Heterogeneous nuclear ribonucleoprotein K

Overview
NameHeterogeneous nuclear ribonucleoprotein K
Smed IDSMED30030818
Length (bp)1264
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heterogeneous nuclear ribonucleoprotein K (SMED30030818) t-SNE clustered cells

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein K (SMED30030818) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heterogeneous nuclear ribonucleoprotein K (SMED30030818) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein K (SMED30030818) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030818

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030818SMESG000021944.1 SmedASXL_014161SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30030818SMESG000021944.1 SmedASXL_014161SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30030818SMESG000021944.1 dd_Smed_v4_2111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30030818SMESG000021944.1 dd_Smed_v4_2111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030818SMESG000021944.1 dd_Smed_v4_2111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030818SMESG000021944.1 dd_Smed_v4_2111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030818SMESG000021944.1 dd_Smed_v4_2111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030818SMESG000021944.1 dd_Smed_v4_2111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30030818SMESG000021944.1 SMED30030818smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30030818SMESG000021944.1 SMED30030818smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30030818SMESG000021944.1 SMED30030818smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: HNRNPK (heterogeneous nuclear ribonucleoprotein K [Source:HGNC Symbol;Acc:HGNC:5044])

HSP 1 Score: 141.354 bits (355), Expect = 2.047e-37
Identity = 82/202 (40.59%), Postives = 123/202 (60.89%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++EY +     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEYQH-----YKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGF 215          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: HNRNPK (heterogeneous nuclear ribonucleoprotein K [Source:HGNC Symbol;Acc:HGNC:5044])

HSP 1 Score: 134.035 bits (336), Expect = 3.223e-34
Identity = 83/221 (37.56%), Postives = 126/221 (57.01%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYM---------------NAKDC----DYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++E +               +A +C     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGF 239          

HSP 2 Score: 52.7582 bits (125), Expect = 6.928e-7
Identity = 23/75 (30.67%), Postives = 46/75 (61.33%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   ++++ + F
Sbjct:  389 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF 463          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: HNRNPK (heterogeneous nuclear ribonucleoprotein K [Source:HGNC Symbol;Acc:HGNC:5044])

HSP 1 Score: 134.035 bits (336), Expect = 3.223e-34
Identity = 83/221 (37.56%), Postives = 126/221 (57.01%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYM---------------NAKDC----DYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++E +               +A +C     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGF 239          

HSP 2 Score: 52.7582 bits (125), Expect = 6.928e-7
Identity = 23/75 (30.67%), Postives = 46/75 (61.33%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   ++++ + F
Sbjct:  389 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF 463          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: HNRNPK (heterogeneous nuclear ribonucleoprotein K [Source:HGNC Symbol;Acc:HGNC:5044])

HSP 1 Score: 134.035 bits (336), Expect = 3.366e-34
Identity = 83/221 (37.56%), Postives = 126/221 (57.01%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYM---------------NAKDC----DYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++E +               +A +C     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGF 239          

HSP 2 Score: 55.8398 bits (133), Expect = 8.680e-8
Identity = 26/76 (34.21%), Postives = 48/76 (63.16%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAE-EGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   +++A+ EGF
Sbjct:  389 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYADVEGF 464          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: HNRNPK (heterogeneous nuclear ribonucleoprotein K [Source:HGNC Symbol;Acc:HGNC:5044])

HSP 1 Score: 134.035 bits (336), Expect = 3.366e-34
Identity = 83/221 (37.56%), Postives = 126/221 (57.01%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYM---------------NAKDC----DYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++E +               +A +C     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGF 239          

HSP 2 Score: 55.8398 bits (133), Expect = 8.680e-8
Identity = 26/76 (34.21%), Postives = 48/76 (63.16%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAE-EGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   +++A+ EGF
Sbjct:  389 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYADVEGF 464          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Match: hrpk-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) K homolog [Source:UniProtKB/TrEMBL;Acc:Q8I7G9])

HSP 1 Score: 128.257 bits (321), Expect = 4.679e-33
Identity = 77/202 (38.12%), Postives = 110/202 (54.46%), Query Frame = 2
Query:   89 ESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPD-NYDESIAPDYGGF 691
            E+  + KFE       R L+ SK+AGA+IGKGGE IKRLR E N  + VPDS  PER+  +     TVL I  D+LP +++  + +               D  ++RM+VH+S AGA+IG+ G +I+ L +      +K++    P STDRV+    + +NV+  +  V + L    IKG+   Y P  NYD S   DYGGF
Sbjct:   26 EAIQQGKFEV------RLLVSSKSAGAIIGKGGENIKRLRAEFNAHVQVPDSNTPERVCTVTADEKTVLNILKDVLPRLEDNFSER---------------DPCEVRMLVHQSHAGALIGRNGSKIKELRE-KCSARLKIFTGCAPGSTDRVLITSGEQKNVLGIIEEVMKELKEIPIKGSATPYLPAFNYDPSNISDYGGF 205          

HSP 2 Score: 49.6766 bits (117), Expect = 2.383e-6
Identity = 21/70 (30.00%), Postives = 40/70 (57.14%), Query Frame = 2
Query:  923 MNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCAR 1132
            + T+++T+P +L   ++G+ G R+  + +E GA I +E       + +  I+G+  QI+  Q L+Q C R
Sbjct:  299 VTTAQVTIPSDLGGTIIGRGGERIARIRQESGAQITLEQSN-GQPERIITIKGTEQQIHSAQYLLQQCVR 367          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Match: hrpk-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) K homolog [Source:UniProtKB/TrEMBL;Acc:Q8I7G9])

HSP 1 Score: 128.257 bits (321), Expect = 4.679e-33
Identity = 77/202 (38.12%), Postives = 110/202 (54.46%), Query Frame = 2
Query:   89 ESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPD-NYDESIAPDYGGF 691
            E+  + KFE       R L+ SK+AGA+IGKGGE IKRLR E N  + VPDS  PER+  +     TVL I  D+LP +++  + +               D  ++RM+VH+S AGA+IG+ G +I+ L +      +K++    P STDRV+    + +NV+  +  V + L    IKG+   Y P  NYD S   DYGGF
Sbjct:   26 EAIQQGKFEV------RLLVSSKSAGAIIGKGGENIKRLRAEFNAHVQVPDSNTPERVCTVTADEKTVLNILKDVLPRLEDNFSER---------------DPCEVRMLVHQSHAGALIGRNGSKIKELRE-KCSARLKIFTGCAPGSTDRVLITSGEQKNVLGIIEEVMKELKEIPIKGSATPYLPAFNYDPSNISDYGGF 205          

HSP 2 Score: 49.6766 bits (117), Expect = 2.383e-6
Identity = 21/70 (30.00%), Postives = 40/70 (57.14%), Query Frame = 2
Query:  923 MNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCAR 1132
            + T+++T+P +L   ++G+ G R+  + +E GA I +E       + +  I+G+  QI+  Q L+Q C R
Sbjct:  299 VTTAQVTIPSDLGGTIIGRGGERIARIRQESGAQITLEQSN-GQPERIITIKGTEQQIHSAQYLLQQCVR 367          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Match: hrpk-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) K homolog [Source:UniProtKB/TrEMBL;Acc:Q8I7G9])

HSP 1 Score: 128.257 bits (321), Expect = 6.408e-33
Identity = 77/202 (38.12%), Postives = 110/202 (54.46%), Query Frame = 2
Query:   89 ESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPD-NYDESIAPDYGGF 691
            E+  + KFE       R L+ SK+AGA+IGKGGE IKRLR E N  + VPDS  PER+  +     TVL I  D+LP +++  + +               D  ++RM+VH+S AGA+IG+ G +I+ L +      +K++    P STDRV+    + +NV+  +  V + L    IKG+   Y P  NYD S   DYGGF
Sbjct:   43 EAIQQGKFEV------RLLVSSKSAGAIIGKGGENIKRLRAEFNAHVQVPDSNTPERVCTVTADEKTVLNILKDVLPRLEDNFSER---------------DPCEVRMLVHQSHAGALIGRNGSKIKELRE-KCSARLKIFTGCAPGSTDRVLITSGEQKNVLGIIEEVMKELKEIPIKGSATPYLPAFNYDPSNISDYGGF 222          

HSP 2 Score: 49.6766 bits (117), Expect = 2.366e-6
Identity = 21/70 (30.00%), Postives = 40/70 (57.14%), Query Frame = 2
Query:  923 MNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCAR 1132
            + T+++T+P +L   ++G+ G R+  + +E GA I +E       + +  I+G+  QI+  Q L+Q C R
Sbjct:  316 VTTAQVTIPSDLGGTIIGRGGERIARIRQESGAQITLEQSN-GQPERIITIKGTEQQIHSAQYLLQQCVR 384          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Match: pes-4 (Patterned Expression Site [Source:UniProtKB/TrEMBL;Acc:Q95Y67])

HSP 1 Score: 76.6406 bits (187), Expect = 5.706e-15
Identity = 51/171 (29.82%), Postives = 86/171 (50.29%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNP 649
            R L+  K  G++IGK G+ IK++R E   +I + D   PER+V I G+   +   +N +    +E M         S  K       I +R+IV  +Q G++IGKGG +I+++ +    +I    +M  P+ST+R V +    + +  C+  V ++L     KG+   Y P
Sbjct:   75 RLLMQGKEVGSIIGKKGDQIKKIREESGAKINISDGSCPERIVTITGTLGVIGKAFNMVCNKFEEDM----LLLPNSVPK-----PPITMRVIVPATQCGSLIGKGGSKIKDIREATGASIQVASEML-PHSTERAVTLSGTADAINLCMTQVCQILLEAPPKGSTITYRP 235          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Match: hrpk-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) K homolog [Source:UniProtKB/TrEMBL;Acc:Q8I7G9])

HSP 1 Score: 58.151 bits (139), Expect = 1.217e-10
Identity = 31/57 (54.39%), Postives = 37/57 (64.91%), Query Frame = 2
Query:   89 ESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPER 259
            E+  + KFE       R L+ SK+AGA+IGKGGE IKRLR E N  + VPDS  PER
Sbjct:   43 EAIQQGKFEV------RLLVSSKSAGAIIGKGGENIKRLRAEFNAHVQVPDSNTPER 93          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: HnRNP-K (gene:FBgn0267791 transcript:FBtr0086221)

