SMED30030820

Overview
NameSMED30030820
Smed IDSMED30030820
Length (bp)2902
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30030820 (SMED30030820) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30030820 (SMED30030820) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30030820 (SMED30030820) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30030820 (SMED30030820) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030820

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30030820SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SmedASXL_018089SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30030820SMESG000081078.1 SMESG000069853.1 SMESG000045007.1 SMESG000016710.1 SMESG000016305.1 SMESG000002984.1 SMESG000078601.1 SMESG000062504.1 SMESG000047126.1 SMESG000040474.1 SMESG000029537.1 dd_Smed_v4_199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30030820SMESG000081078.1 SMESG000069853.1 SMESG000045007.1 SMESG000016710.1 SMESG000016305.1 SMESG000002984.1 SMESG000078601.1 SMESG000062504.1 SMESG000047126.1 SMESG000040474.1 SMESG000029537.1 dd_Smed_v4_199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030820SMESG000081078.1 SMESG000069853.1 SMESG000045007.1 SMESG000016710.1 SMESG000016305.1 SMESG000002984.1 SMESG000078601.1 SMESG000062504.1 SMESG000047126.1 SMESG000040474.1 SMESG000029537.1 dd_Smed_v4_199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30030820SMESG000040959.1 dd_Smed_v4_9020_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30030820SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SMED30032823smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30030820SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SMED30032823smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30030820 vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 52.7582 bits (125), Expect = 2.135e-6
Identity = 28/72 (38.89%), Postives = 45/72 (62.50%), Query Frame = -2
Query: 1981 KTCPQEMFPNVFKLLKIYNMISVTTADV*SSFSQMKQLKTEDRNTTGEERLSGLMF*SINRDNRVLFEEFID 2196
            +T  Q +FP + ++LK+Y  + V+TA V  SFS+M+ +K + R+   EERLS L+  +I +D  V   E I+
Sbjct:  820 ETSGQHVFPALVEMLKVYATLPVSTATVERSFSKMRLIKNQLRSLCSEERLSDLLLIAIEKDIPVDHSEVIN 891          
BLAST of SMED30030820 vs. TrEMBL
Match: A0A4Y2TN79 (Dimer_Tnp_hAT domain-containing protein OS=Araneus ventricosus OX=182803 GN=AVEN_210133_1 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.427e-12
