Mpv17-like protein

Overview
NameMpv17-like protein
Smed IDSMED30030811
Length (bp)1265
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mpv17-like protein (SMED30030811) t-SNE clustered cells

Violin plots show distribution of expression levels for Mpv17-like protein (SMED30030811) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mpv17-like protein (SMED30030811) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mpv17-like protein (SMED30030811) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Mpv17-like protein vs. Ensembl Human
Match: C12orf66 (chromosome 12 open reading frame 66 [Source:HGNC Symbol;Acc:HGNC:26517])

HSP 1 Score: 93.9745 bits (232), Expect = 1.883e-20
Identity = 102/416 (24.52%), Postives = 177/416 (42.55%), Query Frame = 1
Query:   58 SYFENLGKLNFISAKNKIKLIVVEDNNSSLSDLLNQIVCLERNYCNLIFITYKQSGLLGRKKQTESFIDSRVLLNEIKNSKKFLSSNCDLIFSNLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKL--KTIKNSLEKLQDEKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF------------ELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYS----ILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS-TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLR 1248
            ++F +LG  +F S K+ I+ I      +SL + L ++V               +  L G     E  +     L+E                  L F +  R  + +FY+ +  L ++  F+ ++ L  L    +K    +      I  PL  S  +EV VL  LL+A  + +   FL  L  + +A+T L  +             L   QS+ A+ P  L  WL  L   +L K++ YF   LS+ +    + T+    +PD F    KI  F  K      +L+FD  +  +++  HGY  PH++ E   G+  Y ++ S  S  P+      + +   R    N  +KV H   +      ++YF+ + E    + +IF S K+E+D H +SF+N++S  L+  ++   L+
Sbjct:   20 TFFSHLGGQSFFSRKDSIRTIY-----TSLHNELKKVVT-------------GRGALGGTAPHVEELLSH---LSE-----------------QLCFFVQARMEIADFYEKMYTLSTQ-KFINAEELVGLLDAIMKKYSSRFHHP--ILSPLESSFQLEVDVLCHLLKAQAQVSEWKFLPSLVNLHSAHTKLQTWGQIFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKNMLLAKFSFYFHEALSRQTTASEMKTLTAKANPDFF---GKISSFIRKYDAANVSLIFDN-RGSESFQGHGYHHPHSYREAPKGVDQYPAVVSLPSDRPVMHWPNVIMIMTDRTSDLNSLEKVVHFYDDK---VQSTYFLTRPEPHFTIVIIFESKKSERDSHFISFLNEVSLALKNPKVFASLK 387          
BLAST of Mpv17-like protein vs. Ensembl Human
Match: C12orf66 (chromosome 12 open reading frame 66 [Source:HGNC Symbol;Acc:HGNC:26517])

HSP 1 Score: 93.9745 bits (232), Expect = 2.995e-20
Identity = 85/323 (26.32%), Postives = 147/323 (45.51%), Query Frame = 1
Query:  337 NLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKL--KTIKNSLEKLQDEKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF------------ELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYS----ILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS-TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLR 1248
             L F +  R  + +FY+ +  L ++  F+ ++ L  L    +K    +      I  PL  S  +EV VL  LL+A  + +   FL  L  + +A+T L  +             L   QS+ A+ P  L  WL  L   +L K++ YF   LS+ +    + T+    +PD F    KI  F  K      +L+FD  +  +++  HGY  PH++ E   G+  Y ++ S  S  P+      + +   R    N  +KV H   +      ++YF+ + E    + +IF S K+E+D H +SF+N++S  L+  ++   L+
Sbjct:  128 QLCFFVQARMEIADFYEKMYTLSTQK-FINAEELVGLLDAIMKKYSSRFHHP--ILSPLESSFQLEVDVLCHLLKAQAQVSEWKFLPSLVNLHSAHTKLQTWGQIFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKNMLLAKFSFYFHEALSRQTTASEMKTLTAKANPDFF---GKISSFIRKYDAANVSLIFDN-RGSESFQGHGYHHPHSYREAPKGVDQYPAVVSLPSDRPVMHWPNVIMIMTDRTSDLNSLEKVVHFYDDK---VQSTYFLTRPEPHFTIVIIFESKKSERDSHFISFLNEVSLALKNPKVFASLK 440          
BLAST of Mpv17-like protein vs. Ensembl Human
Match: C12orf66 (chromosome 12 open reading frame 66 [Source:HGNC Symbol;Acc:HGNC:26517])

HSP 1 Score: 93.5893 bits (231), Expect = 3.918e-20
Identity = 108/434 (24.88%), Postives = 189/434 (43.55%), Query Frame = 1
Query:   58 SYFENLGKLNFISAKNKIKLIVVEDNNSSLSDLLNQIVCL------ERNYCNLIFITYKQSG--LLGRKKQTESFIDSRVLLNEIK---NSKKFLSSNCDLI-------FSNLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKL--KTIKNSLEKLQDEKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF------------ELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYS----ILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS-TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLR 1248
            ++F +LG  ++  AK+ ++    E N S+    L+ +  L      E+ Y +L ++  K  G     RK    +   S  L NE+K     +  L      +          L F +  R  + +FY+ +  L ++  F+ ++ L  L    +K    +      I  PL  S  +EV VL  LL+A  + +   FL  L  + +A+T L  +             L   QS+ A+ P  L  WL  L   +L K++ YF   LS+ +    + T+    +PD F    KI  F  K      +L+FD  +  +++  HGY  PH++ E   G+  Y ++ S  S  P+      + +   R    N  +KV H   +      ++YF+ + E    + +IF S K+E+D H +SF+N++S  L+  ++   L+
Sbjct:   20 TFFSHLGIFSYDKAKDNVEK-EREANKSAGGSWLSLLAALAHLAAAEKVYHSLTYLGQKLGGQSFFSRKDSIRTIYTS--LHNELKKVVTGRGALGGTAPHVEELLSHLSEQLCFFVQARMEIADFYEKMYTLSTQK-FINAEELVGLLDAIMKKYSSRFHHP--ILSPLESSFQLEVDVLCHLLKAQAQVSEWKFLPSLVNLHSAHTKLQTWGQIFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKNMLLAKFSFYFHEALSRQTTASEMKTLTAKANPDFF---GKISSFIRKYDAANVSLIFDN-RGSESFQGHGYHHPHSYREAPKGVDQYPAVVSLPSDRPVMHWPNVIMIMTDRTSDLNSLEKVVHFYDDK---VQSTYFLTRPEPHFTIVIIFESKKSERDSHFISFLNEVSLALKNPKVFASLK 440          
BLAST of Mpv17-like protein vs. Ensembl Zebrafish
Match: C4H12orf66 (si:ch211-125a15.1 [Source:NCBI gene;Acc:555715])