HSP 1 Score: 125.176 bits (313), Expect = 4.244e-31
Identity = 72/197 (36.55%), Postives = 108/197 (54.82%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDE-IDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIA 673
            ++  N++  ET+     R LIPS  AGA+IGKGG+ I+++RT++   + V DSQGPER + I     + L I  ++L                   KY E  DE  D+R+++H+S AG VIGKGG++I+ + D      +K++    P STDRVV+ V K   V+  +  V  L  +  IKGA  +Y+P N+D   A
Sbjct:   20 DQKRNRRNEETV-----RILIPSSIAGAVIGKGGQHIQKMRTQYKATVSVDDSQGPERTIQISADIESTLEIITEML-------------------KYFEERDEDFDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVVQTVGKQSQVIEAVREVITLTRDTPIKGAIHNYDPMNFDRVYA 192          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: HnRNP-K (gene:FBgn0267791 transcript:FBtr0301760)

HSP 1 Score: 124.79 bits (312), Expect = 4.451e-31
Identity = 70/196 (35.71%), Postives = 109/196 (55.61%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIA 673
            ++  N++  ET+     R LIPS  AGA+IGKGG+ I+++RT++   + V DSQGPER + I     + L I  ++L    +Y   +D D+              D+R+++H+S AG VIGKGG++I+ + D      +K++    P STDRVV+ V K   V+  +  V  L  +  IKGA  +Y+P N+D   A
Sbjct:   14 DQKRNRRNEETV-----RILIPSSIAGAVIGKGGQHIQKMRTQYKATVSVDDSQGPERTIQISADIESTLEIITEML----KYFEERDEDF--------------DVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVVQTVGKQSQVIEAVREVITLTRDTPIKGAIHNYDPMNFDRVYA 186          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: HnRNP-K (gene:FBgn0267791 transcript:FBtr0086220)

HSP 1 Score: 124.79 bits (312), Expect = 4.770e-31
Identity = 72/197 (36.55%), Postives = 108/197 (54.82%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDE-IDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIA 673
            ++  N++  ET+     R LIPS  AGA+IGKGG+ I+++RT++   + V DSQGPER + I     + L I  ++L                   KY E  DE  D+R+++H+S AG VIGKGG++I+ + D      +K++    P STDRVV+ V K   V+  +  V  L  +  IKGA  +Y+P N+D   A
Sbjct:   14 DQKRNRRNEETV-----RILIPSSIAGAVIGKGGQHIQKMRTQYKATVSVDDSQGPERTIQISADIESTLEIITEML-------------------KYFEERDEDFDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVVQTVGKQSQVIEAVREVITLTRDTPIKGAIHNYDPMNFDRVYA 186          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: HnRNP-K (gene:FBgn0267791 transcript:FBtr0336730)

HSP 1 Score: 124.79 bits (312), Expect = 4.770e-31
Identity = 72/197 (36.55%), Postives = 108/197 (54.82%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDE-IDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIA 673
            ++  N++  ET+     R LIPS  AGA+IGKGG+ I+++RT++   + V DSQGPER + I     + L I  ++L                   KY E  DE  D+R+++H+S AG VIGKGG++I+ + D      +K++    P STDRVV+ V K   V+  +  V  L  +  IKGA  +Y+P N+D   A
Sbjct:   14 DQKRNRRNEETV-----RILIPSSIAGAVIGKGGQHIQKMRTQYKATVSVDDSQGPERTIQISADIESTLEIITEML-------------------KYFEERDEDFDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVVQTVGKQSQVIEAVREVITLTRDTPIKGAIHNYDPMNFDRVYA 186          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: mub (gene:FBgn0262737 transcript:FBtr0078470)

HSP 1 Score: 95.5153 bits (236), Expect = 2.140e-21
Identity = 83/336 (24.70%), Postives = 139/336 (41.37%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGG--FISKDSRNPPRRNMQQP-DDFMPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRI-NPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMG---DSVFIIRGSPDQIYKTQCLMQL 1123
            R ++  K  G++IGK GEI+ R R E   +I + D   PER+V + G+ + +   +  I    +E+     C       K   G  +I +R+IV  SQ G++IGK G +I+ +      +I    +M  PNST+R V +    E +  C+  +  ++     +GA   Y P        P   G   ++       + N   P  +   +P A        G +    GG+               +  L G  LR  NP N         +TV  +L+  ++GK G ++ ++ +  GA I +       G   D    I G+PD +   Q L+ +
Sbjct:   27 RLIMQGKEVGSIIGKKGEIVNRFREESGAKINISDGSCPERIVTVSGTTNAIFSAFTLITKKFEEW-----CSQFNDVGKV--GKTQIPIRLIVPASQCGSLIGKSGSKIKEIRQTTGCSIQVASEML-PNSTERAVTLSGSAEQITQCIYQICLVMLESPPRGATIPYRPK-------PQVTGPVILANGQAFTIQGNYAVPTQEVAKNPLASLAALGLAGMNPASTGGIN----------HTAALAALAGSQLRTANPANRAQ-QQQHEMTVSNDLIGCIIGKGGTKIAEIRQISGAMIRISNCEEREGGNTDRTITISGNPDSVALAQYLINM 336          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:ZFIN;Acc:ZDB-GENE-040426-1926])

HSP 1 Score: 146.747 bits (369), Expect = 2.413e-39
Identity = 78/185 (42.16%), Postives = 114/185 (61.62%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ +     TV  I   I+P+++EY + K  D+            + +LR+++H+S AG++IG  G +I+ L D    T IKL++  CP STDRVV +  K E V+ C+  + EL+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   46 RILLQSKNAGAVIGKGGKNIKALRTDYNATVSVPDSSGPERILSVSADIPTVAEILLKIIPTLEEYQHHKGVDF------------DCELRLLIHQSLAGSIIGLKGAKIKELRDS-TQTTIKLFQECCPQSTDRVVLVGGKAERVVQCIKTMLELIVEAPIKGRAQQYDPNFYDETY--DYGGF 215          

HSP 2 Score: 52.373 bits (124), Expect = 5.495e-7
Identity = 29/92 (31.52%), Postives = 53/92 (57.61%), Query Frame = 2
Query:  869 NDLFGGSLR-----INPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCA 1129
            ND +GGS+       +  +D  ++ T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q  A
Sbjct:  319 NDRYGGSMNDGYGGRSSYSDGPVI-TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLQGSEDRIITITGTQDQIQNAQYLLQNSA 409          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:ZFIN;Acc:ZDB-GENE-040426-1926])

HSP 1 Score: 146.747 bits (369), Expect = 2.940e-39
Identity = 78/185 (42.16%), Postives = 114/185 (61.62%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ +     TV  I   I+P+++EY + K  D+            + +LR+++H+S AG++IG  G +I+ L D    T IKL++  CP STDRVV +  K E V+ C+  + EL+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   46 RILLQSKNAGAVIGKGGKNIKALRTDYNATVSVPDSSGPERILSVSADIPTVAEILLKIIPTLEEYQHHKGVDF------------DCELRLLIHQSLAGSIIGLKGAKIKELRDS-TQTTIKLFQECCPQSTDRVVLVGGKAERVVQCIKTMLELIVEAPIKGRAQQYDPNFYDETY--DYGGF 215          

HSP 2 Score: 51.9878 bits (123), Expect = 8.442e-7
Identity = 28/89 (31.46%), Postives = 52/89 (58.43%), Query Frame = 2
Query:  869 NDLFGGSLR-----INPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQ 1120
            ND +GGS+       +  +D  ++ T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q
Sbjct:  319 NDRYGGSMNDGYGGRSSYSDGPVI-TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLQGSEDRIITITGTQDQIQNAQYLLQ 406          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:ZFIN;Acc:ZDB-GENE-040426-1926])

HSP 1 Score: 146.747 bits (369), Expect = 3.149e-39
Identity = 78/185 (42.16%), Postives = 114/185 (61.62%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ +     TV  I   I+P+++EY + K  D+            + +LR+++H+S AG++IG  G +I+ L D    T IKL++  CP STDRVV +  K E V+ C+  + EL+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   46 RILLQSKNAGAVIGKGGKNIKALRTDYNATVSVPDSSGPERILSVSADIPTVAEILLKIIPTLEEYQHHKGVDF------------DCELRLLIHQSLAGSIIGLKGAKIKELRDS-TQTTIKLFQECCPQSTDRVVLVGGKAERVVQCIKTMLELIVEAPIKGRAQQYDPNFYDETY--DYGGF 215          

HSP 2 Score: 51.9878 bits (123), Expect = 8.970e-7
Identity = 23/67 (34.33%), Postives = 41/67 (61.19%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCA 1129
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q  A
Sbjct:  355 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLQGSEDRIITITGTQDQIQNAQYLLQNSA 421          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:ZFIN;Acc:ZDB-GENE-040426-1926])

HSP 1 Score: 146.747 bits (369), Expect = 3.149e-39
Identity = 78/185 (42.16%), Postives = 114/185 (61.62%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ +     TV  I   I+P+++EY + K  D+            + +LR+++H+S AG++IG  G +I+ L D    T IKL++  CP STDRVV +  K E V+ C+  + EL+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   46 RILLQSKNAGAVIGKGGKNIKALRTDYNATVSVPDSSGPERILSVSADIPTVAEILLKIIPTLEEYQHHKGVDF------------DCELRLLIHQSLAGSIIGLKGAKIKELRDS-TQTTIKLFQECCPQSTDRVVLVGGKAERVVQCIKTMLELIVEAPIKGRAQQYDPNFYDETY--DYGGF 215          

HSP 2 Score: 51.9878 bits (123), Expect = 8.970e-7
Identity = 23/67 (34.33%), Postives = 41/67 (61.19%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCA 1129
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q  A
Sbjct:  355 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLQGSEDRIITITGTQDQIQNAQYLLQNSA 421          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K, like [Source:ZFIN;Acc:ZDB-GENE-040426-1923])