Identity = 37/83 (44.58%), Postives = 57/83 (68.67%), Query Frame = -2
Query: 1969 QTAMDHIKTCPQEMFPNVFKLLKIYNMISVTTADV*SSFSQMKQLKTEDRNTTGEERLSGLMF*SINRDNRVLFEEFIDKGKR 2217
            +TA+  ++ C +  FPN++ LLK+  ++ V+ A V  SFS +++LKT  RNTT E RL+GL+  SI+RD ++  EEF+DK  R
Sbjct:   20 KTAISSLEKCDKTSFPNIYTLLKLLAVLPVSVATVERSFSSLRRLKTYLRNTTSESRLNGLILLSIHRDLKISDEEFLDKFAR 102          
BLAST of SMED30030820 vs. TrEMBL
Match: A0A4Y2BX22 (Dimer_Tnp_hAT domain-containing protein OS=Araneus ventricosus OX=182803 GN=AVEN_238683_1 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 3.789e-12
Identity = 36/80 (45.00%), Postives = 55/80 (68.75%), Query Frame = -2
Query: 1978 QTAMDHIKTCPQEMFPNVFKLLKIYNMISVTTADV*SSFSQMKQLKTEDRNTTGEERLSGLMF*SINRDNRVLFEEFIDK 2217
            +TA+  ++ C +  FPN++ LLK+  ++SV+ A+V  SFS +++LKT  RNTT E RL+GL   SI RD ++  EE +DK
Sbjct:   17 KTAISSLEKCDKTFFPNIYILLKLLAVLSVSVANVERSFSSLRRLKTYLRNTTSESRLNGLALLSIYRDIKIRDEELLDK 96          
BLAST of SMED30030820 vs. TrEMBL
Match: X1WTS2 (Dimer_Tnp_hAT domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 4.280e-12
Identity = 42/104 (40.38%), Postives = 64/104 (61.54%), Query Frame = -2
Query: 1966 EIW*KRLRN--STGKSQTAMDHIKTCPQEMFPNVFKLLKIYNMISVTTADV*SSFSQMKQLKTEDRNTTGEERLSGLMF*SINRD----NRVLFEEFIDKGKRR 2259
            EIW  + +N     K  TA++ +  C + M+PN++KLLKI  +I V+TA    SF+ +++LKT  RNTT E RL GL   +I+RD    + +L ++F + GK R
Sbjct:   97 EIWQAKWKNIEDNLKPTTAIEALSVCDRLMYPNMYKLLKILAIIPVSTATAERSFTMLRRLKTYLRNTTSESRLVGLALLAIHRDIDIPDDILLDKFANSGKER 200          
BLAST of SMED30030820 vs. TrEMBL
Match: A0A4Y1ZUW7 (Dimer_Tnp_hAT domain-containing protein OS=Araneus ventricosus OX=182803 GN=AVEN_157365_1 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 4.926e-12
Identity = 36/80 (45.00%), Postives = 54/80 (67.50%), Query Frame = -2
Query: 1978 QTAMDHIKTCPQEMFPNVFKLLKIYNMISVTTADV*SSFSQMKQLKTEDRNTTGEERLSGLMF*SINRDNRVLFEEFIDK 2217
            +TA+  ++ C +  FPN++ LLK+  ++ V+ A V  SFS +++LKT  RNTT E RL+GL   SINRD ++  EE +DK
Sbjct:   17 KTAISSLEKCDKNFFPNIYILLKLLAVLPVSVATVERSFSSLRRLKTYLRNTTSESRLNGLALLSINRDIKIRDEEVLDK 96          
BLAST of SMED30030820 vs. TrEMBL
Match: X1X8F3 (Dimer_Tnp_hAT domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.234e-12
Identity = 40/105 (38.10%), Postives = 65/105 (61.90%), Query Frame = -2