HSP 1 Score: 78.1814 bits (191), Expect = 2.888e-15
Identity = 101/430 (23.49%), Postives = 176/430 (40.93%), Query Frame = 1
Query:   58 SYFENLGKLNFISAKNKIKLIVVEDNNSSLSDLLNQIVCL-------ERNYCNLIFITYKQSG--LLGRKKQTESFIDSRVLLNEIKNSKKFLSSNCDLIFSNLMFLLDH-----------RCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQDEKRICDPLLL----SITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF------------ELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYS----ILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS--TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQ 1221
            S+F  LG   F  AK+ ++    +D + S   +   ++         E+ Y N+ F+  K  G     RK    +   S  L NE+K               NL  LL H           R  + +FY+ +  L S+      + +  L +I   L+K     R   P+L     S  +EV VL++LL    + +  +FL  L  +  A++ L  +             L   QS+ A+ P  L  WL+ L   +L K++ YF   LS+ +    + T+    S D F    KI  F  K      +L+FD  +  +++  HGY  P ++ E   G+  + ++ S      P+      + +   R    N   KV H   +      ++YF+ + E    + +IF   K+E+D +I++F+ ++   L+
Sbjct:   22 SFFTQLGMFWFDRAKDYVE--KEKDASKSAGAIWGSLLAALAHLAAAEKAYHNMTFLGQKLGGQSFFSRKDSIRTIYTS--LHNELKKVVSMGRHAPGGSTPNLEELLPHLSEQLCHFTQARMEIADFYEKMHTLGSQKTVNSEELVGALDSI---LQKYSS--RFHHPILSRLESSFQVEVDVLTQLLRCQAQISEWHFLPSLLNLHGAHSKLQAWGQVFERQRETRKHLFGGQSQKAVQPPHLFLWLQRLQATLLAKFSFYFHEALSRQTSQSEMKTLTARTSLDYF---GKISGFIRKYDASNVSLVFD-NRGSESFQGHGYHHPQSYREAPKGVDQFPAVVSLPGGERPVTHWPNVIMIMSDRSTELNTLDKVVHFYDDK---VQSTYFLARPEPHFTIVVIFDGRKSERDSYIVAFLQELIGSLR 435          
BLAST of Mpv17-like protein vs. Ensembl Xenopus
Match: C12orf66 (chromosome 12 open reading frame 66 [Source:NCBI gene;Acc:100379702])

HSP 1 Score: 84.3445 bits (207), Expect = 4.547e-17
Identity = 100/436 (22.94%), Postives = 186/436 (42.66%), Query Frame = 1
Query:   49 CIYSYFENLGKLNFISAKNKIKLIVVEDNNSSLSDLLNQIVCLERNYCNLIFITYKQSGLLGRKKQTESFIDSR--------VLLNEIK-------NSKKFLSSNCDLIFSNLM----FLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQD--EKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF------------ELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYS--ILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS-TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLR 1248
             ++++F +LG  ++  AK+ ++    E N S+ +     ++     +       Y     LG+K   +SF   +         L NE+K       N+    + + + + S+L     + +     + +FY+ +  L S+  F+ S+ L  +  ++  L+K        I  PL     +EV VL+ LL+A        FL  L  +  A+T L  +             L   QS+    P  L  WL      +L K++ YF   LS+ +  +  +    +PD F    KI  F  K      +L++DT +  + +  HGY  P ++ E   G+  Y ++ S  +  P+      + +   +    N  +KV H   +      ++YF+ + E    + +IF S K+E+D H +SF+N++S+ L+G R    L+
Sbjct:   51 VLHTFFSHLGNFSYDKAKDHVEK-EKEGNKSAGASW--SLMLAALAHLAAAEKAYHSMSFLGQKPGGQSFFSRKDSIRTNYTSLYNELKKVVTTGRNAVGGTAPHLEELLSHLSEQLCYFVQAHMEIADFYEKMYTLSSQK-FINSEEL--VSILEAILKKYSSRFHHPILSPLESGFQLEVDVLTHLLKAQSLIYEWKFLPALVNLHNAHTKLQTWGQIFEKQKETKKHLFGGQSQKVAQPPYLFLWLMKFKNLLLAKFSFYFHEALSRQTSEMKALTAKTNPDYF---GKISSFIRKYDAVNVSLIYDT-RGSENFQGHGYHHPDSYREAPKGVDQYPALVSLPNDRPIMHWPNVIMIMTDKSADLNTLEKVVHFYDDK---VQSTYFLTRPEPNFTIVVIFESKKSERDSHFISFLNELSHSLKGSRAFASLK 473          
BLAST of Mpv17-like protein vs. Ensembl Mouse
Match: BC048403 (cDNA sequence BC048403 [Source:MGI Symbol;Acc:MGI:2670984])

HSP 1 Score: 96.2857 bits (238), Expect = 3.321e-21
Identity = 84/320 (26.25%), Postives = 148/320 (46.25%), Query Frame = 1
Query:  337 NLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQD--EKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF------------ELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYSILTIGYSMSPDSFP-MVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS-TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLR 1248
             L F +  R  + +FY+ +  L ++  F+ ++ L  + T+   L K        I  PL  S  +EV VLS LL+A  + +   FL  L  +  A+T L  +             L   QS+ A+ P  L  WL  L   +L K++ YF   LS+ +  +   +++  + P +  KI  F  K      +L+FD  +  +++  HGY  PH++ E   G+  Y ++ S  S  P+      + +   R    N  +KV H   +      ++YF+ + E    + +IF S K+E+D H +SF+N++S  L+  ++   L+
Sbjct:  128 QLCFFVQARMEIADFYEKMYALSTQ-KFINTEEL--VSTLDTILRKYSSRFHHPILSPLESSFQLEVGVLSHLLKAQAQISEWKFLPSLVTLHNAHTKLQSWGQTFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKTMLLAKFSFYFHEALSRQTTASEMKALTAKANPDLFGKISSFIRKYDAANVSLIFDN-RGSESFQGHGYHHPHSYREAPKGVDQYPAVVSLPSDRPVMHWPNVIMIMTDRASDLNSLEKVVHFYDDK---VQSTYFLTRPEPHFTIVVIFESKKSERDSHFISFLNELSLALKNPKVFASLK 440          
BLAST of Mpv17-like protein vs. Ensembl Mouse
Match: BC048403 (cDNA sequence BC048403 [Source:MGI Symbol;Acc:MGI:2670984])

HSP 1 Score: 92.0485 bits (227), Expect = 2.081e-20
Identity = 73/266 (27.44%), Postives = 125/266 (46.99%), Query Frame = 1
Query:  493 ICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF------------ELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYSILTIGYSMSPDSFP-MVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS-TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLR 1248
            I  PL  S  +EV VLS LL+A  + +   FL  L  +  A+T L  +             L   QS+ A+ P  L  WL  L   +L K++ YF   LS+ +  +   +++  + P +  KI  F  K      +L+FD  +  +++  HGY  PH++ E   G+  Y ++ S  S  P+      + +   R    N  +KV H   +      ++YF+ + E    + +IF S K+E+D H +SF+N++S  L+  ++   L+
Sbjct:   43 ILSPLESSFQLEVGVLSHLLKAQAQISEWKFLPSLVTLHNAHTKLQSWGQTFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKTMLLAKFSFYFHEALSRQTTASEMKALTAKANPDLFGKISSFIRKYDAANVSLIFDN-RGSESFQGHGYHHPHSYREAPKGVDQYPAVVSLPSDRPVMHWPNVIMIMTDRASDLNSLEKVVHFYDDK---VQSTYFLTRPEPHFTIVVIFESKKSERDSHFISFLNELSLALKNPKVFASLK 304          
BLAST of Mpv17-like protein vs. UniProt/SwissProt
Match: sp|Q6P1I3|CL066_MOUSE (KICSTOR complex protein C12orf66 homolog OS=Mus musculus OX=10090 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.323e-20
Identity = 84/320 (26.25%), Postives = 148/320 (46.25%), Query Frame = 1
Query:  337 NLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQD--EKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF------------ELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYSILTIGYSMSPDSFP-MVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS-TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLR 1248
             L F +  R  + +FY+ +  L ++  F+ ++ L  + T+   L K        I  PL  S  +EV VLS LL+A  + +   FL  L  +  A+T L  +             L   QS+ A+ P  L  WL  L   +L K++ YF   LS+ +  +   +++  + P +  KI  F  K      +L+FD  +  +++  HGY  PH++ E   G+  Y ++ S  S  P+      + +   R    N  +KV H   +      ++YF+ + E    + +IF S K+E+D H +SF+N++S  L+  ++   L+
Sbjct:  128 QLCFFVQARMEIADFYEKMYALSTQ-KFINTEEL--VSTLDTILRKYSSRFHHPILSPLESSFQLEVGVLSHLLKAQAQISEWKFLPSLVTLHNAHTKLQSWGQTFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKTMLLAKFSFYFHEALSRQTTASEMKALTAKANPDLFGKISSFIRKYDAANVSLIFDN-RGSESFQGHGYHHPHSYREAPKGVDQYPAVVSLPSDRPVMHWPNVIMIMTDRASDLNSLEKVVHFYDDK---VQSTYFLTRPEPHFTIVVIFESKKSERDSHFISFLNELSLALKNPKVFASLK 440          
BLAST of Mpv17-like protein vs. UniProt/SwissProt
Match: sp|Q96MD2|CL066_HUMAN (KICSTOR complex protein C12orf66 OS=Homo sapiens OX=9606 GN=C12orf66 PE=1 SV=4)

