Prominin (Prom) protein, putative

Overview
NameProminin (Prom) protein, putative
Smed IDSMED30030797
Length (bp)3485
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Prominin (Prom) protein, putative (SMED30030797) t-SNE clustered cells

Violin plots show distribution of expression levels for Prominin (Prom) protein, putative (SMED30030797) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Prominin (Prom) protein, putative (SMED30030797) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Prominin (Prom) protein, putative (SMED30030797) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030797

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30030797SMESG000010133.1 dd_Smed_v4_4175_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030797SMESG000010133.1 dd_Smed_v4_4175_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: A0A5J4N486 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0003829 PE=4 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 1.844e-70
Identity = 229/873 (26.23%), Postives = 396/873 (45.36%), Query Frame = 1
Query:  346 ILNNAQTVHDGGLINSILQNVQIL-----NNSNVKRD--IMPYVVSSRMTGGYVAALFFGILWILALISAMVY--------------MFYLY-FKRPNSNTNRKPIRRQFLAVRSFFAKGDKNSFSFVYSXXXXXXXXXXXXXXXXXCFCLTNANQIHRSIGESAQSYNA----------NSTAKPNAIL-PALKKSLYHIRNYLSTFADNARQNTASTVDEIIQATKDMQKETQKDFNKKLMTRLGVENTFKYGQEMTNIVVKFYDISNALLNNQTQYNGVIQELYPRV---MNPTFRLFDFIGEIRNSFKQLPDCDEGCKQFEAFF--NQPFAEVEGFPETSFATSFLFVMKQQNKTRESVIAQTQHGRKEMNKTMAKTEEKMKRLLDIDGTVRNMTGETWTKMEMNFVKIVELIDNITMKLNSDNVSNKASRYSGLLLAV--LFVPIFL----GIVVLFFAL-SVATSLHVWPEKRPHSALQIGMYLSLIFLALIMLVCTLTFLYGGKVETELCRYLRTNQP-IVVTHNDT---------RLVLDEHINRFLQVNLPKIA----KSMPKSEFPLPKP--RNVLYGLIKKCQKNEPILAAINAIESLDTAALSKPEVAAKFIRVGRQLLIESLNETDPKKMLPPDMKDSLQQASQLGMFKAIDTEESIRKVPRTPIFITTNNGKEP----MAITTFMDNVDKYISHYVININDPVMKNKLNQDQ-KKMMLLFEQFNL-------ITDRVRNIFSNMKYIPSIKPVVKSLSESLDKMLIILNNKTELFKIGNEYFDNIIVKSTPQKSAGIMAKFGPKMMSKLGHCRPIFEAYQSSIDTTCDIIVMKLNAYWLYLGAVGLLLTCILSIVFLML 2745