HSP 1 Score: 142.895 bits (359), Expect = 7.987e-38
Identity = 90/246 (36.59%), Postives = 134/246 (54.47%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFI---SKDSRNP----PRRNMQQPDDFMPHPNAFARPPIPHGYDD 802
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ +     T+  I   I+P+++EY +    D+            + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K E V+ C+  + EL+    IKG  + Y+P+ YDE+   DYGGF     +  R P    P R     D   P   + + PP    YDD
Sbjct:   30 EEQAFKRSRNTDEMVELRVLLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSVSADIDTIGEILLKIIPTLEEYQHYSGTDF------------DCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLVGGKPERVVECIKVILELIAEAPIKGRAQPYDPNFYDETY--DYGGFTMMYEERGRRPMGGFPMRGRGGFDRMPPGRGSRSVPPSRRDYDD 260          

HSP 2 Score: 52.373 bits (124), Expect = 6.144e-7
Identity = 23/75 (30.67%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   ++++   F
Sbjct:  346 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGRFF 420          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:NCBI gene;Acc:394952])

HSP 1 Score: 139.428 bits (350), Expect = 1.454e-36
Identity = 78/202 (38.61%), Postives = 120/202 (59.41%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++EY + K  D+            + +LR+++H+S AG +IG  G +I+ L +    T IKL++  CP+STDRVV +  K + V+ C+  + +L+    +KG  + Y+P+ YDE+   DYGGF
Sbjct:   26 EEQAFKRSRNTDMMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEYQHFKGNDF------------DCELRLLIHQSLAGGIIGVKGAKIKELRE-KTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKVILDLISESPVKGRSQPYDPNFYDETY--DYGGF 212          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Match: ENSXETT00000046760.1 (poly(rC) binding protein 3 [Source:NCBI gene;Acc:100490531])

HSP 1 Score: 94.3597 bits (233), Expect = 8.588e-21
Identity = 80/349 (22.92%), Postives = 146/349 (41.83%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNMQ-------------QPDDFMPHPNAFAR---------PPIPHGYDDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRINPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLM 1117
            R L+  K  G++IGK GE +K++R E   RI + +   PER+V I G    +   +  I    +E +     +   +S         + LR++V  SQ G++IGKGG +I+ + +     +     M  PNST+R V +    + ++ C+  +  ++     KGA   Y P      +    GG +  D       N+              Q    +PHP+   +         P  P G     + G +   +P ++        +L G S  ++  +     +T  +T+P +L+  ++G+ G ++ ++ +  GA I++        +    I GSP  I   Q L+
Sbjct:   17 RLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSTATS------KPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDML-PNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPASAPVI-FAGGQVRADPLGASTANLSLLLQHQPLPAYSIQGQYAIPHPDQLTKLHQLAMQQTPFTPLGQTTPAFPGEK---LPLHS---SEEAQNLMGQSAGMDASSQ---ASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIASAMEGSAERQITITGSPANISLAQYLI 348          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Match: ENSXETT00000046774.1 (poly(rC) binding protein 3 [Source:NCBI gene;Acc:100490531])

HSP 1 Score: 93.2041 bits (230), Expect = 1.651e-20
Identity = 80/335 (23.88%), Postives = 141/335 (42.09%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNMQQPDDFMPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPI-------MDRGVNDLFGGSLRINPVNDINIM-NTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLM 1117
            R L+  K  G++IGK GE +K++R E   RI + +   PER+V I G    +   +  I    +E +     +   +S         + LR++V  SQ G++IGKGG +I+ + +     +     M  PNST+R V +    + ++ C+  +  ++     KGA   Y P      +    GG +  D       N+      + H       P+P     G Y       IPH + +       M +      G +    P  D +   +T  +T+P +L+  ++G+ G ++ ++ +  GA I++        +    I GSP  I   Q L+
Sbjct:   17 RLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSTATS------KPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDML-PNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPASAPVI-FAGGQVRADPLGASTANL---SLLLQH------QPLPAYSIQGQYA------IPHPDQLTKLHQLAMQQTPFTPLGQTTPAFPGMDASSQASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIASAMEGSAERQITITGSPANISLAQYLI 328          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Match: cert1 (ceramide transporter 1 [Source:Xenbase;Acc:XB-GENE-1002414])

HSP 1 Score: 92.4337 bits (228), Expect = 2.300e-20
Identity = 76/332 (22.89%), Postives = 146/332 (43.98%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNMQQPDDFMPHPNAFARP--PIPHGYDDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRINPVNDINIMNTS-RITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQL 1123
            R L+  K  G++IGK GE +K++R E   RI + +   PER++ + G  + +   ++ I+  ++E +++   +   SS         + LR++V  SQ G++IGKGG +I+ + +     +     M  PNST+R + +    ++++ C+  +  ++     KG    Y P      +    G   +       +  + QPD    H  A  +   P+ H  + G  G  + +  P+N  I                   D +   TS  +T+P +L+  ++G+ G ++ ++ +  GA I++        D    I GS   I   Q L+ +
Sbjct:   17 RLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFSMIIDKLEEDISSSMTNSTASS------KPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDML-PNSTERAITIAGIPQSIIECVKQICVVMLESPPKGVTIPYRPKPSSSPVIFAGGQAYTIQG----QYAIPQPDLTKLHQLAMQQSHFPMSHSGNTGFSG--KNICFPYNCGI-------------------DASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSNDRQVTITGSTASISLAQYLINM 316          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Match: cert1 (ceramide transporter 1 [Source:Xenbase;Acc:XB-GENE-1002414])

HSP 1 Score: 90.5077 bits (223), Expect = 1.032e-19
Identity = 77/341 (22.58%), Postives = 146/341 (42.82%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNMQQPDDFMPHPNAFARP--PIPHGYDDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRINPVNDINIMNTS-RITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEG 1150
            R L+  K  G++IGK GE +K++R E   RI + +   PER++ + G  + +   ++ I+  ++E +++   +   SS         + LR++V  SQ G++IGKGG +I+ + +     +     M  PNST+R + +    ++++ C+  +  ++     KG    Y P      +    G   +       +  + QPD    H  A  +   P+ H  + G  GG+                              D +   TS  +T+P +L+  ++G+ G ++ ++ +  GA I++        D    I GS   I   Q L+ +  R  +E G
Sbjct:   17 RLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFSMIIDKLEEDISSSMTNSTASS------KPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDML-PNSTERAITIAGIPQSIIECVKQICVVMLESPPKGVTIPYRPKPSSSPVIFAGGQAYTIQG----QYAIPQPDLTKLHQLAMQQSHFPMSHSGNTGFSGGI------------------------------DASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSNDRQVTITGSTASISLAQYLINV--RLSSEAG 314          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:MGI Symbol;Acc:MGI:99894])

HSP 1 Score: 142.124 bits (357), Expect = 1.192e-38
Identity = 82/202 (40.59%), Postives = 123/202 (60.89%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++EY +     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEYQH-----YKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGF 215          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:MGI Symbol;Acc:MGI:99894])

HSP 1 Score: 141.739 bits (356), Expect = 2.514e-37
Identity = 93/245 (37.96%), Postives = 135/245 (55.10%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF--ISKDSRNP----PRRNMQQPDDFMPHPNAFARPPIPHGYDD 802
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++EY +     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF  +  D R      P R     D   P       PP    YDD
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEYQH-----YKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDD 258          

HSP 2 Score: 53.1434 bits (126), Expect = 4.264e-7
Identity = 23/75 (30.67%), Postives = 46/75 (61.33%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   ++++ + F
Sbjct:  365 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF 439          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:MGI Symbol;Acc:MGI:99894])

HSP 1 Score: 141.739 bits (356), Expect = 2.530e-37
Identity = 93/245 (37.96%), Postives = 135/245 (55.10%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF--ISKDSRNP----PRRNMQQPDDFMPHPNAFARPPIPHGYDD 802
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++EY +     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF  +  D R      P R     D   P       PP    YDD
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEYQH-----YKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDD 258          

HSP 2 Score: 55.8398 bits (133), Expect = 5.137e-8
Identity = 26/76 (34.21%), Postives = 48/76 (63.16%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAE-EGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   +++A+ EGF
Sbjct:  365 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYADVEGF 440          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:MGI Symbol;Acc:MGI:99894])

HSP 1 Score: 134.42 bits (337), Expect = 3.692e-36
Identity = 83/221 (37.56%), Postives = 126/221 (57.01%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYM---------------NAKDC----DYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++E +               +A +C     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGF 239          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:MGI Symbol;Acc:MGI:99894])

HSP 1 Score: 134.035 bits (336), Expect = 2.213e-34
Identity = 83/221 (37.56%), Postives = 126/221 (57.01%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYM---------------NAKDC----DYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++E +               +A +C     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGF 239          

HSP 2 Score: 52.7582 bits (125), Expect = 4.756e-7
Identity = 23/75 (30.67%), Postives = 46/75 (61.33%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   ++++ + F
Sbjct:  389 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF 463          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|Q5ZIQ3|HNRPK_CHICK (Heterogeneous nuclear ribonucleoprotein K OS=Gallus gallus OX=9031 GN=HNRNPK PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 2.340e-37
Identity = 93/245 (37.96%), Postives = 136/245 (55.51%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF--ISKDSRNP----PRRNMQQPDDFMPHPNAFARPPIPHGYDD 802
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++EY +     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF  +  D R      P R     D   P+      PP    YDD
Sbjct:   26 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADTETIGEILKKIIPTLEEYQH-----YKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPNRGGRPMPPSRRDYDD 255          

HSP 2 Score: 52.373 bits (124), Expect = 4.265e-6
Identity = 23/75 (30.67%), Postives = 46/75 (61.33%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   ++++ + F
Sbjct:  353 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF 427          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|P61980|HNRPK_RAT (Heterogeneous nuclear ribonucleoprotein K OS=Rattus norvegicus OX=10116 GN=Hnrnpk PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.548e-33
Identity = 83/221 (37.56%), Postives = 126/221 (57.01%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYM---------------NAKDC----DYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++E +               +A +C     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGF 239          

HSP 2 Score: 52.7582 bits (125), Expect = 3.327e-6
Identity = 23/75 (30.67%), Postives = 46/75 (61.33%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   ++++ + F
Sbjct:  389 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF 463          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|P61979|HNRPK_MOUSE (Heterogeneous nuclear ribonucleoprotein K OS=Mus musculus OX=10090 GN=Hnrnpk PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.548e-33
Identity = 83/221 (37.56%), Postives = 126/221 (57.01%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYM---------------NAKDC----DYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++E +               +A +C     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGF 239          