HSP 1 Score: 95.5153 bits (236), Expect = 4.514e-20
Identity = 109/434 (25.12%), Postives = 189/434 (43.55%), Query Frame = 1
Query:   58 SYFENLGKLNFISAKNKIKLIVVEDNNSSLSDLLNQIVCL------ERNYCNLIFITYKQSG--LLGRKKQTESFIDSRVLLNEIK---NSKKFLSSNCDLI-------FSNLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKL--KTIKNSLEKLQDEKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF------------ELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYS----ILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS-TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLR 1248
            ++F +LG  ++  AK+ ++    E N S+    L+ +  L      E+ Y +L ++  K  G     RK    +   S  L NE+K     +  L      +          L F +  R  M +FY+ +  L ++  F+ ++ L  L    +K    +      I  PL  S  +EV VL  LL+A  + +   FL  L  + +A+T L  +             L   QS+ A+ P  L  WL  L   +L K++ YF   LS+ +    + T+    +PD F    KI  F  K      +L+FD  +  +++  HGY  PH++ E   G+  Y ++ S  S  P+      + +   R    N  +KV H   +      ++YF+ + E    + +IF S K+E+D H +SF+N++S  L+  ++   L+
Sbjct:   20 TFFSHLGIFSYDKAKDNVEK-EREANKSAGGSWLSLLAALAHLAAAEKVYHSLTYLGQKLGGQSFFSRKDSIRTIYTS--LHNELKKVVTGRGALGGTAPHVEELLSHLSEQLCFFVQARMEMADFYEKMYTLSTQK-FINAEELVGLLDAIMKKYSSRFHHP--ILSPLESSFQLEVDVLCHLLKAQAQVSEWKFLPSLVNLHSAHTKLQTWGQIFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKNMLLAKFSFYFHEALSRQTTASEMKTLTAKANPDFF---GKISSFIRKYDAANVSLIFDN-RGSESFQGHGYHHPHSYREAPKGVDQYPAVVSLPSDRPVMHWPNVIMIMTDRTSDLNSLEKVVHFYDDK---VQSTYFLTRPEPHFTIVIIFESKKSERDSHFISFLNEVSLALKNPKVFASLK 440          
BLAST of Mpv17-like protein vs. UniProt/SwissProt
Match: sp|Q6IR80|CL066_XENLA (KICSTOR complex protein C12orf66 homolog OS=Xenopus laevis OX=8355 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.538e-16
Identity = 101/434 (23.27%), Postives = 190/434 (43.78%), Query Frame = 1
Query:   49 CIYSYFENLGKLNFISAKNKIKLIVVEDNNSSLSDL------LNQIVCLERNYCNLIFITYKQSGLLGRKKQTESFIDSRVLLNEIK-------NSKKFLSSNCDLIFSNLM----FLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQD--EKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF-ELIHRQSELAMH-----------PLPLLNWLRDLSRFVLDKYTLYFQPILSKYS--ILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS-TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLR 1248
             + ++F +LG  ++  AK+ ++    E N S+ +        L  +   ++ Y ++ F+  KQ G L   ++     +   L NE+K       N+    + + + + S+L     + +     + +FY+ +  L S+  F+ ++ L  +K ++  L+K           PL     +EV VL+ LL+A        FL  L  +  A+T L  + ++  +Q E   H           P  L  WL      +L K++ YF   LS+ +  + T+    +PD F    KI  F  K      +L++DT +  + +  HGY  P ++ E   G+  Y ++ S  +  P+      + +   +    N  +KV H   +      ++YF+ + E    + +IF S K+E+D H  SF+N++S  L+G R    L+
Sbjct:   15 VLQTFFSHLGNFSYDKAKDHVE-KEKEGNKSAGASWSLMLAALAHLAAAQKAYHSMSFLGQKQGGQLFFSRKDSIRTNYTSLYNELKKVVTTGRNAVGGTAPHLEELLSHLSEQLCYFVQAHMEIADFYEKMYTLSSQK-FINAEEL--VKILEAILKKYSSRFHHPTLSPLESGFQLEVDVLAHLLKAQFLIYEWKFLPALVNLHNAHTKLQTWGQIFEKQKETKKHLFGGQSQKVAQPPHLFLWLMKFKNLLLAKFSFYFHEALSRQTSEMKTLTAKTNPDYF---GKISSFIRKYDAVNVSLIYDT-RGSENFQGHGYHHPDSYREAPKGMDQYPAVVSLPNDRPIMHWPNVIMIMTDKSADLNTLEKVVHFYDDK---VQSTYFLTRPEPNFTIVVIFESKKSERDSHFTSFLNELSQSLKGSRAFASLK 437          
BLAST of Mpv17-like protein vs. UniProt/SwissProt
Match: sp|Q1L8F9|CL066_DANRE (KICSTOR complex protein C12orf66 homolog OS=Danio rerio OX=7955 GN=si:ch211-125a15.1 PE=2 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 2.180e-14
Identity = 101/430 (23.49%), Postives = 176/430 (40.93%), Query Frame = 1
Query:   58 SYFENLGKLNFISAKNKIKLIVVEDNNSSLSDLLNQIVCL-------ERNYCNLIFITYKQSG--LLGRKKQTESFIDSRVLLNEIKNSKKFLSSNCDLIFSNLMFLLDH-----------RCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQDEKRICDPLLL----SITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF------------ELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYS----ILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS--TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQ 1221
            S+F  LG   F  AK+ ++    +D + S   +   ++         E+ Y N+ F+  K  G     RK    +   S  L NE+K               NL  LL H           R  + +FY+ +  L S+      + +  L +I   L+K     R   P+L     S  +EV VL++LL    + +  +FL  L  +  A++ L  +             L   QS+ A+ P  L  WL+ L   +L K++ YF   LS+ +    + T+    S D F    KI  F  K      +L+FD  +  +++  HGY  P ++ E   G+  + ++ S      P+      + +   R    N   KV H   +      ++YF+ + E    + +IF   K+E+D +I++F+ ++   L+
Sbjct:   22 SFFTQLGMFWFDRAKDYVE--KEKDASKSAGAIWGSLLAALAHLAAAEKAYHNMTFLGQKLGGQSFFSRKDSIRTIYTS--LHNELKKVVSMGRHAPGGSTPNLEELLPHLSEQLCHFTQARMEIADFYEKMHTLGSQKTVNSEELVGALDSI---LQKYSS--RFHHPILSRLESSFQVEVDVLTQLLRCQAQISEWHFLPSLLNLHGAHSKLQAWGQVFERQRETRKHLFGGQSQKAVQPPHLFLWLQRLQATLLAKFSFYFHEALSRQTSQSEMKTLTARTSLDYF---GKISGFIRKYDASNVSLVFD-NRGSESFQGHGYHHPQSYREAPKGVDQFPAVVSLPGGERPVTHWPNVIMIMSDRSTELNTLDKVVHFYDDK---VQSTYFLARPEPHFTIVVIFDGRKSERDSYIVAFLQELIGSLR 435          
BLAST of Mpv17-like protein vs. TrEMBL
Match: A0A504Y688 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_10336 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.766e-21
Identity = 112/402 (27.86%), Postives = 187/402 (46.52%), Query Frame = 1
Query:  127 EDNNSSLSDLLNQIVCLERNYCNLIFITYKQSGLLGRKKQTESFIDS-RVLLNEIKNSKKFLSSNCDLIFSNLMFLLDHRC----NMIEFYKS-----ISGLKSKPGFMVSDSLPKLKTIKNSLEKLQDEKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQFE-LIHRQSELAMHP----LPLLNWLRDLSRFVLDKYTLYFQPIL-----SKYSILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFSTSVTPMNQDELFVTVSLIREKIDN--------QQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLR 1248
            ED++ + S+ L   V LE+ Y  L F   +   +  R++  ES   S ++    I  +    S+  + I S +   L + C    ++I+FY S     IS + S   F  SDSL +L+ +  + E   + ++  +P+ +SI  E+ VL  LL A     +L+F D L  ++ A+ DL+     +   + L + P      LL WL      V+ KYTLY+  IL     S   +LT+  +  P+   +V  I  F          + FDTT Q   +  HGYVL  T  E   G+++   IF+    P+ Q      V  I  +I          +  K+ +L     NH   +YF+ K+E R +LSL++   K+ +D+ I+SF++ I++ ++   +I  LR
Sbjct:   41 EDSSPTFSEQLISFVRLEKYYHGLQFFCTRS--IFSRRENLESSYKSLQIWFGRIAGT----SAERENIMSKITMHLRNFCLIRASLIDFYHSVDENPISVITSCSEF--SDSLIRLRNVLVT-EDADNTRQAFEPIRVSIECELNVLVYLLRAQSYIADLFFGDSLLCLKRASDDLSSLHSYLGFDNSLNVRPSGKAFSLLVWLNSFRNTVMAKYTLYWFNILMRSVSSPADVLTVAGTEDPN---IVHLISNFQRASGALYIAIFFDTTCQEYPFLGHGYVLRGTVGEGPKGVESIPPIFTV---PLGQSIPAADVYAIVMQISGVLNLGEPTEYDKLVYLFDEKLNH---TYFIQKLESRTFLSLVYEGCKSRRDKQIMSFVSSIASLIRLQTLISQLR 424          
BLAST of Mpv17-like protein vs. TrEMBL
Match: A0A3L8SRK4 (Uncharacterized protein OS=Chloebia gouldiae OX=44316 GN=DV515_00004470 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 6.732e-20
Identity = 113/435 (25.98%), Postives = 198/435 (45.52%), Query Frame = 1
Query:   58 SYFENLGKLNFISAKNKIKLIVVEDNNSSLSDLLNQIVCL------ERNYCNLIFITYKQSG--LLGRKKQTESFIDSRVLLNEIK-------NSKKFLSSNCDLIFSNLM----FLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQD--EKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF------------ELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYS----ILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS-TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLR 1248
            ++F +LG  ++  AK+ ++    E N S+ S  L  +  L      E+ Y ++ F+  K  G     RK    +   S  L NE+K       N+    + + + + S+L     F +  R  + +FY+ +  L S+  F+ S+ L  +  +++ L+K        I  PL  S  +EV VL+ LL+A  + +   FL  L  + +A+T L  +             L   QS+ A+ P  L  WL  L   +L K++ YF   LS+ +    + T+    +PD F    KI  F  K      +L+FD  +  +++  HGY  PH++ E   G+  Y ++ S  S  P+      + +   R    N  +KV H   +      ++YF+ + E    + +IF S K+E+D H +SF+N+IS+ L+  +    L+
Sbjct:   20 TFFSHLGIFSYDKAKDNVEK-EREANKSAGSSWLALLAGLAHLAAAEKAYHSMTFLGQKLGGQSFFSRKDSIRTIYTS--LHNELKKVVATGHNALGGTAPHLEELLSHLSEQLCFFVQARMEIADFYEKMYTLSSQK-FINSEEL--VNILESILKKYSSRFHHPILSPLESSFQLEVDVLAHLLKAQAQISEWKFLPSLVNLHSAHTKLQTWGQIFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKNILLAKFSFYFHEALSRQTTASEMKTLTAKTNPDYF---GKISSFIRKYDAVNVSLIFDN-RGSESFQGHGYHHPHSYREAPKGVDQYPAVVSLPSDRPVMHWPNVIMIMTDRTSDLNSLEKVVHFYDDK---VQSTYFLTRPEPHFTIVVIFESKKSERDYHFISFLNEISHSLKNSKAFASLK 441          
BLAST of Mpv17-like protein vs. TrEMBL
Match: A0A401PLX6 (Uncharacterized protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0003200 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 8.318e-20
Identity = 108/433 (24.94%), Postives = 188/433 (43.42%), Query Frame = 1
Query:   28 PNYLYMECIYSYFENLGKLNFISAKNKIKLIVVEDNNSSLSDLLNQIVCLERNYCNLIFITYKQSGLLGRKKQTESFI---DS------------RVLLNEIKNSKKFLSSNCDLIFSNLM----FLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQDE--KRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF------------ELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYSILTIGYSMSPDSFP-MVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFSTSV-TPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQ 1221
            P  L    + ++F  LG  +   AK+ ++    E  NS  +      +     +       Y   G LG+K   +SF    DS            R L+   +NS    S + + + S+L     F +  R  + +FY+ +  L ++     ++ L  L++I   L+K        I  PL  S  +EV VL++LL+A  + +   FL  L  + +A++ L  +             L   Q++ A+ P  L  WL  L   +L K+T YF   LS+ +  +   +++  + P    KI  F  K      +L+FD  +  +T+  HGY  PH++ E   G+  Y ++ S     P+      + +   R    N   KV H   +      ++YF+ + E +  + +IF S K+EKD H LSF+N++S+ L+
Sbjct:    8 PVPLEQAVLETFFSQLGICSHDRAKDYVER---EKENSRSAGPSWAGILSALAHLAAAEKAYHSMGFLGQKLGGQSFFSRKDSIRSIYTSLHNELRKLVTSARNSAAGTSPHLEELLSHLSEQLCFFIQARMEIADFYEKMYSLSTQKSIHSTEVLHTLESI---LQKYSSRFHHPILSPLESSFQLEVDVLTQLLKAQAEISEWKFLPSLLNLHSAHSKLQTWGQTFEKQRETRKHLFGGQTQKALQPPHLFLWLGKLKNALLAKFTFYFHDALSRQTTSSEMKALTAKTNPDYCGKISSFIRKYDAENVSLIFDN-RGSETFQGHGYHHPHSYREAPKGVDQYPAVVSLPTDRPLIHWPNVIMIMSDRATELNTLDKVVHFYDDK---VQSTYFLTRPEPQFTIVVIFDSRKSEKDSHFLSFLNELSSSLK 430          
BLAST of Mpv17-like protein vs. TrEMBL
Match: E9GMT5 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_304951 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.203e-19
Identity = 107/419 (25.54%), Postives = 209/419 (49.88%), Query Frame = 1
Query:   58 SYFENLGKLNFISAKNKIKLIVVEDNNSS-----LSDLLNQIVCLERNYCNLIFITYKQSGLLGRKKQTESFIDSRVLLNEIKNSKKF-LSSNCDLIFSNLMFLLDH----RCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQDEKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPL---NEMQAA-NTDLNQFELIH-RQSELAMHPLP--LLNWLRDLSRFVLDKYTLYFQPILSKYSILTIGYSM-SPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFSTSVTPMNQDELFVTVSL-IREKIDN--QQKKVAHLIQNSHNHRST-SYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLR 1248
            +YF  L + +F   K+ +      + N +     L   L+Q+   E++Y  L+F+  K    L ++   +S  D+  L  E K +++F  ++  DL+  +L+  L      R  ++EFY+ +S   S     + + LP++  +  + + ++    + +PL  S   E  +L+ LL+A+ +  +  +L  L   NE QA  +T    F+L   R+  L  +P    L  WL       + K+TLYF  +LSKYS      ++ +  S   V+ I+ F  K      +L+ D    ++++   GYV P+  ++   GL +Y  IF++    + +   + +V + + ++I +    +K+ ++     +HR+  +YF+ ++E R+ L LIF S + EK+ +I+SF+N+I+ +L+G R+   L+
Sbjct:   16 TYFNGLAQSSFDKCKDAVDKERDTNKNQNGIWPYLMGTLSQLATTEKSYMALLFLVPK--SFLRKENSLKSAYDT--LRMECKRTEEFSKTTQLDLLVVHLLGQLAQFASARLELMEFYEKLSAFGSSKQNNLEELLPQIHNLSQTSD-IKFHHPLMEPLKSSFAYECEILTHLLDANVEMASWNYLPALLKINETQAKLDTWAKIFQLKETRRLGLFKNPTSPQLFQWLIKFKCLSVSKFTLYFYEVLSKYSTPQDLKTLCAKQSLDYVNLIQAFQRKADARAVSLILDVNG-LESFRGPGYVHPNKPIDTPKGLDSYPCIFTSPDKSIREIPYWPSVIMTLADRIQDLSNYEKLVYVF----DHRAQRTYFLQRVEPRLTLVLIFESKRLEKESYIVSFMNEITQQLRGTRIFNCLK 424          
BLAST of Mpv17-like protein vs. TrEMBL
Match: A0A226EVN9 (Uncharacterized protein OS=Folsomia candida OX=158441 GN=Fcan01_02938 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.491e-19
Identity = 104/390 (26.67%), Postives = 186/390 (47.69%), Query Frame = 1
Query:  145 LSDLLNQIVCLERNYCNLIFITYKQSGLLGRKKQTESFIDSRVLLNEIKNSKKFLSS-----NCDLIFSNLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQ----DEKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF-ELIH------RQSEL--AMHPLP-LLNWLRDLSRFVLDKYTLYFQPILSKYSILTIGYSMSPDSFPM--VDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFSTSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQ-GLRMIEFLR 1248
            ++  L Q+   E+ Y NL F+  K  G L +    +S +DS V L+  K S+  ++S     +   + + L+ L++ R  M+EFY+ +S   S     +SD +  ++TI  +  + Q    D   I   +L S+  E++ +  LL+         +LD    +Q AN++L ++ EL+       R+S    +   LP L  W++ L   ++ KYTLYF  +LSK+S             P+    +I  F  K       ++FD  +   ++  +GY  P   VE + GL ++ SI S    P+      V +  I +K +         I +S      +YFV KI++R++L +++ + K+EKD + L F+ D++ EL+ G ++   L+
Sbjct:   67 ITTALAQLSQTEKAYVNLTFLAPK--GFLRKDSNLKSILDS-VKLDLKKISESSVTSLPAKHSYPEVAAALLVLINLRLEMMEFYEKLSLYGSAKNVEISDLITDIETILENFSEEQNSIGDSVAILQGILNSVNWELQTMCNLLKVIHAVQTWSYLDATVGIQLANSNLQEWSELVQSNSTTVRKSSFYSSTPTLPTLFLWIKKLKGMLISKYTLYFYELLSKHSNSNYDIRNYCTKLPVDYYSRISVFQKKSDALCICIVFDARET--SFYRNGYRFPGREVELVEGLDSFPSIVSVPAKPVQHWPSIVMI--ISDKANELAADKTVAIFDSRIQ--VTYFVHKIDVRMFLLIMYEAKKSEKDAYTLKFLTDLAFELRFGAKIFSSLK 447          
BLAST of Mpv17-like protein vs. Ensembl Cavefish
Match: si:ch211-125a15.1 (chromosome 7 C12orf66 homolog [Source:NCBI gene;Acc:103023944])