            I++  Q   DGGL+  +L NV  L     +NS+   D  ++ +V+++    GYV ++ FG++W + L    VY              + YL     P +  +  P      A R    +    S     + Q ++ +I A+ +   +      ++Q+H +I  S     A            T  P   L P L ++L   R Y S F    + +T   VD++IQAT+ MQ     +FN  L  +LGV N F+ G  + N V+     S +++   T +    ++ + R    +    RL    G   +       C   C+   A F  N         P  +FA +  FV   +N+T ESV AQ   G+    + + +T++ M   ++I  ++R+M  + W  +     K + L+D +  KL + +V+ K S  SG+ LA+  +F  I L    GI  L      V   L     +R  +    G+++    LAL ML+  + FL GG + TE CRYL  +Q  ++V   D             LD HIN F+  +   I     K++P    P+P P  R+ +Y L   C++N  IL A++AI   DTA+L+ PE++ +FI++GR+++++SL   D  ++ P +  + L  A +L  F  ++ EE   K+P T + I +++ +       +     +  D Y         + V++++L+ DQ  K+    +Q  +       +   +     ++     + P +  L  SL  +  +++NKT L +  N+ FD  I   TP ++A ++ +FGP++M+++G CR + EA+Q      C+ +V  LN +W   G V  + T I S   L+L
Sbjct:   11 IVDRTQPNLDGGLLTFVLNNVVRLPGSEQDNSSTTEDHTVVSHVITTFARTGYVLSITFGLIWTILLGLTGVYICCQGRQKKKHSNGLVYLAEAGGPVTEVDTPPHNSSGWAFRE--KRTQLQSHWLCLAIQFILFIILAVLLSTGVLLGFATSSQLHANIASSPTHEEAVGRLLNSAELEHTDPPRTYLFPRLLRALAQTRAYFSEFVYYTKNHTTPIVDQLIQATEAMQDRMTNEFNTILFDKLGVSNAFELGDALGNSVISLIRHSMSIVEQDTAF----KQHFDRFKIELQTWLRLITTYGPKSDD----TSCTARCQFLRAAFTGNLTVRHDTFMPSFTFAIALKFVTTDRNQTAESVQAQINQGKILAARQLTETKQIMAERINIPKSIRDMVDQQWDAIGSQMSKAIHLVDQLASKL-TRSVAPKVSSGSGVALALGCIFWSILLLLTIGIAWLIIHYHCVPNGLRSRERRRVRAVAAFGLFI----LALCMLLAMIFFLVGGYLSTEACRYLNPSQKKVIVVKRDAPKDTYTKELMFPLDSHINEFVNHHWVIITSLAEKAVPPGGKPMPLPHIRSPIYALSHNCRENMGILGAMDAIRDFDTASLNDPELSDRFIKIGREIMLDSLRAIDVNELFPKETDEQLAMAGRLDDF-IVNFEEIRGKLPATYLSIRSSDDESGNYKLYSEEDMWETWDAY--------QNEVLRDRLSTDQWTKLAAATQQVRIRLVNLGSVVSTIDGHLKDLAKAEKVGPTLTQLQTSLFHVKEVMSNKTALIEQANQLFDKHIAAKTPDEAAKLITQFGPQLMAEVGRCRRLHEAFQDVNSAVCEGVVSLLNGFWFVYGWVAFVGTLITSFGLLLL 859          
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: A0A183WSI6 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS15089 PE=4 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 2.491e-68
Identity = 223/880 (25.34%), Postives = 405/880 (46.02%), Query Frame = 1
Query:  331 SFANIILNNAQTVHDGGLINSILQNVQILNNSNV---------------KRDIMPYVVSSRMTGGYVAALFFGILW--ILALISAMVYMFYLYFKRPNS-------------NTNRKPIRRQFLAVRS----FFAKGDKNSFSFV-YSXXXXXXXXXXXXXXXXXCFCLTNANQIH----------RSIGESAQSYNANST-AKPNAILPALKKSLYHIRNYLSTFADNARQNTASTVDEIIQATKDMQKETQKDFNKKLMTRLGVENTFKYGQEMTNIVVKFYDISNALLNNQTQYNGVIQEL------YPRVMNPTFRLFDFIGEIRNSFKQLPDCDEGCKQFEA-FFNQPFAEVEGF-PETSFATSFLFVMKQQNKTRESVIAQTQHGRKEMNKTMAKTEEKMKRLLDIDGTVRNMTGETWTKMEMNFVKIVELIDNITMKLNSDNVSNKASRYSGLLLAVLFVPIFLGIVVLFFALSVATSLHVWPEK---RPHSALQIGMYLSLIFLALIMLVCTLTFLYGGKVETELCRYLRTNQPIV-VTHND---------TRLVLDEHINRFLQVNLPKIAK-SMPKSEFPLPKPRNVLYGLIKKCQKNEPILAAINAIESLDTAALSKPEVAAKFIRVGRQLLIESLNETDPKKMLPPDMKDSLQQASQLGMFKAIDTEESIRKVPRTPIFITTNNGKEPMAITTFMDNVDKYISHYVININDPVMK----NKLNQDQKKMMLLFEQFNLITDRVRNIFSNMKYIPSIK---PVVKSLSESLDKMLIILNNKTELFKIGNEYFDNIIVKSTPQKSAGIMAKFGPKMMSKLGHCRPIFEAYQSSIDTTCDIIVMKLNAYWLYLGAVGLLLTCILSIVFLML 2745
            S AN I++ AQ   DGG+I  IL N+  L   +                +  I  +++S+    GY   +   +LW  IL +I+        + K+ +              NT+R+ I    L   S    F+   ++   S++  + Q  ++ + AI +   +    T + Q+H           S+G        + T      I P L + L  IR Y+S F    + +    V E+IQAT+ MQ     +FN  L   +GV   F+ G  +   VV   +   A++ +  ++  +   L      + R++N      D+            +C + C    + F N      + F PE +FA +  F+   +N+T ES+ AQ  HG++  N+ + +T+  M   ++I  ++RNMT + W ++      ++  ID I + + + ++S K S  S L L +  +  F  +++    + +    H  P +   +  + +++G  +    LA+ +++  L +L GG + TE CRY+   Q ++ VT  D         T L +D HIN F+  N P I   S   S  P+P  R+ +YG++  C+ N+ IL A+++I+  D  AL+ P+++ +F+ +G++++I SL   +  +M P +  D+L  AS+L  F  ++ EE   ++P+  + I +   +        +D++ K    Y  +I    +     NKLN   +K+     Q + I   +++I  N+  + S+K   P+V  L   L  +  I+NNKT L     + FD  I   TP+++  ++ ++GPK+MSK+G CR ++ A     +  C+  V  LN +W  +G V L+ T I++   L+L
Sbjct:    6 SSANAIVSRAQPSLDGGIITFILNNLVHLPTPDSSSPSSSNQTTTTSDSEVTITHHILSTYSRTGYALGIVCAVLWSIILIIIACSTCRRRKHIKKHSETLIYLAPTDNHVLNTSRQTINTGSLTHHSSKSTFYRTRERLQSSWICLAIQFALLTLLAILLGTAVILGFTASGQLHTNLITTPIHEESVGRLLTIGELDITNPDKRHIFPRLLRGLAQIRAYISEFVPQTKIDIEPIVKELIQATEKMQDRMTNEFNAILFNDIGVTEAFQLGDILGGHVVTLINKYTAIVESNKEFKNIFDRLKVEFQSWLRLVNADSPQNDY------------NCVDQCSVLRSTFMNNVSVRPDSFMPEINFAIALKFLTTDRNQTAESIQAQLNHGKELANQQLERTKSMMAEKINIPESIRNMTNKQWDQIGSQLSDVLSRIDQIFIMI-TRSISPKVSSASSLFLTLNLIFWFSILLITIGLIWLIIRYHFVPAELGLQARNRVRLGASVGYFILAISIILACLFYLIGGYLYTEGCRYINPEQNMINVTDYDPTHQNYIQKTMLPVDAHINAFINRNWPAIVSISSQLSSMPVPHIRSPIYGILHNCRDNQGILQAMDSIKDFDMKALNDPQMSERFVNLGKEIMINSLESINVDEMFPKETDDNLAMASRLDDF-IVNYEEVRLQLPKYYLSIQSPTDEAGNFTLWSVDDMWKAWEMYYTDILSYRLSVEQMNKLNSATEKVRRTLIQLDSI---IKDIDENLIVLSSLKKSAPLVMKLQNRLIDLKAIMNNKTHLIHRAVQLFDENIKAKTPEEAMNLIVEYGPKIMSKVGQCRRVYSAVDDVNNAVCNGFVSVLNGFWFLMGWVTLIGTLIITFSLLLL 868          