Query: 1960 EIW*KRLRNSTGK-SQTAMDHIKTCPQEMFPNVFKLLKIYNMISVTTADV*SSFSQMKQLKTEDRNTTGEERLSGLMF*SINRDNRV----LFEEFIDKGKRRLD 2259
            E W ++  N      + A+D +  CP+++FP++  LLK+  ++ V+TA V  SFS +K++KT  RN+TGE RL+GL   +I+RD ++    +   F  K +RRLD
Sbjct:   33 EFWKQKWSNEENDLPKNALDTLSKCPEDLFPHINILLKLLAILPVSTASVERSFSSLKRIKTYLRNSTGEARLNGLALMNIHRDIQIDTDAILNMFASKKERRLD 137          
BLAST of SMED30030820 vs. Ensembl Cavefish
Match: ENSAMXT00000036272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:11935414:11938921:1 gene:ENSAMXG00000041670.1 transcript:ENSAMXT00000036272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 2.643e-6
Identity = 27/56 (48.21%), Postives = 38/56 (67.86%), Query Frame = -2
Query: 2017 QEMFPNVFKLLKIYNMISVTTADV*SSFSQMKQLKTEDRNTTGEERLSGLMF*SIN 2184
            QE++PN++  L+I   + VT A    SFS++K +KT  R+T G+ERLSGL   SIN
Sbjct:  740 QEVYPNLWIALRIALTLPVTVASAERSFSKLKLIKTYLRSTMGQERLSGLAVISIN 795          
BLAST of SMED30030820 vs. Ensembl Nematostella
Match: EDO40596 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q7])

HSP 1 Score: 59.3066 bits (142), Expect = 2.945e-10
Identity = 37/89 (41.57%), Postives = 52/89 (58.43%), Query Frame = -2
Query: 1963 QTAMDHIKTCPQEMFPNVFKLLKIYNMISVTTADV*SSFSQMKQLKTEDRNTTGEERLSGLMF*SI--NR--DNRVLFEEFIDKGKRRL 2217
            ++A++ +K C  E +PNV  LL+I   +SVT+A+   SFS MK+LKT  RNT   ER S L   S+  NR  D   + + F  +  RRL
Sbjct:   64 RSAVNALKNCDAEFYPNVHVLLRILCTLSVTSAESERSFSTMKRLKTYLRNTMSTERESSLALISVHYNRSLDVDAIIDTFATRHPRRL 152          
BLAST of SMED30030820 vs. Ensembl Nematostella
Match: EDO40662 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6J7])

HSP 1 Score: 57.7658 bits (138), Expect = 2.166e-8
Identity = 36/89 (40.45%), Postives = 50/89 (56.18%), Query Frame = -2
Query: 1963 QTAMDHIKTCPQEMFPNVFKLLKIYNMISVTTADV*SSFSQMKQLKTEDRNTTGEERLSGLMF*SI--NR--DNRVLFEEFIDKGKRRL 2217
            ++A+D +K C  E +PNV  LL+I   + VT+A+   SFS MK+LKT  RNT   ER   L   S+  NR  D   + + F  +  RRL
Sbjct:  215 RSAVDALKNCDAEFYPNVHVLLRILCTLPVTSAESERSFSTMKRLKTYLRNTMSTEREPSLALISVHYNRSLDVDAIIDTFATRHPRRL 303          
BLAST of SMED30030820 vs. Planmine SMEST
Match: SMESG000040959.1 (SMESG000040959.1)

HSP 1 Score: 934.48 bits (2414), Expect = 0.000e+0
Identity = 482/489 (98.57%), Postives = 485/489 (99.18%), Query Frame = 3