HSP 1 Score: 89.7373 bits (221), Expect = 4.439e-19
Identity = 99/429 (23.08%), Postives = 176/429 (41.03%), Query Frame = 1
Query:   58 SYFENLGKLNFISAKNKIKLIVVEDNNSSLSDLLNQIVCLERNYCNLIFITYKQSGLLGRKKQTESFIDSR--------VLLNEIK-----------NSKKFLSSNCDLIFSNLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQDEKRICDPLL----LSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF------------ELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYSILT----IGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS--TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQ 1221
            S+F  LG  +F  AK+ ++    E ++S  +  +   +     +       Y     LG+K   +SF   +         L NE+K            S  +L      +   L      R  + + Y+ +  L S+      +S   + T+++ ++K     R   P+L     S  +EV VL++LL    + +  +FL  L  +  A++ L  +             L   QS+ A  P  L  WL+ L   +L K+T YF   LS+ + L     +    SPD F    K+  F  K      +L+FD  +  +++  HGY  PH++ E   G+  + ++ S      P+      + +   R    N   KV H   +      ++YF+ + E    + +IF   K+EKD H+++F+ +IS  L+
Sbjct:   22 SFFTQLGMFSFDRAKDYVE---KEKDSSKSAGAIWASLLAALAHLAAAEKAYHNMTFLGQKLGGQSFFSRKDSIRTIYTSLHNELKKVVSMGRHPPGGSSPYLEELLSHLSEQLCHFTQARMEVADLYEKMHTLGSQ---KTVNSEELVSTLESIMQKYSS--RFHHPILSRLEGSFQVEVDVLTQLLRCQAQISEWHFLPSLLNLHGAHSKLQAWGQAFERQRETRKHLFGGQSQRAAQPPHLYLWLQRLQGALLAKFTFYFHEALSRQAPLAEMKALTARTSPDYF---GKVSAFIRKHDASSVSLVFDN-RGSESFQGHGYHHPHSYREAPKGVDQFPAVVSLPGGERPLTHWPNVIMIMSDRAAELNSLDKVMHFYDDK---VQSTYFLARPEPHFTIVVIFDGRKSEKDSHVVAFLQEISTSLR 435          
BLAST of Mpv17-like protein vs. Ensembl Cavefish
Match: si:ch211-125a15.1 (chromosome 7 C12orf66 homolog [Source:NCBI gene;Acc:103023944])