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: A0A074ZPJ9 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_05281 PE=4 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 8.230e-67
Identity = 225/885 (25.42%), Postives = 399/885 (45.08%), Query Frame = 1
Query:  346 ILNNAQTVHDGGLI----NSILQ-------NVQILNNSNVKRDIMPYVVSSRMTGGYVAALFFGILWILALISAMVYMFYLYFKRPNSNTNRKPIRRQFLAVRSFFAKG--------------DKNSFSFVYSXXXXXXXXXXXXXXXXXCFCL-------------TNANQIH----------RSIGE---SAQSYNANSTAKPNAILPALKKSLYHIRNYLSTFADNARQNTASTVDEIIQATKDMQKETQKDFNKKLMTRLGVENTFKYGQEMTNIVVKFYDISNALLNNQTQYNGVIQELYPRVMNPTFRLFDFIGEIRNSFKQLPD--CDEGCKQF-EAFFNQPFAEVEGF-PETSFATSFLFVMKQQNKTRESVIAQTQHGRKEMNKTMAKTEEKMKRLLDIDGTVRNMTGETWTKMEMNFVKIVELIDNITMKLNSDNVSNKASRYSGLLLAV------LFVPIFLGIVVLFFAL-SVATSLHVWPEKRPHSALQIGMYLSLIFLALIMLVCTLTFLYGGKVETELCRYLRTNQPIV--VTHN--------DTRLVLDEHINRFLQVNLPKIA----KSMPKSEFPLPKP--RNVLYGLIKKCQKNEPILAAINAIESLDTAALSKPEVAAKFIRVGRQLLIESLNETDPKKMLPPDMKDSLQQASQLGMFKAIDTEESIRKVPRTPIFITTNNGKE------PMAITTFMDNVDKYISH-YVININDPVMKNKLNQDQKKMMLLFEQFNLITDRVRNIFSNMKYIPSIKPVVKSLSESLDKMLIILNNKTELFKIGNEYFDNIIVKSTPQKSAGIMAKFGPKMMSKLGHCRPIFEAYQSSIDTTCDIIVMKLNAYWLYLGAVGLLLTCILSIVFLML 2745
            I++  Q   DGGL+    N+I+Q       NV   +  +  RD   +V+S+    GY  A+  G+LWI+ L++A V++ +           RK  R+  +   +    G               K S    Y  +  +   ++        FCL             T ++Q+H           +IG    SA+  + +S+   + + P L ++L  +R YLS F  N + +TA  V+E+I+AT+ MQ     +FN  L  ++GV   F  G  + + V+     S A++   T      +            L  ++  I N    L D  C   C+   + F     A  + F P  +FA +  FV   +N+T E+V AQ   G+   +K + +T++ M   ++I  ++ +M  + W  +     K ++ ID   + + + +V+ K S  S + LAV      LF+ + +GI  L      V   L+     R  S    G    L+  A+ ML   + FL  G   +E+CRYL   Q +V  V H+        +T   LD HIN FL  + P+I     ++ P    P+P P  R+ +Y L   CQ++  +L A +AI   +  +L+ PE++A+F+ +GR+++++SL   DP +M P +  + L  A +L  F  ++ EE  + +P T  +++    +E      P       D  D Y +  Y     + V K +    Q ++ L     N+ T  +    + +     +  VV SL  +L K+  ++++K  L ++  + F+  I  +TP ++A ++  +GPK+M+++G CR ++EA +   ++ C  +V  +N  W   G + L+ T ++SI  L+L