Query:   42 MFNKTVLEKLGFIITFSALAFAFLVSYGKVAIILGKSATYKDVSTPLXXXXXXXXXXXXXXXXXSKYFIRRHKNAKPFGETQAENPIIIYFICLPMTVSIIICMVITLFKDTYKPNSTRDEIFFDTMAILYFGSLLLILIQLNGFYDFGENWEITFSNIFAVTSAIFSQIYFLSLFSSQQQAYFFTREVNNSDIKQECQNVSKTEIRIIFCALWTEVEKYVSKFHLVLGSICMLLLVKAFNKLYKNLQRYKKEDIFVLPNMEEKLSRFGKTMIFICGSVNFSYCMALGFESNKTFRYITSIAEIFVYFMMIYFSINQLGIIIKWPYRSDVENRDMFNEIMIWAGFLGQTMQLTAVINYYDSSYKSLIILRNLIQFVQTSVQTIFESILIEKSQPSKNILFSTITFLLVLAILNFQFGIINIWLFGQMLKDLNDKSLNDPKFQYYFMIILVFRVGTIFTIMQKFHSSFLLFRLNFIVYKTKKNGYNEIEG 1508
            MFNKTVLEKLGFIITFSALAFAFLVSYGKVAIILG SATYKDVSTPLNVIGGVLNIVFIVLIVISKYFIRRHKNAKPFGETQAENPIIIYFICLPMTVSIIICM+ITLFKDTYKPNSTRDEIFFDTMAILYFGSLLLILIQLNGFYDFGENWEITFSNIFAVTSAIFSQIYFLSLFSSQQQAYFFTREVNNSDIKQECQNVSKTEIRIIFCALWTEVEKYVSKFHLVLGSICMLLLVKAFNKLYKNLQRYKKEDIFVLPNMEEKLSRFGKTMIFICGSVNFSYCMALGFESNKTFRYITSIAEIFVYFMMIYFSINQLGIIIKWPYRSDVENRDMFNEIMIWAGFLGQTMQLTA+INYYDSS+KSL ILRNLIQFVQTSVQTIFESILIEKSQPSKNILFSTIT L VLAILNFQFGIINIWLFGQMLKDLNDKSLNDPKFQYYFMIILVFRVGTIFTIMQKFHSSFLLFRLNFIVYKTKKNGYNEIEG
Sbjct:    1 MFNKTVLEKLGFIITFSALAFAFLVSYGKVAIILGNSATYKDVSTPLNVIGGVLNIVFIVLIVISKYFIRRHKNAKPFGETQAENPIIIYFICLPMTVSIIICMIITLFKDTYKPNSTRDEIFFDTMAILYFGSLLLILIQLNGFYDFGENWEITFSNIFAVTSAIFSQIYFLSLFSSQQQAYFFTREVNNSDIKQECQNVSKTEIRIIFCALWTEVEKYVSKFHLVLGSICMLLLVKAFNKLYKNLQRYKKEDIFVLPNMEEKLSRFGKTMIFICGSVNFSYCMALGFESNKTFRYITSIAEIFVYFMMIYFSINQLGIIIKWPYRSDVENRDMFNEIMIWAGFLGQTMQLTALINYYDSSHKSLTILRNLIQFVQTSVQTIFESILIEKSQPSKNILFSTITSLSVLAILNFQFGIINIWLFGQMLKDLNDKSLNDPKFQYYFMIILVFRVGTIFTIMQKFHSSFLLFRLNFIVYKTKKNGYNEIEG 489          
BLAST of SMED30030820 vs. Planmine SMEST
Match: SMESG000064134.1 (SMESG000064134.1)

HSP 1 Score: 139.043 bits (349), Expect = 1.892e-38
Identity = 71/103 (68.93%), Postives = 82/103 (79.61%), Query Frame = -2
Query: 1957 IW*KRLRNSTGKSQTAMDHIKTCPQEMFPNVFKLLKIYNMISVTTADV*SSFSQMKQLKTEDRNTTGEERLSGLMF*SINRDNRVLFEEFID---KGKRRLDV 2256
            +W KRLRNST K QTAM+H KTC Q MF NV  LLKIYN+I + TADV  S++Q KQLKT+DRNT GEE+L+GLM  SINRD +VLFEEFID   KGKRR+DV
Sbjct:    1 MWQKRLRNSTKKQQTAMNHFKTCLQGMFLNVLTLLKIYNVIPIITADVKRSYTQNKQLKTDDRNTAGEEKLNGLMVLSINRDIKVLFEEFIDEFRKGKRRIDV 103          
BLAST of SMED30030820 vs. Planmine SMEST
Match: SMESG000051898.1 (SMESG000051898.1)

HSP 1 Score: 103.605 bits (257), Expect = 1.008e-22
Identity = 126/493 (25.56%), Postives = 234/493 (47.46%), Query Frame = 3