HSP 1 Score: 89.3521 bits (220), Expect = 6.647e-19
Identity = 99/429 (23.08%), Postives = 176/429 (41.03%), Query Frame = 1
Query:   58 SYFENLGKLNFISAKNKIKLIVVEDNNSSLSDLLNQIVCLERNYCNLIFITYKQSGLLGRKKQTESFIDSR--------VLLNEIK-----------NSKKFLSSNCDLIFSNLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQDEKRICDPLL----LSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF------------ELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYSILT----IGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS--TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQ 1221
            S+F  LG  +F  AK+ ++    E ++S  +  +   +     +       Y     LG+K   +SF   +         L NE+K            S  +L      +   L      R  + + Y+ +  L S+      +S   + T+++ ++K     R   P+L     S  +EV VL++LL    + +  +FL  L  +  A++ L  +             L   QS+ A  P  L  WL+ L   +L K+T YF   LS+ + L     +    SPD F    K+  F  K      +L+FD  +  +++  HGY  PH++ E   G+  + ++ S      P+      + +   R    N   KV H   +      ++YF+ + E    + +IF   K+EKD H+++F+ +IS  L+
Sbjct:   47 SFFTQLGMFSFDRAKDYVE---KEKDSSKSAGAIWASLLAALAHLAAAEKAYHNMTFLGQKLGGQSFFSRKDSIRTIYTSLHNELKKVVSMGRHPPGGSSPYLEELLSHLSEQLCHFTQARMEVADLYEKMHTLGSQ---KTVNSEELVSTLESIMQKYSS--RFHHPILSRLEGSFQVEVDVLTQLLRCQAQISEWHFLPSLLNLHGAHSKLQAWGQAFERQRETRKHLFGGQSQRAAQPPHLYLWLQRLQGALLAKFTFYFHEALSRQAPLAEMKALTARTSPDYF---GKVSAFIRKHDASSVSLVFDN-RGSESFQGHGYHHPHSYREAPKGVDQFPAVVSLPGGERPLTHWPNVIMIMSDRAAELNSLDKVMHFYDDK---VQSTYFLARPEPHFTIVVIFDGRKSEKDSHVVAFLQEISTSLR 460          
BLAST of Mpv17-like protein vs. Ensembl Sea Lamprey
Match: si:ch211-125a15.1 (chromosome 12 open reading frame 66 [Source:HGNC Symbol;Acc:HGNC:26517])