Sbjct:   11 IISYTQPSLDGGLLAYAFNNIVQLPTAKQANVSFYSPKHTVRD---HVLSTYARTGYAVAVTSGLLWIILLLTAAVFLCF--------QCRRKARRKTAMVYLTDMTSGVMEANMPMLVMDAAPKRSSKPFYKRREQLQSHWSCLAIQFFLFCLLTVLLGTGVLLGFTVSSQLHANLASPPTHEEAIGRLLTSAELEHVDSSK--SHVFPRLLRALAQVRAYLSEFVQNTKNHTAPAVEELIRATEQMQDGMTNEFNALLFDKIGVSEAFAQGDLLGSSVISLITHSMAVVEQDTSVKAHFERF-------KIELQTWLRLINNYGPSLTDGNCTGQCRWLHDTFAGNLTARPDSFMPPFTFAIALKFVTTDRNQTAETVQAQLNQGKILADKQLIETKKIMAERINIPKSIGDMIDQRWDMLGSQLGKAIQAIDQAALMV-TRSVAPKVSSGSTIALAVGCIFWSLFLLLTVGITWLLIHYHCVPGKLNRHDRHRVRSVASCG----LVLFAISMLFAVILFLSAGYAYSEVCRYLDPGQKMVTVVRHDTLKGTYTSETVFTLDSHINEFLNQHWPEIEAIALRATPPGSKPMPIPHIRSPVYALTHNCQQDMGVLQAFDAIRDFNMTSLNDPEMSARFVNIGREIMMDSLRSIDPNEMFPAETDEQLAMAGRLDDF-IVNFEELRQNLPTT--YVSVRGTEEDSVNYRPYPEKAMWDAWDAYRTIIYPSLTTEQVQKIEFATQQVRLGLTQMAANIKT--IDGHLTELSKAKKVSHVVVSLQANLAKLKSLMSDKPRLLEVAVKLFEENIAANTPDEAAKLVVTYGPKLMAEVGRCRRLYEATRDVTESVCGGVVTVMNGVWFVAGWITLVGT-VISIFGLLL 864          
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: H2KNI2 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_100222 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.139e-66
Identity = 223/882 (25.28%), Postives = 396/882 (44.90%), Query Frame = 1
Query:  346 ILNNAQTVHDGGLINSILQNVQIL---NNSNV-----KRDIMPYVVSSRMTGGYVAALFFGILWILALISAMVYMFYLYFKRPNSNTNRKPIRRQFLAVRSFFAKG--------------DKNSFSFVYSXXXXXXXXXXXXXXXXXCFCL-------------TNANQIHRSIGE-------------SAQSYNANSTAKPNAILPALKKSLYHIRNYLSTFADNARQNTASTVDEIIQATKDMQKETQKDFNKKLMTRLGVENTFKYGQEMTNIVVKFYDISNALLNNQTQYNGVIQELYPRVMNPTFRLFDFIGEIRNSFKQLPD--CDEGCKQF-EAFFNQPFAEVEGF-PETSFATSFLFVMKQQNKTRESVIAQTQHGRKEMNKTMAKTEEKMKRLLDIDGTVRNMTGETWTKMEMNFVKIVELIDNITMKLNSDNVSNKASRYSGLLLAV------LFVPIFLGIVVLFFAL-SVATSLHVWPEKRPHSALQIGMYLSLIFLALIMLVCTLTFLYGGKVETELCRYLRTNQPIV--VTHN--------DTRLVLDEHINRFLQVNLPKIA----KSMPKSEFPLPKP--RNVLYGLIKKCQKNEPILAAINAIESLDTAALSKPEVAAKFIRVGRQLLIESLNETDPKKMLPPDMKDSLQQASQLGMFKAIDTEESIRKVPRTPIFITTNNGKE------PMAITTFMDNVDKYIS-HYVININDPVMKNKLNQDQKKMMLLFEQFNLITDRVRNIFSNMKYIPSIKPVVKSLSESLDKMLIILNNKTELFKIGNEYFDNIIVKSTPQKSAGIMAKFGPKMMSKLGHCRPIFEAYQSSIDTTCDIIVMKLNAYWLYLGAVGLLLTCILSIVFLML 2745