HSP 2 Score: 52.7582 bits (125), Expect = 3.327e-6
Identity = 23/75 (30.67%), Postives = 46/75 (61.33%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   ++++ + F
Sbjct:  389 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF 463          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|P61978|HNRPK_HUMAN (Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.548e-33
Identity = 83/221 (37.56%), Postives = 126/221 (57.01%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYM---------------NAKDC----DYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++E +               +A +C     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGF 239          

HSP 2 Score: 52.7582 bits (125), Expect = 3.327e-6
Identity = 23/75 (30.67%), Postives = 46/75 (61.33%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   ++++ + F
Sbjct:  389 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF 463          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|Q5R5H8|HNRPK_PONAB (Heterogeneous nuclear ribonucleoprotein K OS=Pongo abelii OX=9601 GN=HNRNPK PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.616e-33
Identity = 83/221 (37.56%), Postives = 126/221 (57.01%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYM---------------NAKDC----DYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ I     T+  I   I+P+++E +               +A +C     YKGS       D + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + +L+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGS-------DFDCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGF 239          

HSP 2 Score: 55.8398 bits (133), Expect = 4.169e-7
Identity = 26/76 (34.21%), Postives = 48/76 (63.16%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAE-EGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   +++A+ EGF
Sbjct:  389 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYADVEGF 464          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: A0A023ZS14 (Heterogeneous nuclear ribonucleoprotein K OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.165e-55
Identity = 120/375 (32.00%), Postives = 204/375 (54.40%), Query Frame = 2
Query:  110 FETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEG-------DDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRN---------PPRRNMQQP---DDFMPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRINPVNDINI------MNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDS--VFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            F++     +RFLIP  AAGA+I K GE IKRLR  ++C I VP S GPERL+II+     + G+ ++I   +K+ M++K  D K      I G         ++DLR +V E+  GA+IGKGGE IR L + + +++IK+Y+  CP+STDRV+R+V   E++++CL  + +++ +     + ++Y+P+N++E  A +YGG++S ++R          PP +   +       +      A  P    +  GM  G     +   N +MD G   ++G  +    +  +++      +  S +++P  L+ A++GK G R+ ++  E GA I+++   M+   S  +  I+GS DQI   Q L+Q C RK+  + F
Sbjct:   17 FKSFRNLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPK----DIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 387          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: A0A267GC81 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033523g1 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.219e-52
Identity = 129/383 (33.68%), Postives = 196/383 (51.17%), Query Frame = 2
Query:   53 DSRKRRFLSNAEESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNMQQPDDF--MPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPIMDRGVNDL----FGGSLRINPVNDI-------------NIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMG-DSVFIIRGSPDQIYKTQCLMQLCARKFA 1141
            D  KR  + +  E  +K++F T S    RFLIPSK AG +IGKGG  IKR+R E++ ++ VPDS GPER+  ++G P T+  I  D+  ++ E    +D      SS       EID+R++VH+SQAG VIGK G +I+ L +   +  +K+Y   CP STDRVV++V   E ++  +  V ELL+    KG   +Y+  N+DE     YGG+I        R     PD    M  P  +   P PH       GG+ P   P     M RG   L     GG+++                     +  T ++++P +L  +++G+ G+R+  +  E GA I  ++D+   G D +  IRGS +QI   Q L+Q+C +K++
Sbjct:    6 DDLKRSNMDHTNEPPSKRQF-TGSRIELRFLIPSKMAGVIIGKGGSNIKRMREEYSAKVSVPDSNGPERVFTLEGEPDTLQSILRDLFNALLEESAGRDSHQGAVSST-----GEIDMRLLVHQSQAGCVIGKAGAKIKELREESRLRALKVYSNPCPVSTDRVVQLVGAPEELLKSIQMVLELLELAPPKGQVANYDARNFDEFNYEQYGGWIGGGQTRSVR-----PDGIGNMGGPVGYGAAP-PHHMG---RGGMPPQ--PAAPQAMQRGGPQLGGPPMGGAMQPGAPPPPPGAFGGPRPGAPRGMETTQQVSIPDSLTGSIMGRGGQRIKQIRMESGADI--KIDKGEPGQDRIITIRGSQEQIQNAQYLLQMCVKKYS 369          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: A0A2C9JPR1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106062761 PE=4 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 1.905e-48
Identity = 121/344 (35.17%), Postives = 174/344 (50.58%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNMQQPDDFMPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPIMDRGV-------NDLFGGSLRINPVNDINI----MNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARK 1135
            R L+ SK AGA+IGKGG  I RLR ++   + VPDS GPER++ I     TVL +  DILP +++  N +              D E +LRMIVH+SQAG +IG+ G +++ L +     I K+Y   CPNSTDRVV +  K + V+ C+  + ELL     KG    Y+P   DE +AP+YGGFI+ D R             +P   A    P P G    M G    MN+  NN  + RG         D  G    +     +        T+++T+P++L  A++GK G R+ D+ R  GA I ++       D +  I G+PDQI   Q L+Q+  ++
Sbjct:   38 RILMQSKNAGAIIGKGGANINRLRNDYKASVTVPDSNGPERVLSIGAELGTVLDMLLDILPEMEDSRNKRS-------------DSESELRMIVHQSQAGCIIGRQGFKVKELREKTGANI-KVYSTCCPNSTDRVVAITGKPKIVVGCIEEIIELLQQAPPKGPINPYDPSFSDEFLAPEYGGFITGDIR---------ASKGLPRGAA----PPPRGLRGAMRG---RMNMNANNLGLGRGFGGGFGMQQDFSGDMTNLGGGQGMAFGDEECETTQVTIPKDLAGAIIGKGGSRITDIRRRSGAMIVIDEPLPGSNDRIISISGTPDQIQNAQYLLQMSVKQ 351          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: C1LR27 (Heterogeneous nuclear ribonucleoprotein K OS=Schistosoma japonicum OX=6182 GN=hnRNP-K PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 4.420e-48
Identity = 91/206 (44.17%), Postives = 139/206 (67.48%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYK------GSSSK----------YIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDS 706
            RFLIP +AAG MIGKGGE IK++R+++N ++ +PDS+GPER++ I+G    +  I  D+ P +K+ MNAK  D K      G+  +            E ++ ID R++VHESQAG+VIG+GGERI++L D + M +IK+Y+M  P STDRVV+MV+  +NV+ CL  V E +++   +G R+DY+  N+ E  A +YGG++S+++
Sbjct:   38 RFLIPGRAAGIMIGKGGENIKKIRSQYNVKLNIPDSRGPERIMTIEGDLQAICSIMRDVCPKLKDIMNAKLSDPKRIMGTQGARRRPRRNEDPERDDDEDENMIDFRILVHESQAGSVIGRGGERIKDLRDKYKMRVIKVYQMLAPLSTDRVVQMVADPDNVVQCLRAVIEAVESAPPRGRREDYDAANFSEGDALNYGGWLSREA 243          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: F1KWY9 (Heterogeneous nuclear ribonucleoprotein K OS=Ascaris suum OX=6253 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.335e-47
Identity = 117/357 (32.77%), Postives = 175/357 (49.02%), Query Frame = 2
Query:   62 KRRFLSNAEESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNMQQPDDFMPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRINPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCAR 1132
            KR+     +E+    K+E       R L+PS+ AGA+IGKGGE IKRLR E +  + +PDSQ PER+V I      V+   N+I+P + E +  +D D +GS+        E +LR++VH+S AGA+IG+GG RI+ L +    T +K+Y   CP ST+RV++++   E ++AC+  +  +L    IKG  + Y    YD +   +YGGF       PP RN +              P  P                P+    M  GV+          P      M T+++T+P  L   ++GK G R+  +  E GA I +E  + N  + +  I GS  QI   Q L+Q C R
Sbjct:   89 KRQRADGYQEALAAGKYEL------RLLVPSRGAGAVIGKGGESIKRLRAECDATLTIPDSQTPERIVTIVAEIDNVIRCVNEIIPRLDECLKTRDSDDEGSAR------GESELRLLVHQSHAGAIIGRGGYRIKELRE-ETSTQLKVYSQCCPQSTERVIQIIGVPEKIIACVILIINMLKEIPIKGPSRPYESMFYDPNFVHEYGGF-------PPDRNYRGMGPRGGMYGGGLPPRAP--------------RFPYGGRGMGMGVSPF-------PPAPFGGPMQTTQVTIPNELGGTIIGKGGERINRIREESGAHIVVEPQQPN-SERIITISGSHAQIQTAQYLLQQCVR 403          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:NCBI gene;Acc:103037234])

HSP 1 Score: 140.969 bits (354), Expect = 3.278e-37
Identity = 75/187 (40.11%), Postives = 115/187 (61.50%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFIS 697
            R L+ SK AGA+IGK G+ IK LRT++N  + VPDS GPER++ I      V  I   I+P+++EY + K  D+            + +LR+++H+S AG++IG  G +I+ L + +  T IKL++  CP STDRVV +  K E V+ C+  + EL++   IKG  + Y+P+ YDE+   DYGG+ +
Sbjct:   46 RVLLQSKNAGAVIGKAGKNIKALRTDYNATVSVPDSSGPERILSITAEIPIVAEILLKIIPTLEEYQHHKGVDF------------DCELRILIHQSLAGSIIGVKGAKIKELRE-NTQTTIKLFQECCPQSTDRVVLVGGKAEKVVECIKTMLELINEAPIKGRAQQYDPNFYDETY--DYGGYTT 217          

HSP 2 Score: 51.9878 bits (123), Expect = 7.562e-7
Identity = 23/67 (34.33%), Postives = 41/67 (61.19%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCA 1129
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q  A
Sbjct:  356 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLQGSEDRIITITGTQDQIQNAQYLLQNSA 422          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:103043638])

HSP 1 Score: 140.584 bits (353), Expect = 4.133e-37
Identity = 89/246 (36.18%), Postives = 131/246 (53.25%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF---ISKDSRNP----PRRNMQQPDDFMPHPNAFARPPIPHGYDD 802
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ +     T+  I   I+P+++EY +    D+            + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + EL     IKG  + Y+P+ YDE+   DYGGF     +  R P    P R     D   P       PP    YDD
Sbjct:   30 EEQAFKRSRNTDEMVELRVLLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSVSADIETIGEILLKIIPTLEEYQHYNGIDF------------DCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLVGGKPQRVVECIKVILELTSEAPIKGRAQPYDPNFYDETY--DYGGFTMMFEERGRRPMGGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDD 260          