HSP 1 Score: 67.3958 bits (163), Expect = 1.652e-12
Identity = 69/325 (21.23%), Postives = 135/325 (41.54%), Query Frame = 1
Query:  337 NLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQDEKRICDPLLLSITI----EVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQFELIHRQSELA-------------------MHPLPLLN-WLRDLSRFVLDKYTLYFQPILSKYS---ILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPL-IGLQNYQSIFS--TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQ 1221
             L  L+  R  M + Y+ + GL         + L  L  I           R+  P+L +++     E   L  LL A    ++  FL  L E+ AA+  L  +    R SE A                     P P L+ W+     F+L K++ YF   LS+ +   + ++    SPD F    K+  F  K      +L+ DT    D++  HGY  P ++ E   +  + +  + S  +  T M+    +  +S++  +  ++      ++ +      ++Y++ + E R  +++++ S ++EKD  + +F+ + +  L+
Sbjct:  138 QLGHLVQSRQEMADLYEKLHGLSLGRNAAPDELLASLGAITQKFSS-----RVHHPVLSALSSSFQHETEALGHLLRAQRDVSSWLFLPALLELHAAHAKLGAW--ASRGSERARDGAAAPQRKPLFGGAAQRAAPTPHLHQWMVKYKTFLLAKFSFYFHEALSRQAGGEMKSLTAKTSPDFF---GKVSSFIKKTDAANVSLILDTRGLEDSFKGHGYHYPGSYPEGFKVPAEGFVPVLSLPSERTAMH----WSALSMVLAERASELACAERVVHDYDEKAQSTYYLARPEPRFTIAVVYESRRSEKDSGVHAFLLETAAALK 448          
BLAST of Mpv17-like protein vs. Ensembl Nematostella
Match: EDO42854 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0D0])

HSP 1 Score: 80.1073 bits (196), Expect = 2.425e-16
Identity = 98/439 (22.32%), Postives = 195/439 (44.42%), Query Frame = 1
Query:   58 SYFENLGKLNFISAKNKIKLIVVEDNNSSLSDL---------LNQIVCLERNYCNLIFITYKQSGLLGRKKQTESFIDSRVLLNEIKNSKKF--LSSNCDLIFS---------NLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQD--EKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQFE-----LIHRQSELAMHP-----LPLLN-WLRDLSRFVLDKYTLYFQPILSKYS------ILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS-TSVTPMNQDELFVTVSLIREKIDN--QQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLR 1248
            ++F  L +  F  AK++++     D+  +L+ +         L+ +   E+ Y +L FI  K      RK         + LL E+K + +   ++S+  L+           +L   +  R  +++FY+ ++ +   P    +D    +  +   + + Q+     I DP+  S + EV +L   L A  +   L FL  L  + A++T L  +      L  ++S  +  P      P L  W+  L   ++ K+TLYF P+L++ +      +LT   ++       + KI  F  +      ++L D  + +D+Y+S GY  P    +   GL  + ++ S     P+      +++ + R    +    +KV +   N      ++YF+ +I+ R+ L +IF S +NEKD +I SF++D++  L+  ++   L+
Sbjct:   17 TFFHALSQFAFDKAKDQVE--KERDSRKTLAQMSMWVSVLNSLSHLASAEKIYFSLAFIARK----FFRKDTLRDMY--KTLLVELKKTSEVTPVASHSVLLVEGSLLAELSRHLTQFVQARMELMDFYEVMASIAVSPVVNYTD---LVIMVDELIHRHQNCFHHPILDPVKSSFSFEVEILLHSLRAQCEMCELKFLPSLLHLHASHTKLTSWSQLLPALNSKESLFSSGPKKQMETPFLYLWISKLHAALVSKFTLYFYPVLTEQTTTADMKVLTARATVD-----YIAKITAFQRRSDALNVSVLLDA-RGLDSYSSDGYHFPQDKRDQPAGLGAFPAVVSFPGERPLEHWPNIISIMMDRAHAQDLASAEKVVYFFDN---RVQSTYFLTRIDSRLTLVVIFNSKRNEKDSYITSFMSDMALHLRNTKVFAMLK 435          
BLAST of Mpv17-like protein vs. Ensembl Medaka
Match: si:ch211-125a15.1 (chromosome 23 C12orf66 homolog [Source:NCBI gene;Acc:101154911])