Query:   45 FNKTVLEKLGFIITFSALAFAFLVSYGKVAIILGKSATYKDVSTPLXXXXXXXXXXXXXXXXXSKYFIRRHKNAKPFGETQAENPIIIYFICLPMTVSIIICMVITLFKDTYKPNSTRDEI-FFDTMAILYFGSLLLILIQLNGFYDFGENWEITFSNIFAVTSAIFSQIYFLSLFSSQQQAYFFTREVNNSDIKQEC-QNVSKTEIRIIFCALWTEVEKYVSKFHLVLGSICMLLLVKAFNKLYKNLQRYKKED-IFVLPNMEEKLSRFGK-------------TMIFICGSVNFSYCMALGFESNKTFRYITSIAEIFVYFMMIYFSINQLGIIIKWPYRSDVENRDMFNEIMIWAGFLGQTMQLTAVINYY--------DSSYKSLIILRNLIQFVQTSVQTIFESILIEK---SQPSKNILFSTITF-LLVLAILNFQFGIINIWLFGQMLKDLNDKSLN-DPKFQYYFMIILVFRVGTIFTIMQKFHS 1436
            F K + EKL   +T    +   L++YG   + L  ++  + V  PL + G V N++ + LI+ + Y    HK    F +   EN  I+Y+ C+P T+ +I  ++ITL K  Y        I  F   +++YF  +++ + + N  +DFGE+W + F N+      + S ++ +   +S +Q  +F   +N S I Q C  N+     R  +  LW  V  ++ K  ++ G    + + K+  + Y  LQ YK +     L + +E ++R  +             T++F  G +  +  +A+   S +   +I    E+F Y  MI  +I  +  +I   +   +    +FNE++IW G  GQ +   AVI  Y        ++ Y + I+++ ++Q +   VQ++FE+IL+EK   ++  KN  FST+ F    +A+ NF      +++F  ++    +  L  +   +    + L F  G IF+++Q+ H 
Sbjct:    7 FEKVLFEKLSISLTVITFSIGLLITYGWNTLTLASNSFLEFVWAPLYICGSVFNLLVVFLILFALY--MNHKYRNLFNKCPMENQDILYYFCIPATIFVISTLIITLVKSLYIAECNGKMIVLFIFTSVIYFVVIVVFIAETNSVFDFGESWALNFVNMMVSLIIVSSLVFNIVFNTSLEQMDYFAAVINKSLINQSCIDNLPFIAQRTYY--LWVSVRIFLYKSIVLFGLFSTVFIFKSLYRNYLYLQFYKYDGKTNDLKSNDEDVNRNSQKNNLKKLYLKIFSTLLF--GILFLAINIAVYIRSKEYLEHILIGMEMFSYISMIGLTIFMMKNLIFTDF--SISRIYVFNEVIIWLGLCGQLVHCFAVIAAYIYLMYNEVNAIYIA-ILIKYVLQILSNIVQSVFEAILVEKLWNNKIGKN--FSTMAFGAFYIAVNNF------VYIFTDLILVYKEFLLPFEGSVKLKLFVCLFFNFGNIFSVLQRIHG 482          
BLAST of SMED30030820 vs. Planmine SMEST
Match: SMESG000040960.1 (SMESG000040960.1)

HSP 1 Score: 72.7886 bits (177), Expect = 5.733e-13
Identity = 126/504 (25.00%), Postives = 219/504 (43.45%), Query Frame = 3
Query:   51 KTVLEKLGFIITFSALAFAFLVSYGKVAIILGKSATY--KDVSTPLXXXXXXXXXXXXXXXXXSKYFIRR---HKNAKPFGETQAENPIIIYFICLPMTVSIIICMVITLFKDTYKPNSTR-DEIFFDTMAILYFGSLLLILIQLNGFYDFGENWEITFSNIFAVTSAIFSQIYFLSLFSSQQQAYFFTREVNNSDIKQEC----QNVSKTEIRIIFCALWTEVEKYVSKFHLVLGSICMLLLVKAFNKLYKNLQRYKKEDIFV----LPNMEEKLSRFGKTMIFICGSVNFSYCMALGFESNKTFRY---------ITSIAEIFVYFMMIYFSINQLGIIIKWPYRSDVENRDMFNEIMIWAGFLGQ-----TMQLTAVINYYDSSYKSL---IILRNLIQFVQTSVQTIFESILIEKSQPSKNILFST--ITFLLVLAILNFQFGIINIWLFGQMLKDLNDK---SLNDP-KFQYYFMIILVFRVGTIFTIMQKFHSSFLLF 1451
            KT+LEKL F+I        FL+S+G V I LG    Y  K +S        + +   + ++  S   +     H N   F + +  N  I++  C P+   II  ++I+   D Y         + F +   +Y+ ++++ L + +   D GE W I FSN+ A+   I SQI+++ +  S +Q       +N +D    C      +SKT   +    L   ++ +     L+ G++C  LL+  F   Y +L  +K E   +       ++  +S F         S+  +    +GF S K F Y         ++ I EI +  +++  S+        WP  S       FN  ++W G +GQ     TM + + I++  + +  L   ++   L + +Q SVQ I ES+L+E    ++ +  ++  I   L L I N    I+NI         +ND     L DP  F+ +F+    F +  +F ++Q+ H  FLLF