HSP 2 Score: 51.9878 bits (123), Expect = 6.635e-7
Identity = 23/75 (30.67%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   ++++   F
Sbjct:  339 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGRFF 413          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:103043638])

HSP 1 Score: 140.198 bits (352), Expect = 6.306e-37
Identity = 89/246 (36.18%), Postives = 131/246 (53.25%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF---ISKDSRNP----PRRNMQQPDDFMPHPNAFARPPIPHGYDD 802
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ +     T+  I   I+P+++EY +    D+            + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + EL     IKG  + Y+P+ YDE+   DYGGF     +  R P    P R     D   P       PP    YDD
Sbjct:   30 EEQAFKRSRNTDEMVELRVLLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSVSADIETIGEILLKIIPTLEEYQHYNGIDF------------DCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLVGGKPQRVVECIKVILELTSEAPIKGRAQPYDPNFYDETY--DYGGFTMMFEERGRRPMGGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDD 260          

HSP 2 Score: 52.7582 bits (125), Expect = 4.309e-7
Identity = 23/75 (30.67%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   ++++   F
Sbjct:  358 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGRFF 432          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:103043638])

HSP 1 Score: 140.198 bits (352), Expect = 7.252e-37
Identity = 89/246 (36.18%), Postives = 131/246 (53.25%), Query Frame = 2
Query:   86 EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF---ISKDSRNP----PRRNMQQPDDFMPHPNAFARPPIPHGYDD 802
            EE + K+   T      R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ +     T+  I   I+P+++EY +    D+            + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K + V+ C+  + EL     IKG  + Y+P+ YDE+   DYGGF     +  R P    P R     D   P       PP    YDD
Sbjct:   30 EEQAFKRSRNTDEMVELRVLLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSVSADIETIGEILLKIIPTLEEYQHYNGIDF------------DCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLVGGKPQRVVECIKVILELTSEAPIKGRAQPYDPNFYDETY--DYGGFTMMFEERGRRPMGGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDD 260          

HSP 2 Score: 50.0618 bits (118), Expect = 2.852e-6
Identity = 22/64 (34.38%), Postives = 40/64 (62.50%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQ 1120
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q
Sbjct:  358 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQ 421          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: pcbp4 (poly(rC)-binding protein 4-like [Source:NCBI gene;Acc:103041973])

HSP 1 Score: 98.2117 bits (243), Expect = 6.694e-22
Identity = 78/344 (22.67%), Postives = 147/344 (42.73%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFI---------SKDSRNPPRRNMQQPDDFMPHPNAFARPPIPHG-----YDDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRINPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLC 1126
            R L+  K  G++IGK GE +KR+R E + RI + +   PER++ I G    V   +  I   ++E + A   +        +     + LR+++  SQ G++IGKGG +I+ + +     + ++     PNST+R V +    + ++ C+  +  ++     KGA   Y P       +P  G  +         S+   +P     Q   D         +  IPH      +   M  G+ P+  P   P++  G++               +   +  + +P +L+ +++G+ G ++ ++ +  GA I++     +  D    I GSP  I   Q L+  C
Sbjct:   30 RLLMHGKEVGSIIGKKGETVKRIREESSARINISEGSCPERIITITGPTECVFRAFTMITIKLEEDLTALVAN------GTVTSKPPVTLRLVIPASQCGSLIGKGGSKIKEIRESTGAQV-QVAGDLLPNSTERGVTISGSQDAIIQCVKLICTVILESPPKGATIPYRP-------SPSPGAVLLSGNQVFEASEFGSHPLFSVAQGALDLQQAYTVQNQYGIPHSELAKLHQLSMQQGLAPIAQPAATPVLPAGMDS-------------SSQTASQELLIPNDLIGSIIGRQGTKINEIRQVSGAQIKIGSQLDSTSDRHVTITGSPISINLAQYLITSC 346          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005114.1 (pep scaffold:Pmarinus_7.0:GL476545:177182:183416:1 gene:ENSPMAG00000004551.1 transcript:ENSPMAT00000005114.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 3.285e-24
Identity = 84/327 (25.69%), Postives = 139/327 (42.51%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNMQQPDDFMPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRINPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLM 1117
            R L+ SK  G++IGK GE +KR+R E   RI + D+  PER+V + G   ++   +  I   ++E M +        S   +     + LR++V  SQ G++IGK G +I+ L +      +++     PNST+R V +    + ++ C+  +  L+     KGA   Y P     S    + G  +   +   +  +  PD    H  A    P                      PI     N    G      V+    M+T  I++P NL+  ++GK G ++ ++ +  GA I++        D   II GSP  I   Q L+
Sbjct:   19 RLLMHSKEVGSIIGKKGEFVKRVREESGARINISDANCPERIVTVTGPMESIFLAFALITHKLEEDMGST------LSGGVMMSRPPVTLRLVVPASQCGSLIGKSGNKIQELRESTGAQ-VQVAGDLLPNSTERAVTISGTPDAIVQCVRQICVLMMESPPKGATIPYRPKPVSSSAPVIFAGGQAYTIQG--QYAIPNPDLTKLHQLAMQHTPF--------------------TPI-----NQASSGYQATPGVDASAQMSTHEISIPNNLIGCIIGKQGTKINEIRQMSGAQIKIASAIDGATDRQVIITGSPANISLAQYLI 311          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005105.1 (pep scaffold:Pmarinus_7.0:GL501087:1205:15413:-1 gene:ENSPMAG00000004637.1 transcript:ENSPMAT00000005105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 2.498e-19
Identity = 51/172 (29.65%), Postives = 85/172 (49.42%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPD 652
            R L+  K  G++IGK GE +K++R E   RI + +   PER+V I G    +   ++ I    +E +NA   +   +S         + LR++V  SQ G++IGKGG +I+ + +     +     M  PNST+R V +    E ++ C+  +  ++     KGA   Y P 
Sbjct:   17 RLLMHGKEVGSIIGKKGETVKKMREESGARINISEGSCPERIVTITGQTDAIFKAFSMITNKFEEDINASMANSAVTS------KPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDML-PNSTERAVTVSGAPEAIIQCVKQICVIMLESPPKGATIPYRPK 181          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Match: zgc:110045 (zgc:110045 [Source:ZFIN;Acc:ZDB-GENE-050706-149])

HSP 1 Score: 62.003 bits (149), Expect = 3.374e-12
Identity = 35/113 (30.97%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNL 475
            R L+ SK  G++IGK G+ +KR+R E   RI + D   PER+V + G    +   +  +   ++E M          ++  +     + LR++V  SQ G++IGK G +I+ L
Sbjct:   20 RLLMHSKEVGSIIGKKGDFVKRIRDESGSRINISDGNCPERIVTVTGPTEAIFRAFTMMTHKLEEDM------ISTMANSVVMNRPPVTLRLVVPASQCGSLIGKSGNKIKEL 126          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001813.1 (pep scaffold:Pmarinus_7.0:GL484105:1100:13677:-1 gene:ENSPMAG00000001644.1 transcript:ENSPMAT00000001813.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 3.829e-9
Identity = 43/146 (29.45%), Postives = 71/146 (48.63%), Query Frame = 2
Query:  134 HRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRI-IVPDSQG-PERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKY-IEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSK 562
              F +P +  G +IG+GGE I +L+ E  C+I I PDS G PER   + G+P  +      I     E +  +  D  GS   +   G       +++   + G VIGKGGE I++L +   + +I +     P   D+ +R++ +
Sbjct:  102 EEFKVPDRMVGLIIGRGGENISKLQNESGCKIQISPDSGGKPERPCSLTGTPEAIRDAKRLI-----EQIIERARDGPGSQGDHNNNGGGGGGGELMIPAGKVGLVIGKGGETIKHLQERAGVRMIMIQDGPMPTGVDKPLRIMGE 242          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009168.1 (pep scaffold:Pmarinus_7.0:GL479182:17814:35570:1 gene:ENSPMAG00000008286.1 transcript:ENSPMAT00000009168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 1.330e-8
Identity = 43/175 (24.57%), Postives = 80/175 (45.71%), Query Frame = 2
Query:  140 FLIPSKAAGAMIGKGGEIIKRLRTEHNCRI-IVPDSQG-PERLVIIDGSPSTVLG---IWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNP 649
            + +P K  G +IG+GGE I R++++  C++   PDS G  +R   + G+P  +     + + I+   +        D+   S +           M++   + G +IGKGGE I+ L D   + ++ +     P   D+ +R++ +   V      V ELL  +     R+D+ P
Sbjct:   90 YKVPDKMVGFIIGRGGENISRIQSDSGCKVQFAPDSGGQADRPCTLTGTPEAIAEAKRMLDQIVERGRIPPGPAGVDHTSHSQE-----------MMIPADKVGLIIGKGGETIKQLQDRAGVRMLLIQDGSQPTGADKPLRIMGEPFKVQQAKELVLELLREK----DREDFRP 249          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Yeast
Match: PBP2 (RNA binding protein; has similarity to mammalian heterogeneous nuclear RNP K protein, involved in the regulation of telomere position effect and telomere length; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000000437])

HSP 1 Score: 49.2914 bits (116), Expect = 5.571e-7
Identity = 76/356 (21.35%), Postives = 149/356 (41.85%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDS-QG-PERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDD-EIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPN----STDRVVRMVSKIENVMACLANVFELLDNQAIKGARKD------YNPDNYDESIAPDYGG----FISKDSRNPPRRNM--QQPDDFMPHPNAFARPPIPHGYDDGMYGGV--RPMNIPHNNPIMDRGV-NDLFGGSLRINPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKF 1138
            R L   K A  ++G  G  I R+++E + RI + ++ +G PER+V + G+   V   +  I+ ++ E    +D            G+D EI + +++     G +IGK G R+R + D   ++  KL+    PN    S DR++ +    + +      + + L N  ++  +K+      Y P  ++ S+  D+      F  ++ +  P   +   +P+  +P  +       P      +      +P  +  N  ++D  V +   G  L +N V          I + +  V  V+GKDG+ +  ++   G SI ++       +    IRG+      +Q  + L + K 
Sbjct:   70 RMLCLVKHASLIVGHKGATISRIKSETSARINISNNIRGVPERIVYVRGTCDDVAKAYGMIVRALLEEHGNED-----------NGEDIEISINLLIPHHLMGCIIGKRGSRLREIED---LSAAKLFA--SPNQLLLSNDRILTINGVPDAIHIATFYISQTLLNFQMESPQKNVKRSIYYQPTQFN-SVLIDHSQPNTIFHQRNHQYHPSDKLLSYKPNKNLPISSTLLSMATPQYTTASVANATAFQPNFVIPNVTVLDGPVISPAPGNHLLMNFVQQ-------EIFIDEKFVGNVIGKDGKHINSVKESTGCSIIIQDPVEGSSERRLTIRGT---FMASQAAIMLISNKI 398          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Nematostella
Match: EDO37243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGC0])

