCANNAADTSFDPFNLGNEHREFXXXXXXXXXXXXXXXXXXRYSDDFDSFVSAAPPVPLPTSNLADLDLVFGNFXXXXXXXXXXXXPVALGTTGRPTLITQTPMTPKAISVATDNGKSDKMIIGSTWSDVGGINISLDLLSNRGQKATHSVTSSKSXXXXXXXXVFNSNNDSNKIYSNSRKQPFDSPKNHPHQSRNVAANEKLSNANVSFGQVNHSSANQFVAFNDLLQ 1509
            MLREVFEMGKELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKSLLLLSYLLRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRRYWNSDDMKATERSTRERSCTPPSPSVNGSSRPPAKPPVDLKPVAVVSKPAEPIADLLDLNVPMADSTNLPPLNHCANNAADTSFDPFNLGNEHREFTVPPVPSNPTSPTSPCNPRYSDDFDSFVSAA PVPLPTSNLADLDLVFGNFIDSSSNNDISNNPVALGTTGRPTLITQTPMTP AI VATDNGKSDKMIIGSTWSDVGGINISLDLLSNRGQKATHSVTSSKSLNQLQQQNVFNSNNDSNKIYSNSRKQPFDSPKNHPHQSRNVAANEKLSNANVSFGQVNHSSANQFVAFNDLLQ
Sbjct:    1 MLREVFEMGKELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKSLLLLSYLLRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISGSVNGHRRYWNSDDMKATERSTRERSCTPPSPSVNGSSRPPAKPPVDLKPVAVVSKPAEPIADLLDLNVPMADSTNLPPLNHCANNAADTSFDPFNLGNEHREFTVPPVPSNPTSPTSPCNPRYSDDFDSFVSAALPVPLPTSNLADLDLVFGNFIDSSSNNDISNNPVALGTTGRPTLITQTPMTPNAIPVATDNGKSDKMIIGSTWSDVGGINISLDLLSNRGQKATHSVTSSKSLNQLQQQNVFNSNNDSNKIYSNSRKQPFDSPKNHPHQSRNVAANEKLSNANVSFGQVNHSSANQFVAFNDLLQ 476          
BLAST of ENTH domain-containing protein vs. Planmine SMEST
Match: SMESG000032527.1 (SMESG000032527.1)

HSP 1 Score: 131.339 bits (329), Expect = 1.071e-32
Identity = 73/156 (46.79%), Postives = 105/156 (67.31%), Query Frame = 1
Query:   82 MLREVFEMGKELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATS 549
            ML  V   GK++A+K+TN  +N +E+E K++ ATNDD WGP+G  M+EIA+ T     L +VM  LW R+F E+  N RRTYK L+LL+YL+ NGSE I  SC+ H+ D++ L+S  YID +G    + IR K+ ++  LL +  +LS+ERK+A S
Sbjct:    1 MLSNVINAGKDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQS--YIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKS 153          
BLAST of ENTH domain-containing protein vs. Planmine SMEST
Match: SMESG000032527.1 (SMESG000032527.1)

HSP 1 Score: 131.339 bits (329), Expect = 1.075e-32
Identity = 73/156 (46.79%), Postives = 105/156 (67.31%), Query Frame = 1
Query:   82 MLREVFEMGKELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATS 549
            ML  V   GK++A+K+TN  +N +E+E K++ ATNDD WGP+G  M+EIA+ T     L +VM  LW R+F E+  N RRTYK L+LL+YL+ NGSE I  SC+ H+ D++ L+S  YID +G    + IR K+ ++  LL +  +LS+ERK+A S
Sbjct:    1 MLSNVINAGKDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQS--YIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKS 153          
BLAST of ENTH domain-containing protein vs. Planmine SMEST
Match: SMESG000042233.1 (SMESG000042233.1)

HSP 1 Score: 119.398 bits (298), Expect = 3.934e-28
Identity = 68/165 (41.21%), Postives = 102/165 (61.82%), Query Frame = 1
Query:  112 ELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISG-SVNGHRR 603
            E+  KV N V  Y+E E  VR AT++DPWGP    M EIA+ T  Y     +M ++W+R+  ++  NWR  YKSL+LL YL++ G+ERI   C ++I+ +  L+ +QY +E+ KD G+ IR KSK L+ LL+++  L+NER K    + K++   S    + HRR
Sbjct:    2 EIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRL-NDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEH-KDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRR 164          
BLAST of ENTH domain-containing protein vs. Planmine SMEST
Match: SMESG000042233.1 (SMESG000042233.1)

HSP 1 Score: 119.013 bits (297), Expect = 4.204e-28
Identity = 68/165 (41.21%), Postives = 102/165 (61.82%), Query Frame = 1