Sbjct:   13 KTILEKLIFLIGL------FLISFGSVTI-LGLIHQYFVKILSISYYWNSMIFSGSVMNIVSASIIILNEYLNHLNRNHFYKLRVLNSEILHTFCFPLVSFIIGSLLISTINDIYLIRCIGYGRMIFASTNSIYYITVMIFLAKYHFVCDDGEEWIINFSNMSAIFIIIISQIFYILVSISVEQITLIVPILNITDFDTSCIQHLNTISKTIDNLTGRLLMPMMKAW-----LIFGTLCCTLLIMPFLHHYSSLNNHKIEQSIIKNSSFKGVKHDISNF---------SLIVTLAFGIGFLSCKFFFYYYHTYWTMILSVILEINISIILLICSLYATSEAATWPVCS--VKLFQFNNAIVWIGLIGQFVFSVTMIMNS-ISHLSTEFSILGLCVLFEYLSKMIQISVQFILESLLLETQWENRKLEKNSKLINAFLFLMINNLCLTILNI-------ARINDNILPPLKDPISFKIFFIFTTNFSM--VFCVLQRLH-GFLLF 482          
BLAST of SMED30030820 vs. Planmine SMEST
Match: SMESG000008536.1 (SMESG000008536.1)

HSP 1 Score: 60.8474 bits (146), Expect = 2.961e-9
Identity = 35/104 (33.65%), Postives = 52/104 (50.00%), Query Frame = -2
Query: 1984 LNESLPMFFG*VEIW*KRLRNSTGKSQTAMDHIKTCPQEMFPNVFKLLKIYNMISVTTADV*SSFSQMKQLKTEDRNTTGEERLSGLMF*SINRDNRVLFEEFI 2295
            L  S P     +++W  R      K  + +D IK+C    FPNV KLL I   + VT   +    S++  +KT D  T  E+RL+GL+  +I RD  +  EE +
Sbjct:  305 LQASAPQLRAEIKMWSLRFSKLVEKPNSIIDQIKSCNSTFFPNVLKLLSILVALPVTNCTLERRLSKLNLIKTFDGATMTEDRLNGLVLLNIYRDESIEIEEVL 408          
The following BLAST results are available for this feature:
BLAST of SMED30030820 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030820 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030820 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030820 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CR762475.12.135e-638.89pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
back to top
BLAST of SMED30030820 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030820 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030820 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030820 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2TN791.427e-1244.58Dimer_Tnp_hAT domain-containing protein OS=Araneus... [more]
A0A4Y2BX223.789e-1245.00Dimer_Tnp_hAT domain-containing protein OS=Araneus... [more]
X1WTS24.280e-1240.38Dimer_Tnp_hAT domain-containing protein OS=Acyrtho... [more]
A0A4Y1ZUW74.926e-1245.00Dimer_Tnp_hAT domain-containing protein OS=Araneus... [more]
X1X8F37.234e-1238.10Dimer_Tnp_hAT domain-containing protein OS=Acyrtho... [more]
back to top