HSP 1 Score: 67.0106 bits (162), Expect = 9.808e-12
Identity = 62/250 (24.80%), Postives = 106/250 (42.40%), Query Frame = 1
Query:  514 SITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF-ELIHRQSEL-----------AMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYSILTIGYSMSPDSFP-MVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS-TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQ 1221
            S   EV V+++LL    + +   FL  L  +  A + L  + +L  RQ E               P  L  WL+     +L K++ YF   LS+ +      +++  + P    KI  F  K      +L+FD  +  +++  HGY  PH++ E   G+  + +I S  S  P       + +        N   KV H   +      ++Y++ + E    L +IF   K+EKD  I +F+ +IS  L+
Sbjct:  194 SFQTEVDVVTQLLRCQAQVSEWRFLPALLSLHGAQSKLVAWGQLFQRQKETRKLLFGGQSQKTAQPPHLYTWLQRFQAALLAKFSFYFHEALSRQTTPADMRALTARTAPDYHGKICAFIRKHDASNVSLVFD-NRGSESFQGHGYHHPHSYREAPKGVDQFPAIVSLPSEQPSTHWPNVIMMMGDHAAELNTLDKVVHFYDDK---VQSTYYLTRPEPHFTLVVIFDGRKSEKDVQIAAFLQEISGSLR 439          
BLAST of Mpv17-like protein vs. Ensembl Medaka
Match: si:ch211-125a15.1 (chromosome 23 C12orf66 homolog [Source:NCBI gene;Acc:101154911])

HSP 1 Score: 67.0106 bits (162), Expect = 9.833e-12
Identity = 62/250 (24.80%), Postives = 106/250 (42.40%), Query Frame = 1
Query:  514 SITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF-ELIHRQSEL-----------AMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYSILTIGYSMSPDSFP-MVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS-TSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQ 1221
            S   EV V+++LL    + +   FL  L  +  A + L  + +L  RQ E               P  L  WL+     +L K++ YF   LS+ +      +++  + P    KI  F  K      +L+FD  +  +++  HGY  PH++ E   G+  + +I S  S  P       + +        N   KV H   +      ++Y++ + E    L +IF   K+EKD  I +F+ +IS  L+
Sbjct:  195 SFQTEVDVVTQLLRCQAQVSEWRFLPALLSLHGAQSKLVAWGQLFQRQKETRKLLFGGQSQKTAQPPHLYTWLQRFQAALLAKFSFYFHEALSRQTTPADMRALTARTAPDYHGKICAFIRKHDASNVSLVFD-NRGSESFQGHGYHHPHSYREAPKGVDQFPAIVSLPSEQPSTHWPNVIMMMGDHAAELNTLDKVVHFYDDK---VQSTYYLTRPEPHFTLVVIFDGRKSEKDVQIAAFLQEISGSLR 440          
BLAST of Mpv17-like protein vs. Ensembl Medaka
Match: si:ch211-125a15.1 (chromosome 23 C12orf66 homolog [Source:NCBI gene;Acc:101154911])

HSP 1 Score: 50.8322 bits (120), Expect = 1.801e-6
Identity = 42/167 (25.15%), Postives = 72/167 (43.11%), Query Frame = 1
Query:  514 SITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQF-ELIHRQSEL-----------AMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYSILTIGYSMSPDSFP-MVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFS 975
            S   EV V+++LL    + +   FL  L  +  A + L  + +L  RQ E               P  L  WL+     +L K++ YF   LS+ +      +++  + P    KI  F  K      +L+FD  +  +++  HGY  PH++ E   G+  + +I S
Sbjct:  195 SFQTEVDVVTQLLRCQAQVSEWRFLPALLSLHGAQSKLVAWGQLFQRQKETRKLLFGGQSQKTAQPPHLYTWLQRFQAALLAKFSFYFHEALSRQTTPADMRALTARTAPDYHGKICAFIRKHDASNVSLVFD-NRGSESFQGHGYHHPHSYREAPKGVDQFPAIVS 360          
BLAST of Mpv17-like protein vs. Planmine SMEST
Match: SMESG000008167.1 (SMESG000008167.1)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 404/404 (100.00%), Postives = 404/404 (100.00%), Query Frame = 1
Query:   43 MECIYSYFENLGKLNFISAKNKIKLIVVEDNNSSLSDLLNQIVCLERNYCNLIFITYKQSGLLGRKKQTESFIDSRVLLNEIKNSKKFLSSNCDLIFSNLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQDEKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQFELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYSILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFSTSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLRVE 1254
            MECIYSYFENLGKLNFISAKNKIKLIVVEDNNSSLSDLLNQIVCLERNYCNLIFITYKQSGLLGRKKQTESFIDSRVLLNEIKNSKKFLSSNCDLIFSNLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQDEKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQFELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYSILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFSTSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLRVE
Sbjct:    1 MECIYSYFENLGKLNFISAKNKIKLIVVEDNNSSLSDLLNQIVCLERNYCNLIFITYKQSGLLGRKKQTESFIDSRVLLNEIKNSKKFLSSNCDLIFSNLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQDEKRICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQFELIHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYSILTIGYSMSPDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFSTSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFLRVE 404          
BLAST of Mpv17-like protein vs. Planmine SMEST
Match: SMESG000017214.1 (SMESG000017214.1)