Query:  112 ELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKXXXXXXXXXRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATSNRSKYKAGISG-SVNGHRR 603
            E+  KV N V  Y+E E  VR AT++DPWGP    M EIA+ T  Y     +M ++W+R+  ++  NWR  YKSL+LL YL++ G+ERI   C ++I+ +  L+ +QY +E+ KD G+ IR KSK L+ LL+++  L+NER K    + K++   S    + HRR
Sbjct:    2 EIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRL-NDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEH-KDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRR 164          
The following BLAST results are available for this feature:
BLAST of ENTH domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLINT12.273e-5160.37clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC... [more]
CLINT12.688e-5160.37clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC... [more]
CLINT12.837e-4660.13clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC... [more]
CLINT12.837e-4660.13clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC... [more]
EPN39.060e-3942.65epsin 3 [Source:HGNC Symbol;Acc:HGNC:18235][more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rsd-39.623e-3746.88pep chromosome:WBcel235:X:11798505:11803656:1 gene... [more]
epn-19.142e-3037.42EPsiN (Endocytic protein) homolog [Source:UniProt... [more]
epn-19.714e-3037.42EPsiN (Endocytic protein) homolog [Source:UniProt... [more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lqfR2.061e-5463.41gene:FBgn0261279 transcript:FBtr0299515[more]
lqfR3.932e-5263.41gene:FBgn0261279 transcript:FBtr0299516[more]
lqf3.080e-3041.03gene:FBgn0028582 transcript:FBtr0076796[more]
lqf3.080e-3041.03gene:FBgn0028582 transcript:FBtr0076794[more]
lqf3.169e-3041.03gene:FBgn0028582 transcript:FBtr0076798[more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clint1a8.077e-5660.98clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
clint1a1.322e-5261.15clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
clint1b7.861e-4557.50clathrin interactor 1b [Source:ZFIN;Acc:ZDB-GENE-1... [more]
epn22.287e-3543.75epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
epn22.480e-3543.75epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyct2.229e-5159.04cytochrome c, testis [Source:Xenbase;Acc:XB-GENE-5... [more]
cyct2.364e-4859.12cytochrome c, testis [Source:Xenbase;Acc:XB-GENE-5... [more]
cyct3.059e-4859.12cytochrome c, testis [Source:Xenbase;Acc:XB-GENE-5... [more]
uvssa3.570e-3543.33UV stimulated scaffold protein A [Source:Xenbase;A... [more]
uvssa4.301e-3543.33UV stimulated scaffold protein A [Source:Xenbase;A... [more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Clint12.542e-5160.37clathrin interactor 1 [Source:MGI Symbol;Acc:MGI:2... [more]
Clint13.387e-5160.37clathrin interactor 1 [Source:MGI Symbol;Acc:MGI:2... [more]
Epn32.268e-3544.51epsin 3 [Source:MGI Symbol;Acc:MGI:1919139][more]
Epn28.883e-3544.44epsin 2 [Source:MGI Symbol;Acc:MGI:1333766][more]
Epn29.779e-3544.44epsin 2 [Source:MGI Symbol;Acc:MGI:1333766][more]
back to top
BLAST of ENTH domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14677|EPN4_HUMAN1.091e-5060.37Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=C... [more]
sp|A7Z035|EPN4_BOVIN1.559e-5060.37Clathrin interactor 1 OS=Bos taurus OX=9913 GN=CLI... [more]
sp|Q99KN9|EPN4_MOUSE2.450e-4760.51Clathrin interactor 1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q9H201|EPN3_HUMAN3.086e-3647.02Epsin-3 OS=Homo sapiens OX=9606 GN=EPN3 PE=2 SV=1[more]