BLAST of SMED30030820 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000036272.12.643e-648.21pep primary_assembly:Astyanax_mexicanus-2.0:20:119... [more]
back to top
BLAST of SMED30030820 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030820 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030820 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO405962.945e-1041.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406622.166e-840.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30030820 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030820 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040959.10.000e+098.57SMESG000040959.1[more]
SMESG000064134.11.892e-3868.93SMESG000064134.1[more]
SMESG000051898.11.008e-2225.56SMESG000051898.1[more]
SMESG000040960.15.733e-1325.00SMESG000040960.1[more]
SMESG000008536.12.961e-933.65SMESG000008536.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030820 ID=SMED30030820|Name=SMED30030820|organism=Schmidtea mediterranea sexual|type=transcript|length=2902bp
TCTTTATTAACTTACATTAAGCATACAAAATATTTCATATTATGTTTAAT
AAAACGGTTTTGGAAAAACTGGGATTTATAATAACATTTTCTGCTCTAGC
TTTTGCATTTTTGGTATCTTATGGAAAGGTTGCAATAATTCTTGGAAAGT
CGGCCACATATAAAGATGTATCTACTCCTCTAAATGTCATTGGTGGAGTA
TTGAATATCGTGTTTATTGTTTTAATTGTTATTTCAAAATATTTCATTAG
AAGACATAAAAATGCCAAACCATTTGGAGAAACTCAAGCTGAAAATCCTA
TAATAATTTATTTCATCTGTTTGCCAATGACAGTTTCTATCATCATCTGC
ATGGTCATCACGCTTTTTAAAGACACCTATAAACCTAACAGTACTCGTGA
TGAGATCTTCTTCGATACGATGGCAATTTTATATTTCGGCAGTTTACTAT
TAATTTTGATACAATTGAATGGTTTTTATGATTTCGGTGAAAATTGGGAA
ATTACTTTCTCGAACATATTTGCCGTCACATCCGCGATATTTAGTCAGAT
TTATTTCCTTTCATTGTTTTCATCCCAACAACAGGCGTATTTCTTTACTC
GAGAGGTTAACAACAGCGACATTAAACAAGAATGCCAAAATGTAAGTAAA
ACGGAGATTCGAATCATATTTTGTGCGCTTTGGACAGAAGTCGAGAAATA
CGTTTCAAAATTTCATTTAGTTCTTGGATCAATTTGTATGTTGCTTTTAG
TTAAAGCTTTCAATAAATTGTACAAAAATTTACAAAGATATAAAAAAGAA
GACATATTTGTACTACCAAATATGGAAGAGAAGTTATCACGTTTTGGGAA
AACTATGATTTTTATCTGCGGATCAGTAAATTTCTCATACTGCATGGCAT
TAGGCTTTGAGAGTAACAAAACCTTTAGATATATAACTTCTATTGCTGAA
ATATTTGTTTATTTTATGATGATTTATTTCTCAATTAACCAACTGGGAAT
CATAATAAAATGGCCATATCGAAGTGATGTGGAAAATAGAGACATGTTCA
ACGAAATAATGATTTGGGCTGGATTTCTGGGACAGACGATGCAATTGACG
GCAGTTATAAACTACTATGATTCAAGCTATAAATCCTTAATAATTTTGCG
AAATTTAATTCAGTTTGTCCAGACTAGCGTTCAAACCATTTTCGAAAGCA
TTCTGATAGAAAAATCCCAACCTAGTAAGAACATTCTCTTTTCCACAATT
ACTTTCCTTTTGGTTCTGGCCATTTTAAATTTTCAATTTGGAATAATAAA