HSP 1 Score: 102.064 bits (253), Expect = 8.507e-24
Identity = 58/176 (32.95%), Postives = 92/176 (52.27%), Query Frame = 2
Query:  122 SPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNP 649
            +P   R LI SK AG +IGKGG  I+RLRTE+N  + VPD+   ER++ I     + L I  +++P I E                       +++M+V  SQ G++IG+ G +I+ + +G     +K++    PNST+RVV M    E ++ C+ NV   + N  +KG    ++P
Sbjct:   51 APTTLRILIQSKDAGGIIGKGGTNIRRLRTEYNAVVNVPDTNSNERVLTITAPRQSALDILAEVVPKIGEVQYGH------------------EIQMLVQRSQVGSIIGRAGYKIKEIREGSGAN-VKVFADCLPNSTERVVTMSGSAETIVKCVENVLVAIANAPLKGQVILFDP 207          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Nematostella
Match: EDO42485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C6])

HSP 1 Score: 70.0922 bits (170), Expect = 2.849e-13
Identity = 74/335 (22.09%), Postives = 135/335 (40.30%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNMQQPDDFMPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNP--IMDRGVNDLFGGSLRINPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARK 1135
            + ++  K  G++IGK G  IK+ R E N  I + D   PER+V + G+   V+  +  I   +++ +         S+SK       + LR+IV  SQ G++IGKGG +I+ + +    +++ +   F P S++R V +    E +  C+  +  ++     +G    Y P                          +QQ   F   P  F  P        G YG      +PH  P   M        G   +  P      + +  +T+ +  V +++G+ G  +  + +  GASI++            +I G+ + +   Q L+    R+
Sbjct:   30 KMIMQGKDIGSIIGKEGSTIKQFRQESNAHINISDGSTPERIVSVTGTKDAVVTAFALIGQKLEDELK--------SNSKS-NTTPPVTLRLIVPGSQCGSIIGKGGAKIKEIREVSGASVV-VAGEFLPGSSERAVTLSGTPEALETCIDLLCGVMIEFPPRGHPMPYTP------------------------HKLQQQFGFYGPPQGFGYP--------GPYG------MPHAFPNGFMAGRGPYGGGRKGKGPPPPQPGPITSHTMTILKGAVGSIIGQKGSYITGIRQMSGASIKIGDSENGDDKREVLITGTAEAVGLAQFLINARLRQ 316          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Nematostella
Match: EDO32483 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUX0])

HSP 1 Score: 54.6842 bits (130), Expect = 4.829e-8
Identity = 36/127 (28.35%), Postives = 63/127 (49.61%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIV---PDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKL 508
            R LIP K  GA+IG  G  IK++    N  I +    D +  ++LV I GSP         I   ++E  +A                +E+++R+++H+S AG +IG+ G  +++++D    + IK+
Sbjct:   80 RMLIPCKMVGAVIGTSGNKIKKITEATNTSIDIHRKEDRREVDKLVTIRGSPQDCSNANMQIHQLMREETDAN------------LRSNEVEMRLVIHDSHAGRIIGRKGNNLKSVMDETGASSIKV 194          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Nematostella
Match: EDO35692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKT2])

HSP 1 Score: 50.447 bits (119), Expect = 8.024e-7
Identity = 40/148 (27.03%), Postives = 76/148 (51.35%), Query Frame = 2
Query:   53 DSRKRRFLSN--AEESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRI-IVPDSQ----GPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNL 475
            DSRKR   ++    +   +  F     P  + L+P+ AAG++IGKGG+ I +++     RI + P++Q      ER+ +I G    ++ + + ++  I++    +    K S S   + +    +++IV  S AG +IGK G  I+++
Sbjct:   19 DSRKRPLEASPDTRQPYKRSNFGPAKSPILKILVPNYAAGSIIGKGGQNIAQVQQTTGARIKLSPNNQYYPGTQERIGLIMGEVENIVQMLDFVIDKIRQ----EPQGIKASMSISFDRERAKQMKIIVPNSTAGMIIGKAGSAIKSI 162          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Nematostella
Match: EDO38203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDL7])

HSP 1 Score: 48.9062 bits (115), Expect = 3.123e-6
Identity = 83/349 (23.78%), Postives = 146/349 (41.83%), Query Frame = 2
Query:  146 IPSKAAGAMIGKGGEIIKRLRTEHNCRI-IVPDSQG-----PERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIK---------GARKD---YNPDNYDESIAPDYGGFISKDSRNPPRRNMQQPD---DFMP---HPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRINPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDR-MNMGDSVFIIRGSPDQIYKTQCLM 1117
            IP+K  G +IG+GGE I +L++E   RI + PD        P+R V I G+   V      +L  I E    K  D   S      G+  I+  M++  S+ G +IGKGGE I+NL +     ++ +      N+ ++ +R++            V +LL  + ++         G R+D         +  +  D  GF+        +R   +      F P   +PN+  R     G  + +    + +     N I+ +  +   GG     P  ++  +NT  + VP N    ++GK G  +  +    GA +E+  +   N     F+IRG+  QI + + ++
Sbjct:  163 IPNKYVGLVIGRGGEQINKLQSETGARIQVAPDPPAGMMSPPDRSVTIGGTVQAVEKA-KQVLNKICE--EGKIPDSLMSVPVVAPGEQVIE--MMIPASKVGLIIGKGGETIKNLQERAQCRMVMVQDGPYANAPEKPLRIMGDNTRCQRGKDLVTDLLTEKELEQSKPALDFLGKRQDNRQLGATTLEIPVPRDVVGFVIGKGGETIKRIQAESGARVQFNPAKDNPNSSDRMATVQGSQEQIQKVEKII-----NEIISQVESRQRGGPPPRGPPANMPGINTLEMPVPGNKCGLIIGKGGETIKQIIAVSGAHVELNRNVPENNPTKFFVIRGTDQQIQQAEKMI 501          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:NCBI gene;Acc:101169861])

HSP 1 Score: 167.162 bits (422), Expect = 4.867e-47
Identity = 121/384 (31.51%), Postives = 191/384 (49.74%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNM------------QQPDDFMPHPNAFARPPIP---HGYDDGMYGG----------VRPMNIPHNNPIM------------DRGVNDLFGG--------SLRINPVNDINIMN----TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFA 1141
            R L+ SK AGA+IGKGG+ IK LR+++N  + VPDS GPER++ I     TV  I   I+P+++EY      D+            + +LR+++H+S AG++IG  G +I+ L + +  T IKL++  CP STDRVV +  K E V+ C+  + EL+    IKG  + Y+P+ YDE+   +YGGF   + R   RR M             +  D MP  +   R P+P     YDD               VRP     N P+             DR  +++ GG        S +       + M     T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   ++++
Sbjct:   46 RILLQSKNAGAVIGKGGKNIKALRSDYNASVSVPDSSGPERILSISADIETVGEILLKIIPTLEEYQQYNGMDF------------DCELRLLIHQSLAGSIIGVKGAKIKELRE-NTKTSIKLFQECCPQSTDRVVLVGGKSERVVECVKTMLELISEAPIKGRTQPYDPNFYDETY--EYGGFTMFEERGGGRRLMGSFPMRGSRSSGDRGYDRMPS-SRVGRGPLPPSRRDYDDISPRRGPPPPHHSRVVRPSGRSRNMPMGHPHRGGDRRSRPDRYGDNMSGGYDNSSSWDSYQSGGRGSYSDMGGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYS 413          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:101167466])

HSP 1 Score: 162.54 bits (410), Expect = 3.281e-45
Identity = 127/428 (29.67%), Postives = 201/428 (46.96%), Query Frame = 2
Query:   41 FKMADSRKRRFLSNA-EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGG---FISKDSRNP----PRR-------------------NMQQPDDFMPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPIMDRG------------------------------VNDLFGGSLRINPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            F ++D+  +R   +  EE + K+          R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ +     T+  I   I+P+++EY +    D+            + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K E V+ C+  + EL+    IKG  + Y+P+ YDE+   DYGG         R P    P R                   + +  DD  P       PP P     G+ GG R  N+P   P   RG                                D +GG    + +    I  T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   R+++   F
Sbjct:   16 FSISDTNGKRPAEDMDEEQAFKRSRNADEMVELRVLLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSVSAGIDTIGDILLKIIPTLEEYQHYSGIDF------------DCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLVGGKPERVVECIKVILELVSETTIKGRSQPYDPNFYDETY--DYGGFTMLFEDRGRRPMGGFPIRVRGGFERLPPPRGSRPPPLSRRDYDDLSPRRG----PPPP--LSRGIRGGSRARNLPLPPPPPPRGGDRFSHGSYHSSLDDRPSDRRSRGDRYDSMSGDRYGGRGSYSDIGGPVI--TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVRQYSGRFF 420          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:101167466])

HSP 1 Score: 141.354 bits (355), Expect = 2.275e-37
Identity = 81/218 (37.16%), Postives = 127/218 (58.26%), Query Frame = 2
Query:   41 FKMADSRKRRFLSNA-EESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGF 691
            F ++D+  +R   +  EE + K+          R L+ SK AGA+IGKGG+ IK LRT++N  + VPDS GPER++ +     T+  I   I+P+++EY +    D+            + +LR+++H+S AG +IG  G +I+ L + +  T IKL++  CP+STDRVV +  K E V+ C+  + EL+    IKG  + Y+P+ YDE+   DYGGF
Sbjct:   12 FSISDTNGKRPAEDMDEEQAFKRSRNADEMVELRVLLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSVSAGIDTIGDILLKIIPTLEEYQHYSGIDF------------DCELRLLIHQSLAGGIIGVKGAKIKELRE-NTQTTIKLFQECCPHSTDRVVLVGGKPERVVECIKVILELVSETTIKGRSQPYDPNFYDETY--DYGGF 214          