            I++  Q   DGGL+   L N+  L     +NV     K  +  +V+S+    GY  A+  G+LWI+ L++A V++ +           RK  R+  +   +    G               K S    Y  +  +   ++        FCL             T ++Q+H S+               SA+  + +S+   + + P L ++L  +R YLS F  N + +TA  V+E+I+AT+ MQ     +FN  L  ++GV   F  G  + + V+     S A++   T      +            L  ++  I N    L D  C + C    + F     A  + F P  +FA +  FV   +N+T E+V AQ   G+   +K + +T++ M   ++I  ++ +M  E W  +     K ++ ID   + + + +V+ K S  S + LAV      LF+ + +GI  L      V + L+     R  S    G    L+  A+ M    + FL  G   +E+CRYL   Q +V  V H+        +T   LD HIN FL  + P+I     ++ P    P+P P  R+ +Y +   C++N  +L A +AI   +  +L+ PE++A+F+ +GR+++++SL   DP +M P +  + L  A +L  F  ++ EE  + +P T  +++    +E      P       D  D Y +  Y     + V K +    Q ++ L     N+ T  +    +++     +  VV SL  +L K+  ++++K  L +I  + F+  I   TP ++A ++  +GPK+M+++G CR ++EA +   ++ C  +V  +N  W   G + L+ T ++SI  L+L
Sbjct:   11 IISYTQPSLDGGLLAYALNNIVQLPTAKQANVSFYSPKHTVRDHVLSTYARTGYAVAVTSGLLWIILLLTAAVFLCF--------QCRRKARRKTGMVYLADMTSGVMEANMPMLVMDAAPKRSSKPFYKRREQLQSHWSCLAVQFFLFCLLTVLLGTGVLLGFTVSSQLHASLASPPTHEEAIGRLLTSAELEHVDSSK--SHVFPRLLRALAQVRAYLSEFVQNTKNHTAPVVEELIRATERMQDGMTNEFNALLFDKIGVSEAFAQGDLLGSSVISLITHSMAVVEQDTSVKAHFERF-------KIELQTWLRLINNYGPSLTDGNCTDQCHLLHDTFTGNLTARPDSFMPPFTFAIALKFVTTDRNQTAETVQAQLNQGKILADKQLTETKKIMAERINIPKSIGDMIDERWDMLGPQLGKAIQAIDQAALMV-TRSVAPKVSSGSTIALAVGCIFWSLFLLLTVGITWLLIHYHCVPSKLNRHDRHRVRSVASCG----LVLFAISMSFAVILFLSAGYAYSEVCRYLDPGQKMVTVVRHDTLKGTYTSETVFPLDSHINEFLNQHWPEIEAIALRAAPAGNKPMPLPHIRSPIYAVTHNCRQNMGVLQAFDAIRDFNMTSLNDPEMSARFVNIGREIMMDSLRSIDPNEMFPAETDEQLAMAGRLDDF-IVNFEELRQNLPTT--YVSVRGTEEDSVNYRPYPEKAMWDAWDAYRTIIYPSLTAEQVQKIEFATQQVRLGLTQMAANIKT--IDGHLTDLSKAKKVGHVVVSLQANLAKLKSLMSDKPRLLEIAVKLFEENIAAKTPDEAAKLVVTYGPKLMAEVGRCRRLYEATRDVTESACGGVVTVMNGVWFVAGWITLVGT-VISIFGLLL 864          
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: A0A419PG13 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_671s PE=4 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 3.310e-66
Identity = 223/882 (25.28%), Postives = 395/882 (44.78%), Query Frame = 1