CATTTGGCTTTTTGGTCAGATGTTAAAGGATTTGAATGACAAGAGTTTGA
ATGATCCAAAATTCCAATACTATTTCATGATAATTTTAGTATTCAGAGTT
GGAACTATTTTTACAATCATGCAAAAATTTCACTCTTCCTTTTTATTATT
TCGATTAAATTTTATTGTTTATAAAACCAAGAAAAACGGTTATAACGAGA
TTGAAGGCTGAAAATTAGGAAAATCCTTTGGACATCTTAAAAGTAAAAAA
ACTTTATATAATAATTGATGACAATCGAGAAAAAAATCCTTTCACAATTT
TTAACATTTTTATATAAAACTGATTTATTTTCAATTTACATTTCTTTTCT
AGTAATCGTTCATTTTTTTTTGAAAAAGGCTGTGCCGAAAATTCGTGAAT
ACCTTAAATAAATCTGATTCATAGTCAAATTTTGTAGAAAATATTATGTC
ACTTATAAAGAAATCAGAGGTGATAAACAAAAAAAGTCCTTGTAATATTA
TTATTTTTACTATTAAATAAGCAGGGCAATAATTTAAATAAAAGAAATCG
CTATTCAAATACACTTTTTATGATTAAATTCGACAGATTCATTGTTGTAA
GCAGGTAAAAAAAATAATAATAAGGATCAGCTGCGTAGCCAGAATTTCAG
AATTCACACGTCAAGTCGACGTTTTCCTTTGTCAATAAATTCTTCAAACA
ATACTCTGTTATCACGATTAATGCTCTAAAACATCAATCCGCTGAGTCTT
TCCTCTCCTGTCGTGTTTCTGTCCTCTGTTTTAAGTTGTTTCATTTGACT
GAATGAACTTTAAACGTCAGCGGTTGTTACAGAAATCATATTATAGATTT
TCAACAATTTGAATACGTTTGGAAACATCTCTTGTGGGCATGTTTTGATG
TGGTCCATCGCAGTTTGTGATTTCCCAGTTGAATTTCTCAGTCTTTTCTA
CCATATCTCAACTTATCCGAAAAACATCGGCAGTGATTCGTTCAAAGCTT
ATTTTGATGATGTCTCTTCATGGCTTTAAATCAATTAAGTATTTAAAAAT
TCAATGCAAGTGAAGAAAGAGAATTTAGCTACTATTTGCTGAAAACAATA
TAGCAATATGAAACTAGTCAAATTGAACACTAGTTCAATACAGTTCAATA
ATCGAACTTTTTATTGAGCTTTAAAAATTTGAATAGTTGAAATCCTTTAG
GCAAATCAACAACTTCTGAAAATCCTGAAGTTTCTTGGCTACGCGCCTGA
TATACATTAATTTTTTTTAATTCTTTAAATTCACTTTAAATTTATATTTT
ATTTATTAAATAAATTTAATTTTAAAAATACTAAAAATTTTGAAATTAAA
TATTTAAAAAACCACATTTGCTGCATATATTAGAGAGAATTCCCGTCATA
TCTGTTCTCGGGTTCTTGAGCATTGTAGATTGAAGGGATTCACCAATATT
AGTGAGAATGTAGAAAATGAGTTAAATTGGCATATCGGATTTTAAAATCA
TTGTGTAAAATGCTGTGAGTACGAGTGATATGAATGTGTTTGAATAGTTT
GGTTGGTAAATTTTTGGATATGTCGATTGATTCTGTAGTTGTTTTTAGTT
GC
back to top

protein sequence of SMED30030820-orf-1

>SMED30030820-orf-1 ID=SMED30030820-orf-1|Name=SMED30030820-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=490bp
MFNKTVLEKLGFIITFSALAFAFLVSYGKVAIILGKSATYKDVSTPLNVI
GGVLNIVFIVLIVISKYFIRRHKNAKPFGETQAENPIIIYFICLPMTVSI
IICMVITLFKDTYKPNSTRDEIFFDTMAILYFGSLLLILIQLNGFYDFGE
NWEITFSNIFAVTSAIFSQIYFLSLFSSQQQAYFFTREVNNSDIKQECQN
VSKTEIRIIFCALWTEVEKYVSKFHLVLGSICMLLLVKAFNKLYKNLQRY
KKEDIFVLPNMEEKLSRFGKTMIFICGSVNFSYCMALGFESNKTFRYITS
IAEIFVYFMMIYFSINQLGIIIKWPYRSDVENRDMFNEIMIWAGFLGQTM
QLTAVINYYDSSYKSLIILRNLIQFVQTSVQTIFESILIEKSQPSKNILF
STITFLLVLAILNFQFGIINIWLFGQMLKDLNDKSLNDPKFQYYFMIILV
FRVGTIFTIMQKFHSSFLLFRLNFIVYKTKKNGYNEIEG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0002075pigment cell
PLANA:0002142parenchyma