HSP 1 Score: 124.79 bits (312), Expect = 2.432e-31
Identity = 131/443 (29.57%), Postives = 204/443 (46.05%), Query Frame = 1
Query:   52 IYSYFENLGKLNFISAKNKIKLI------VVEDNNSSLSDLLN---QIVCLERNYCNLIFITYKQSGLLG-RKKQTESFIDSRVLLNEIKNSKKFLSSNCDLIF----SNLMFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQDEKR-----ICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQFELIHRQSELAMHPLPLLNWLRDLSR----------------FVLDKYTLYFQPILSKYSILTIGYSMS---PDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPLIGLQNYQSIFSTSVTPMNQDEL-----FVTVSLIREKIDNQ--QKKVAHLIQNSHNHRSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEFL 1245
            ++ YF NL   N+  AK+ +         V  D+ S LS L++    I+ LER Y    F+  K+  +   R+   +S+ +  V +  I   K    S  + IF    S+L  + D R  M E Y  IS +       + + +  ++ IK  L+++ D  R     +  PLL  I +EV  L  L EA +  +NLYFL P+N + +AN    Q   I           PL    R  SR                  L KY+LYF PIL +  I     + +     +  MV +I  F  K +     L+FD TKQ   +  HGYVLP  + + + GLQ+Y  IFS    PM + EL        V LI  K++N    +++ +L +      + +YF+ +I++RVYL L+F   + EK++ IL+FI ++  +L G  +I+ L
Sbjct:    7 LHEYFMNLATFNYAKAKHIMDHSYSSSSHVKNDSKSGLSKLISGYITILNLERKYYAFDFLINKRKSIFSLRESHFDSYAELLVKILAIPPDKTTFESEFEDIFTIAKSSLAQICDLRWRMTEMYLEISQIGRNNSRSIVNIVDIVRPIKEYLKQIVDLNRETTLSMTSPLLDVIELEVDTLMCLAEAQELMSNLYFLVPINLLHSANEKCQQLLQICS---------PLTTSGRIFSRNPTNLLLLSWLMELYNVSLAKYSLYFHPILMQKMIHLPANNFTTYESRALDMVQRITAFVKKASVSSFLLVFDATKQNHPFLGHGYVLPSNNGDRVSGLQSYPVIFS---CPM-ESELPHKWHCAIVMLIGHKMNNSINCEEIEYLAEPD---GTRTYFLARIDIRVYLILLF-EGRREKEKLILNFIENVKTDLNGKSVIDQL 432          
The following BLAST results are available for this feature:
BLAST of Mpv17-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C12orf661.883e-2024.52chromosome 12 open reading frame 66 [Source:HGNC S... [more]
C12orf662.995e-2026.32chromosome 12 open reading frame 66 [Source:HGNC S... [more]
C12orf663.918e-2024.88chromosome 12 open reading frame 66 [Source:HGNC S... [more]
back to top
BLAST of Mpv17-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mpv17-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mpv17-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C4H12orf662.888e-1523.49si:ch211-125a15.1 [Source:NCBI gene;Acc:555715][more]
back to top
BLAST of Mpv17-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C12orf664.547e-1722.94chromosome 12 open reading frame 66 [Source:NCBI g... [more]
back to top
BLAST of Mpv17-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
BC0484033.321e-2126.25cDNA sequence BC048403 [Source:MGI Symbol;Acc:MGI:... [more]
BC0484032.081e-2027.44cDNA sequence BC048403 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Mpv17-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q6P1I3|CL066_MOUSE2.323e-2026.25KICSTOR complex protein C12orf66 homolog OS=Mus mu... [more]
sp|Q96MD2|CL066_HUMAN4.514e-2025.12KICSTOR complex protein C12orf66 OS=Homo sapiens O... [more]
sp|Q6IR80|CL066_XENLA1.538e-1623.27KICSTOR complex protein C12orf66 homolog OS=Xenopu... [more]
sp|Q1L8F9|CL066_DANRE2.180e-1423.49KICSTOR complex protein C12orf66 homolog OS=Danio ... [more]
back to top
BLAST of Mpv17-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504Y6882.766e-2127.86Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A3L8SRK46.732e-2025.98Uncharacterized protein OS=Chloebia gouldiae OX=44... [more]
A0A401PLX68.318e-2024.94Uncharacterized protein OS=Scyliorhinus torazame O... [more]
E9GMT51.203e-1925.54Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
A0A226EVN91.491e-1926.67Uncharacterized protein OS=Folsomia candida OX=158... [more]
back to top
BLAST of Mpv17-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-125a15.14.439e-1923.08chromosome 7 C12orf66 homolog [Source:NCBI gene;Ac... [more]
si:ch211-125a15.16.647e-1923.08chromosome 7 C12orf66 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of Mpv17-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-125a15.11.652e-1221.23chromosome 12 open reading frame 66 [Source:HGNC S... [more]
back to top
BLAST of Mpv17-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mpv17-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO428542.425e-1622.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mpv17-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-125a15.19.808e-1224.80chromosome 23 C12orf66 homolog [Source:NCBI gene;A... [more]
si:ch211-125a15.19.833e-1224.80chromosome 23 C12orf66 homolog [Source:NCBI gene;A... [more]
si:ch211-125a15.11.801e-625.15chromosome 23 C12orf66 homolog [Source:NCBI gene;A... [more]
back to top
BLAST of Mpv17-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000008167.10.000e+0100.00SMESG000008167.1[more]
SMESG000017214.12.432e-3129.57SMESG000017214.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030811 ID=SMED30030811|Name=Mpv17-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1265bp
TTTAACTAAGCACATTTAGACATTTTGCCAAATTATTTATACATGGAATG
CATTTATTCATATTTTGAAAATTTAGGGAAACTTAATTTTATTTCTGCCA
AGAATAAAATAAAATTAATAGTTGTAGAAGATAATAATTCTTCACTATCA
GACTTACTTAATCAAATAGTTTGTCTAGAAAGAAATTATTGTAATTTAAT
ATTTATTACTTATAAACAGTCTGGATTACTTGGTAGGAAAAAACAAACTG
AAAGTTTTATAGATTCCAGAGTTTTATTAAATGAAATTAAAAACAGCAAA
AAGTTCTTGTCAAGCAATTGTGATCTTATCTTTTCTAACTTAATGTTTTT
ATTAGATCATCGATGTAATATGATCGAATTTTATAAAAGTATTTCCGGTT
TAAAATCGAAACCTGGCTTTATGGTATCTGACAGTTTACCAAAATTGAAA
ACAATTAAAAATTCATTAGAAAAACTTCAAGATGAAAAGCGCATATGTGA
CCCTTTATTACTATCAATTACTATTGAAGTGAGAGTTTTATCCAAATTGC
TCGAAGCTCATGACAAAACTACAAATCTTTACTTTCTCGATCCTCTTAAT
GAAATGCAAGCTGCTAACACAGATCTCAATCAGTTTGAATTAATTCATCG
TCAATCAGAACTAGCCATGCATCCTCTTCCATTGCTCAATTGGTTGAGAG
ATCTCAGTAGGTTCGTATTGGACAAATACACTCTTTATTTCCAACCAATA
TTATCCAAGTATTCCATATTGACAATCGGTTATTCAATGAGTCCAGACTC
TTTTCCAATGGTGGATAAAATTCGACAATTTGCCTTCAAGCAGGCGCCCT
GCGTAGCAACACTTCTATTTGATACAACAAAACAAATCGACACTTACACC
AGCCACGGATATGTTTTGCCACATACTCACGTCGAACCGTTAATTGGGTT
GCAGAATTATCAATCAATATTCTCGACCAGTGTGACGCCAATGAATCAAG
ATGAATTATTCGTTACCGTTTCTTTGATAAGAGAAAAAATTGACAACCAA
CAGAAAAAAGTCGCTCATTTAATCCAAAATAGTCACAATCATAGATCAAC
GTCCTATTTCGTTTGTAAAATAGAACTCAGAGTATATTTATCTCTTATAT
TTGCATCAAATAAAAATGAGAAAGACAGACACATTTTATCTTTTATTAAT
GATATATCTAATGAGCTGCAAGGTTTGAGAATGATTGAATTTCTACGAGT
CGAATAAATATTTTT
back to top

protein sequence of SMED30030811-orf-1

>SMED30030811-orf-1 ID=SMED30030811-orf-1|Name=SMED30030811-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=405bp
MECIYSYFENLGKLNFISAKNKIKLIVVEDNNSSLSDLLNQIVCLERNYC
NLIFITYKQSGLLGRKKQTESFIDSRVLLNEIKNSKKFLSSNCDLIFSNL
MFLLDHRCNMIEFYKSISGLKSKPGFMVSDSLPKLKTIKNSLEKLQDEKR
ICDPLLLSITIEVRVLSKLLEAHDKTTNLYFLDPLNEMQAANTDLNQFEL
IHRQSELAMHPLPLLNWLRDLSRFVLDKYTLYFQPILSKYSILTIGYSMS
PDSFPMVDKIRQFAFKQAPCVATLLFDTTKQIDTYTSHGYVLPHTHVEPL
IGLQNYQSIFSTSVTPMNQDELFVTVSLIREKIDNQQKKVAHLIQNSHNH
RSTSYFVCKIELRVYLSLIFASNKNEKDRHILSFINDISNELQGLRMIEF
LRVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR038060C12orf66-like_central_sf
IPR018544C12orf66-like
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038060KICSTOR complex protein C12orf66-like, central domain superfamilyGENE3DG3DSA:1.10.3450.30coord: 75..247
e-value: 7.3E-20
score: 72.9
IPR038060KICSTOR complex protein C12orf66-like, central domain superfamilySUPERFAMILYSSF158548FLJ32549 domain-likecoord: 97..241
IPR018544KICSTOR complex protein C12orf66-likePFAMPF09404C12orf66_likecoord: 6..399
e-value: 6.1E-29
score: 101.1
IPR018544KICSTOR complex protein C12orf66-likePANTHERPTHR31581FAMILY NOT NAMEDcoord: 5..402
NoneNo IPR availableGENE3DG3DSA:3.30.450.240coord: 256..392
e-value: 8.8E-21
score: 76.1
NoneNo IPR availableSUPERFAMILYSSF160651FLJ32549 C-terminal domain-likecoord: 257..401