sp|Q91W69|EPN3_MOUSE1.586e-3444.51Epsin-3 OS=Mus musculus OX=10090 GN=Epn3 PE=1 SV=1[more]
back to top
BLAST of ENTH domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IYT06.154e-5863.98ENTH domain-containing protein OS=Macrostomum lign... [more]
A0A3M7SRR72.248e-5763.58Clathrin interactor 1-like (Fragment) OS=Brachionu... [more]
A0A267E6W12.420e-5763.98ENTH domain-containing protein OS=Macrostomum lign... [more]
A7RIC85.070e-5558.48Predicted protein (Fragment) OS=Nematostella vecte... [more]
K1Q6802.212e-5464.56Clathrin interactor 1 OS=Crassostrea gigas OX=2915... [more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clint1a4.479e-5257.49clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
epn3a2.866e-3748.73epsin 3 [Source:NCBI gene;Acc:103029089][more]
epn3a3.428e-3748.73epsin 3 [Source:NCBI gene;Acc:103029089][more]
epn3a3.428e-3748.73epsin 3 [Source:NCBI gene;Acc:103029089][more]
epn21.216e-3542.50epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
clint1a4.248e-5255.88clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
epn21.326e-3643.59epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ENT38.781e-3442.42Protein containing an N-terminal epsin-like domain... [more]
ENT11.698e-1534.25Epsin-like protein involved in endocytosis and act... [more]
ENT26.019e-1534.25Epsin-like protein required for endocytosis and ac... [more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO487886.866e-5958.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369921.159e-3642.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clint1a1.175e-5259.04clathrin interactor 1 [Source:NCBI gene;Acc:101169... [more]
CLINT11.380e-4861.84clathrin interactor 1 [Source:NCBI gene;Acc:101160... [more]
CLINT11.411e-4861.84clathrin interactor 1 [Source:NCBI gene;Acc:101160... [more]
epn22.021e-3543.51epsin 2 [Source:NCBI gene;Acc:101161060][more]
epn14.245e-3544.97epsin-1 [Source:NCBI gene;Acc:101167232][more]
back to top
BLAST of ENTH domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019746.10.000e+099.37SMESG000019746.1[more]
SMESG000032527.11.071e-3246.79SMESG000032527.1[more]
SMESG000032527.11.075e-3246.79SMESG000032527.1[more]
SMESG000042233.13.934e-2841.21SMESG000042233.1[more]
SMESG000042233.14.204e-2841.21SMESG000042233.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030824 ID=SMED30030824|Name=ENTH domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1818bp
GTAAATAATTACTAAGTTTCCTTTTTGCACTATTTAATATTTTAGATTAC
ATTTTTAGTTTTTAGATAATTAGATTTATCAATGTTGCGAGAAGTCTTTG
AAATGGGAAAAGAATTAGCTGATAAAGTGACAAACGCGGTTATGAATTAC
ACGGAAGTTGAAGCAAAGGTCCGAGCAGCGACAAACGATGATCCATGGGG
TCCTCATGGCCAAGACATGCAGGAGATTGCGGAATTTACTAAGCATTATG
ACACATTGACACAAGTAATGGGAATGTTGTGGAGGAGAATGTTCCAAGAA
CAGAAAAGTAACTGGAGAAGGACATACAAGTCGCTTCTGCTGCTGTCATA
TTTGTTACGGAACGGATCCGAGAGGATTGTCATCAGCTGCAAAGAGCACA
TCTATGATTTGCGGTTGTTGGAATCATATCAATATATCGATGAAAACGGC
AAGGATCAAGGAATTAATATCAGGCACAAAAGCAAGGAGCTGATTGGATT
GCTGGAGAATGAATCCCAGCTGTCCAATGAGCGTAAGAAAGCCACATCAA
ATAGGAGCAAGTACAAGGCAGGGATAAGCGGCTCGGTAAATGGGCACCGC
CGGTATTGGAATAGTGATGACATGAAAGCAACTGAGAGATCGACACGCGA
GAGATCTTGTACCCCGCCTTCACCGTCAGTTAACGGATCCTCCAGACCCC
CAGCAAAACCTCCCGTTGACCTGAAACCGGTCGCGGTGGTTAGCAAACCG
GCGGAACCGATTGCTGACCTGCTTGATTTGAATGTGCCGATGGCAGATAG
CACCAATTTGCCGCCACTCAATCACTGTGCCAATAACGCCGCTGACACCT