HSP 2 Score: 53.1434 bits (126), Expect = 2.561e-7
Identity = 24/75 (32.00%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   R+++   F
Sbjct:  343 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVRQYSGRFF 417          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:NCBI gene;Acc:101169861])

HSP 1 Score: 141.354 bits (355), Expect = 2.951e-37
Identity = 79/198 (39.90%), Postives = 118/198 (59.60%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNM 730
            R L+ SK AGA+IGKGG+ IK LR+++N  + VPDS GPER++ I     TV  I   I+P+++EY      D+            + +LR+++H+S AG++IG  G +I+ L + +  T IKL++  CP STDRVV +  K E V+ C+  + EL+    IKG  + Y+P+ YDE+   +YGGF   + R   RR M
Sbjct:   46 RILLQSKNAGAVIGKGGKNIKALRSDYNASVSVPDSSGPERILSISADIETVGEILLKIIPTLEEYQQYNGMDF------------DCELRLLIHQSLAGSIIGVKGAKIKELRE-NTKTSIKLFQECCPQSTDRVVLVGGKSERVVECVKTMLELISEAPIKGRTQPYDPNFYDETY--EYGGFTMFEERGGGRRLM 228          

HSP 2 Score: 52.373 bits (124), Expect = 5.944e-7
Identity = 22/71 (30.99%), Postives = 44/71 (61.97%), Query Frame = 2
Query:  929 TSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFA 1141
            T+++T+P++L  +++GK G+R+  +  E GASI+++       D +  I G+ DQI   Q L+Q   ++++
Sbjct:  359 TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYS 429          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:NCBI gene;Acc:101169861])

HSP 1 Score: 140.584 bits (353), Expect = 3.263e-37
Identity = 79/198 (39.90%), Postives = 118/198 (59.60%), Query Frame = 2
Query:  137 RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNM 730
            R L+ SK AGA+IGKGG+ IK LR+++N  + VPDS GPER++ I     TV  I   I+P+++EY      D+            + +LR+++H+S AG++IG  G +I+ L + +  T IKL++  CP STDRVV +  K E V+ C+  + EL+    IKG  + Y+P+ YDE+   +YGGF   + R   RR M
Sbjct:   46 RILLQSKNAGAVIGKGGKNIKALRSDYNASVSVPDSSGPERILSISADIETVGEILLKIIPTLEEYQQYNGMDF------------DCELRLLIHQSLAGSIIGVKGAKIKELRE-NTKTSIKLFQECCPQSTDRVVLVGGKSERVVECVKTMLELISEAPIKGRTQPYDPNFYDETY--EYGGFTMFEERGGGRRLM 228          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000021944.1 (SMESG000021944.1)

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 353/354 (99.72%), Postives = 353/354 (99.72%), Query Frame = 2
Query:   47 MADSRKRRFLSNAEESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNMQQPDDFMPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRINPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQ 1108
            MADSRKRRFLSNAEESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNMQQPDDFMPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRINPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKT 
Sbjct:    1 MADSRKRRFLSNAEESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRRNMQQPDDFMPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRINPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTS 354          

HSP 2 Score: 56.9954 bits (136), Expect = 9.768e-9
Identity = 28/29 (96.55%), Postives = 28/29 (96.55%), Query Frame = 3
Query: 1101 KPSVSCSYVLANSPKKDSNCSLVIFNITL 1187
            K SVSCSYVLANSPKKDSNCSLVIFNITL
Sbjct:  352 KTSVSCSYVLANSPKKDSNCSLVIFNITL 380          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000021955.1 (SMESG000021955.1)

HSP 1 Score: 509.605 bits (1311), Expect = 0.000e+0
Identity = 249/382 (65.18%), Postives = 312/382 (81.68%), Query Frame = 2
Query:   47 MADSRKRRFLSNAEESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRNPPRR------------NMQQPDDFMPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPI--MDRGVNDLFGGSLRINPVNDINIMNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQIYKTQCLMQLCARKFAEEG 1150
            MADSRKRR  +N+ +S   KKF + S  GHRFLIPSKAAGAMIGKGGEIIKRLRTEHN RIIVPDSQGPERL+IID SPST+L IWNDILPSIKEYMNAK+CDYKGSSSK+IEG++EIDLR+IVHESQAGAVIGKGGERIRNLID H MT+IKLY+ FCPNSTDR+VRMVS++EN++ACL NVFELL+NQ+IKG ++DYNPD+YDE+ AP+YGGF+S+DSR P RR            N  +  D+M  P+ F+R    +  +DG+   VR +    +NPI   +RGV+DLFGG +R+  +ND++ MN SR+ VP+NLVSA++G++GRR+ D+ER+ GASIE+++DR+   +++F++RG+PDQIYK QCLMQLCARKFA+E 
Sbjct:    1 MADSRKRRNTNNSGDSFGNKKFLSGSMSGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNARIIVPDSQGPERLLIIDASPSTILDIWNDILPSIKEYMNAKECDYKGSSSKFIEGENEIDLRLIVHESQAGAVIGKGGERIRNLIDKHRMTMIKLYQTFCPNSTDRIVRMVSRMENLLACLENVFELLENQSIKGEKRDYNPDDYDEATAPNYGGFVSRDSRFPTRRTSNPPGRSLINDNAFETADYMSRPSVFSRVN-SNKLEDGI-SAVRSI-FNQSNPIAEYERGVSDLFGGVIRVGAINDLSSMNFSRMAVPKNLVSAIIGREGRRIHDIERDSGASIEIDMDRVGSRETLFVLRGNPDQIYKAQCLMQLCARKFADEA 379          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000033971.1 (SMESG000033971.1)

HSP 1 Score: 198.364 bits (503), Expect = 3.239e-59
Identity = 120/375 (32.00%), Postives = 204/375 (54.40%), Query Frame = 2
Query:  110 FETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEG-------DDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRN---------PPRRNMQQP---DDFMPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRINPVNDINI------MNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDS--VFIIRGSPDQIYKTQCLMQLCARKFAEEGF 1153
            F++     +RFLIP  AAGA+I K GE IKRLR  ++C I VP S GPERL+II+     + G+ ++I   +K+ M++K  D K      I G         ++DLR +V E+  GA+IGKGGE IR L + + +++IK+Y+  CP+STDRV+R+V   E++++CL  + +++ +     + ++Y+P+N++E  A +YGG++S ++R          PP +   +       +      A  P    +  GM  G     +   N +MD G   ++G  +    +  +++      +  S +++P  L+ A++GK G R+ ++  E GA I+++   M+   S  +  I+GS DQI   Q L+Q C RK+  + F
Sbjct:   17 FKSFRNLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPK----DIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 387          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000064674.1 (SMESG000064674.1)

HSP 1 Score: 181.03 bits (458), Expect = 8.898e-52
Identity = 85/199 (42.71%), Postives = 134/199 (67.34%), Query Frame = 2
Query:  128 PGH--------RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISK 700
            PGH        RFLIPSKAA  +IGKGGE I+RLR E N R+ +PD+ GPER+ I++ +    + IW + +P +KE M+A + D +  +  + + + EID+R +VH+SQ GA+IGKGG  ++NL   H ++IIK++ +  PNS+DR+V++V K + V  C   +++ +++Q IKG  ++YN +N+DES+   YGG+ S+
Sbjct:   20 PGHMMGNKIEFRFLIPSKAASVIIGKGGERIQRLRYECNARLSIPDNHGPERVFILESTMENCIKIWRECVPELKECMSA-NVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESLTAQYGGYNSQ 217          
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000064674.1 (SMESG000064674.1)

HSP 1 Score: 180.644 bits (457), Expect = 1.122e-51
Identity = 85/199 (42.71%), Postives = 134/199 (67.34%), Query Frame = 2
Query:  128 PGH--------RFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISK 700
            PGH        RFLIPSKAA  +IGKGGE I+RLR E N R+ +PD+ GPER+ I++ +    + IW + +P +KE M+A + D +  +  + + + EID+R +VH+SQ GA+IGKGG  ++NL   H ++IIK++ +  PNS+DR+V++V K + V  C   +++ +++Q IKG  ++YN +N+DES+   YGG+ S+
Sbjct:   16 PGHMMGNKIEFRFLIPSKAASVIIGKGGERIQRLRYECNARLSIPDNHGPERVFILESTMENCIKIWRECVPELKECMSA-NVDQRRPAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESLTAQYGGYNSQ 213          
The following BLAST results are available for this feature:
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPK2.047e-3740.59heterogeneous nuclear ribonucleoprotein K [Source:... [more]
HNRNPK3.223e-3437.56heterogeneous nuclear ribonucleoprotein K [Source:... [more]
HNRNPK3.223e-3437.56heterogeneous nuclear ribonucleoprotein K [Source:... [more]
HNRNPK3.366e-3437.56heterogeneous nuclear ribonucleoprotein K [Source:... [more]
HNRNPK3.366e-3437.56heterogeneous nuclear ribonucleoprotein K [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrpk-14.679e-3338.12Heterogeneous nuclear RibonucleoProtein (HnRNP) K ... [more]
hrpk-14.679e-3338.12Heterogeneous nuclear RibonucleoProtein (HnRNP) K ... [more]
hrpk-16.408e-3338.12Heterogeneous nuclear RibonucleoProtein (HnRNP) K ... [more]
pes-45.706e-1529.82Patterned Expression Site [Source:UniProtKB/TrEMB... [more]
hrpk-11.217e-1054.39Heterogeneous nuclear RibonucleoProtein (HnRNP) K ... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HnRNP-K4.244e-3136.55gene:FBgn0267791 transcript:FBtr0086221[more]
HnRNP-K4.451e-3135.71gene:FBgn0267791 transcript:FBtr0301760[more]
HnRNP-K4.770e-3136.55gene:FBgn0267791 transcript:FBtr0086220[more]
HnRNP-K4.770e-3136.55gene:FBgn0267791 transcript:FBtr0336730[more]
mub2.140e-2124.70gene:FBgn0262737 transcript:FBtr0078470[more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpk2.413e-3942.16heterogeneous nuclear ribonucleoprotein K [Source:... [more]
hnrnpk2.940e-3942.16heterogeneous nuclear ribonucleoprotein K [Source:... [more]
hnrnpk3.149e-3942.16heterogeneous nuclear ribonucleoprotein K [Source:... [more]
hnrnpk3.149e-3942.16heterogeneous nuclear ribonucleoprotein K [Source:... [more]
hnrpkl7.987e-3836.59heterogeneous nuclear ribonucleoprotein K, like [S... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpk1.454e-3638.61heterogeneous nuclear ribonucleoprotein K [Source:... [more]
ENSXETT00000046760.18.588e-2122.92poly(rC) binding protein 3 [Source:NCBI gene;Acc:1... [more]
ENSXETT00000046774.11.651e-2023.88poly(rC) binding protein 3 [Source:NCBI gene;Acc:1... [more]
cert12.300e-2022.89ceramide transporter 1 [Source:Xenbase;Acc:XB-GENE... [more]
cert11.032e-1922.58ceramide transporter 1 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hnrnpk1.192e-3840.59heterogeneous nuclear ribonucleoprotein K [Source:... [more]
Hnrnpk2.514e-3737.96heterogeneous nuclear ribonucleoprotein K [Source:... [more]
Hnrnpk2.530e-3737.96heterogeneous nuclear ribonucleoprotein K [Source:... [more]
Hnrnpk3.692e-3637.56heterogeneous nuclear ribonucleoprotein K [Source:... [more]
Hnrnpk2.213e-3437.56heterogeneous nuclear ribonucleoprotein K [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZIQ3|HNRPK_CHICK2.340e-3737.96Heterogeneous nuclear ribonucleoprotein K OS=Gallu... [more]
sp|P61980|HNRPK_RAT1.548e-3337.56Heterogeneous nuclear ribonucleoprotein K OS=Rattu... [more]
sp|P61979|HNRPK_MOUSE1.548e-3337.56Heterogeneous nuclear ribonucleoprotein K OS=Mus m... [more]
sp|P61978|HNRPK_HUMAN1.548e-3337.56Heterogeneous nuclear ribonucleoprotein K OS=Homo ... [more]
sp|Q5R5H8|HNRPK_PONAB1.616e-3337.56Heterogeneous nuclear ribonucleoprotein K OS=Pongo... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023ZS141.165e-5532.00Heterogeneous nuclear ribonucleoprotein K OS=Schmi... [more]
A0A267GC811.219e-5233.68Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2C9JPR11.905e-4835.17Uncharacterized protein OS=Biomphalaria glabrata O... [more]
C1LR274.420e-4844.17Heterogeneous nuclear ribonucleoprotein K OS=Schis... [more]
F1KWY91.335e-4732.77Heterogeneous nuclear ribonucleoprotein K OS=Ascar... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpk3.278e-3740.11heterogeneous nuclear ribonucleoprotein K [Source:... [more]
hnrpkl4.133e-3736.18heterogeneous nuclear ribonucleoprotein K-like [So... [more]
hnrpkl6.306e-3736.18heterogeneous nuclear ribonucleoprotein K-like [So... [more]
hnrpkl7.252e-3736.18heterogeneous nuclear ribonucleoprotein K-like [So... [more]
pcbp46.694e-2222.67poly(rC)-binding protein 4-like [Source:NCBI gene;... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005114.13.285e-2425.69pep scaffold:Pmarinus_7.0:GL476545:177182:183416:1... [more]
ENSPMAT00000005105.12.498e-1929.65pep scaffold:Pmarinus_7.0:GL501087:1205:15413:-1 g... [more]
zgc:1100453.374e-1230.97zgc:110045 [Source:ZFIN;Acc:ZDB-GENE-050706-149][more]
ENSPMAT00000001813.13.829e-929.45pep scaffold:Pmarinus_7.0:GL484105:1100:13677:-1 g... [more]
ENSPMAT00000009168.11.330e-824.57pep scaffold:Pmarinus_7.0:GL479182:17814:35570:1 g... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PBP25.571e-721.35RNA binding protein; has similarity to mammalian h... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372438.507e-2432.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424852.849e-1322.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324834.829e-828.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356928.024e-727.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382033.123e-623.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpk4.867e-4731.51heterogeneous nuclear ribonucleoprotein K [Source:... [more]
hnrpkl3.281e-4529.67heterogeneous nuclear ribonucleoprotein K-like [So... [more]
hnrpkl2.275e-3737.16heterogeneous nuclear ribonucleoprotein K-like [So... [more]
hnrnpk2.951e-3739.90heterogeneous nuclear ribonucleoprotein K [Source:... [more]
hnrnpk3.263e-3739.90heterogeneous nuclear ribonucleoprotein K [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021944.19.768e-999.72SMESG000021944.1[more]
SMESG000021955.10.000e+065.18SMESG000021955.1[more]
SMESG000033971.13.239e-5932.00SMESG000033971.1[more]
SMESG000064674.18.898e-5242.71SMESG000064674.1[more]
SMESG000064674.11.122e-5142.71SMESG000064674.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030818 ID=SMED30030818|Name=Heterogeneous nuclear ribonucleoprotein K|organism=Schmidtea mediterranea sexual|type=transcript|length=1264bp
CGCATATATTTTAACTTTAATATTTAATATTTTTTGATATTTTAAAATGG
CCGATTCTCGGAAAAGACGTTTTTTAAGCAATGCAGAAGAATCATCAAAC
AAAAAGAAATTTGAGACCATTAGTCCTCCAGGCCATAGGTTTTTAATACC
ATCTAAGGCTGCTGGAGCTATGATTGGAAAAGGTGGTGAAATTATAAAAC
GCTTGAGAACTGAGCACAATTGCCGCATTATTGTTCCTGACAGCCAAGGC
CCCGAACGACTGGTTATCATTGATGGCTCACCGTCAACAGTTCTTGGGAT
TTGGAATGATATTTTACCTTCGATTAAGGAATATATGAATGCAAAAGATT
GTGATTATAAAGGATCGTCCAGTAAATATATAGAAGGTGATGATGAAATT
GATTTACGAATGATTGTTCATGAAAGTCAAGCTGGTGCGGTTATTGGTAA
AGGTGGAGAGAGAATCAGAAATTTGATTGATGGCCATGCAATGACAATTA
TCAAATTGTATAAAATGTTCTGTCCGAACTCCACCGATCGCGTTGTGAGA
ATGGTTTCTAAAATCGAAAATGTCATGGCATGTCTAGCAAATGTATTTGA
ATTATTGGATAATCAAGCGATAAAAGGAGCCCGGAAAGATTACAATCCTG
ATAATTACGATGAGTCAATCGCACCGGATTATGGAGGTTTTATTTCCAAA
GATTCCCGCAATCCTCCGAGAAGAAATATGCAACAACCCGATGATTTCAT
GCCCCATCCAAATGCTTTTGCACGCCCGCCAATCCCGCACGGATATGATG
ATGGCATGTATGGCGGCGTACGGCCAATGAATATTCCCCACAATAATCCC
ATCATGGATCGGGGAGTTAATGATTTATTCGGTGGATCGCTAAGAATCAA
TCCGGTTAACGATATCAATATAATGAACACGTCCCGAATCACCGTTCCGC
AAAACTTGGTATCAGCGGTTGTTGGCAAGGACGGGAGGCGCCTCGGTGAC
CTGGAACGCGAGTGTGGTGCTAGTATTGAAATGGAAGTCGATCGAATGAA
TATGGGCGACAGTGTATTTATAATCAGAGGATCACCAGATCAAATATACA
AAACCCAGTGTCTCATGCAGTTATGTGCTCGCAAATTCGCCGAAGAAGGA
TTCTAATTGTTCACTAGTTATTTTCAATATTACGTTGTAATTTATTAATA
GCGAAACCGTTTCATAAACGCTATCAGTTATTGTAATAATAAAATTTAGT
CTTGTCAAAAAAAA
back to top

protein sequence of SMED30030818-orf-1

>SMED30030818-orf-1 ID=SMED30030818-orf-1|Name=SMED30030818-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=370bp
MADSRKRRFLSNAEESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEII
KRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAK
DCDYKGSSSKYIEGDDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMT
IIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYN
PDNYDESIAPDYGGFISKDSRNPPRRNMQQPDDFMPHPNAFARPPIPHGY
DDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRINPVNDINIMNTSRITV
PQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDSVFIIRGSPDQI
YKTQCLMQLCARKFAEEGF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000044cephalic ganglia
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036612KH_dom_type_1_sf
IPR004087KH_dom
IPR004088KH_dom_type_1
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0019013viral nucleocapsid
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004087K Homology domainSMARTSM00322kh_6coord: 26..94
e-value: 2.7E-8
score: 43.6
coord: 116..188
e-value: 2.1E-5
score: 33.9
coord: 292..362
e-value: 9.0E-5
score: 31.9
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 288..363
e-value: 9.3E-11
score: 43.2
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 30..100
e-value: 1.2E-15
score: 58.8
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 114..189
e-value: 5.3E-12
score: 47.0
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 291..352
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 30..97
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 108..192
IPR004088K Homology domain, type 1PFAMPF00013KH_1coord: 120..181
e-value: 3.0E-7
score: 30.2
coord: 295..351
e-value: 2.2E-8
score: 33.8
coord: 31..81
e-value: 1.5E-12
score: 47.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..24
NoneNo IPR availablePANTHERPTHR10288KH DOMAIN CONTAINING RNA BINDING PROTEINcoord: 15..353
NoneNo IPR availablePANTHERPTHR10288:SF179HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN Kcoord: 15..353
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 293..350
score: 11.72
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 117..183
score: 10.316
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 27..89
score: 13.083
NoneNo IPR availableCDDcd00105KH-Icoord: 295..352
e-value: 2.25543E-9
score: 51.0215
NoneNo IPR availableCDDcd02396PCBP_like_KHcoord: 120..184
e-value: 5.71639E-14
score: 64.0347
NoneNo IPR availableCDDcd02396PCBP_like_KHcoord: 31..82
e-value: 9.24407E-16
score: 69.0423