CATTTGACCCGTTTAACCTTGGCAACGAGCACCGGGAGTTCACGGTTCCC
CCAGTCCCCTCCAATCCCACATCGCCCACGTCGCCATGCAATCCTCGCTA
TTCTGATGACTTTGACAGCTTTGTATCGGCTGCGCCTCCGGTACCGCTAC
CTACCTCAAATCTCGCGGACCTCGACTTGGTATTTGGGAACTTTATCGAC
AGCAGTAGCAATAACGATATCAGTAACAATCCGGTTGCCTTAGGCACCAC
CGGAAGGCCGACACTCATCACCCAGACTCCCATGACACCAAAAGCCATTT
CCGTTGCCACTGACAACGGGAAATCGGACAAAATGATCATCGGTTCCACT
TGGTCTGACGTTGGTGGCATCAATATCAGTTTGGACTTACTGAGCAACCG
AGGCCAGAAAGCCACTCACTCGGTCACCTCGTCTAAATCTCTTAATCAAC
TCCAGCAGCAAAATGTTTTCAATTCCAATAACGATTCCAATAAAATATAT
TCAAATTCCAGAAAGCAACCATTTGACTCACCAAAGAATCATCCGCATCA
AAGCAGAAATGTAGCAGCCAATGAAAAGCTTAGCAATGCAAATGTGTCAT
TCGGTCAGGTCAATCACTCCTCAGCTAATCAGTTTGTCGCATTCAATGAT
TTGCTGCAATGATTGGTTGGATTAGTTTATTGATCGGTGGTGATTGGTGG
AGATATCACCGATATTCAATAATATGATAATAATCAATAATTATAATAAT
AATCAATAATAGTAATAATAGTGATGATCATGTGCTCATTAGAATATTTT
ATCAATACCTTTGATTACCTTACCAAGTGGCTTTATTTGTTGTGACAATT
TTAATACCTGTTTATTGGTTGATTGGTTACCTTGTCAACCGTTCTGAGTT
CATTATTTATTTTGCTGCTGAATGATTATGAGTGAGTGAGTGAATGTTGC
TATGGTGTAGAAATCGGA
back to top

protein sequence of SMED30030824-orf-1

>SMED30030824-orf-1 ID=SMED30030824-orf-1|Name=SMED30030824-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=477bp
MLREVFEMGKELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIA
EFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKSLLLLSYLLRNGSERIV
ISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNE
RKKATSNRSKYKAGISGSVNGHRRYWNSDDMKATERSTRERSCTPPSPSV
NGSSRPPAKPPVDLKPVAVVSKPAEPIADLLDLNVPMADSTNLPPLNHCA
NNAADTSFDPFNLGNEHREFTVPPVPSNPTSPTSPCNPRYSDDFDSFVSA
APPVPLPTSNLADLDLVFGNFIDSSSNNDISNNPVALGTTGRPTLITQTP
MTPKAISVATDNGKSDKMIIGSTWSDVGGINISLDLLSNRGQKATHSVTS
SKSLNQLQQQNVFNSNNDSNKIYSNSRKQPFDSPKNHPHQSRNVAANEKL
SNANVSFGQVNHSSANQFVAFNDLLQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005737cytoplasm
GO:0005770late endosome
GO:0005794Golgi apparatus
GO:0005856cytoskeleton
GO:0005884actin filament
GO:0009579thylakoid
GO:0030136clathrin-coated vesicle
GO:0031410cytoplasmic vesicle
Vocabulary: biological process
TermDefinition
GO:0016192vesicle-mediated transport
GO:0055114oxidation-reduction process
GO:0006623protein targeting to vacuole
GO:0006810transport
GO:0015031protein transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000101muscle cell
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR030544CLINT1
IPR013809ENTH
IPR008942ENTH_VHS
IPR019774Aromatic-AA_hydroxylase_C
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0002020protease binding
GO:0005515protein binding
GO:0030276clathrin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013809ENTH domainSMARTSM00273enth_2coord: 24..151
e-value: 5.4E-46
score: 168.8
IPR013809ENTH domainPFAMPF01417ENTHcoord: 23..147
e-value: 2.3E-43
score: 147.2
IPR013809ENTH domainPROSITEPS50942ENTHcoord: 18..151
score: 40.371
IPR008942ENTH/VHSGENE3DG3DSA:1.25.40.90coord: 18..165
e-value: 9.6E-58
score: 196.2
IPR008942ENTH/VHSSUPERFAMILYSSF48464ENTH/VHS domaincoord: 8..151
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 173..211
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 175..189
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 145..164
NoneNo IPR availablePANTHERPTHR12276EPSIN/ENT-RELATEDcoord: 10..189
NoneNo IPR availableCDDcd16989ENTH_EpsinRcoord: 26..154
e-value: 4.32893E-72
score: 222.166
IPR030544Clathrin interactor 1PANTHERPTHR12276:SF83CLATHRIN INTERACTOR 1coord: 10..189