Query:  346 ILNNAQTVHDGGLINSILQNVQIL---NNSNV-----KRDIMPYVVSSRMTGGYVAALFFGILWILALISAMVYMFYLYFKRPNSNTNRKPIRRQFLAVRSFFAKG--------------DKNSFSFVYSXXXXXXXXXXXXXXXXXCFCL-------------TNANQIHRSIGE-------------SAQSYNANSTAKPNAILPALKKSLYHIRNYLSTFADNARQNTASTVDEIIQATKDMQKETQKDFNKKLMTRLGVENTFKYGQEMTNIVVKFYDISNALLNNQTQYNGVIQELYPRVMNPTFRLFDFIGEIRNSFKQLPD--CDEGCKQF-EAFFNQPFAEVEGF-PETSFATSFLFVMKQQNKTRESVIAQTQHGRKEMNKTMAKTEEKMKRLLDIDGTVRNMTGETWTKMEMNFVKIVELIDNITMKLNSDNVSNKASRYSGLLLAV------LFVPIFLGIVVLFFAL-SVATSLHVWPEKRPHSALQIGMYLSLIFLALIMLVCTLTFLYGGKVETELCRYLRTNQPIV--VTHN--------DTRLVLDEHINRFLQVNLPKIA----KSMPKSEFPLPKP--RNVLYGLIKKCQKNEPILAAINAIESLDTAALSKPEVAAKFIRVGRQLLIESLNETDPKKMLPPDMKDSLQQASQLGMFKAIDTEESIRKVPRTPIFITTNNGKE------PMAITTFMDNVDKYIS-HYVININDPVMKNKLNQDQKKMMLLFEQFNLITDRVRNIFSNMKYIPSIKPVVKSLSESLDKMLIILNNKTELFKIGNEYFDNIIVKSTPQKSAGIMAKFGPKMMSKLGHCRPIFEAYQSSIDTTCDIIVMKLNAYWLYLGAVGLLLTCILSIVFLML 2745
            I++  Q   DGGL+   L N+  L     +NV     K  +  +V+S+    GY  A+  G+LWI+ L++A V++ +           RK  R+  +   +    G               K S    Y  +  +   ++        FCL             T ++Q+H S+               SA+  + +S+   + + P L ++L  +R YLS F  N + +TA  V+E+I+AT+ MQ     +FN  L  ++GV   F  G  + + V+     S A++   T      +            L  ++  I N    L D  C   C    + F     A  + F P  +FA +  FV   +N+T E+V AQ   G+   +K + +T++ M   ++I  ++ +M  E W  +     K ++ ID   + + + +V+ K S  S + LAV      LF+ + +GI  L      V + L+     R  S    G    L+  A+ M    + FL  G   +E+CRYL   Q +V  V H+        +T   LD HIN FL  + P+I     ++ P    P+P P  R+ +Y +   C++N  +L A +AI   +  +L+ PE++A+F+ +GR+++++SL   DP +M P +  + L  A +L  F  ++ EE  + +P T  +++    +E      P       D  D Y +  Y     + V K +    Q ++ L     N+ T  +    +++     +  VV SL  +L K+  ++++K  L +I  + F+  I   TP ++A ++  +GPK+M+++G CR ++EA +   ++ C  +V  +N  W   G + L+ T ++SI  L+L
Sbjct:   11 IISYTQPSLDGGLLAYALNNIVQLPTAKQANVSFYSPKHTVRDHVLSTYARTGYAVAVTSGLLWIILLLTAAVFLCF--------QCRRKARRKTGMVYLADMTSGVMEANMPMLVMDAAPKRSSKPFYKRREQLQSHWSCLAVQFFLFCLLTVLLGTGVLLGFTVSSQLHASLASPPTHEEAIGRLLTSAELEHVDSSK--SHVFPRLLRALAQVRAYLSEFVQNTKNHTAPVVEELIRATERMQDGMTNEFNALLFDKIGVSEAFAQGDLLGSSVISLITHSMAVVEQDTSVKAHFERF-------KIELQTWLRLINNYGPSLTDGNCTGQCHLLHDTFTGNLTARPDSFMPPFTFAIALKFVTTDRNQTAETVQAQLNQGKILADKQLTETKKIMAERINIPKSIGDMIDERWDMLGPQLGKAIQAIDQAALMV-TRSVAPKVSSGSTIALAVGCIFWSLFLLLTVGITWLLIHYHCVPSKLNRHDRHRVRSVASCG----LVLFAISMSFAVILFLSAGYAYSEVCRYLDPGQKMVTVVRHDTLKGTYTSETVFPLDSHINEFLNQHWPEIEAIALRAAPAGNKPMPLPHIRSPIYAVTHNCRQNMGVLQAFDAIRDFNMTSLNDPEMSARFVNIGREIMMDSLRSIDPNEMFPAETDEQLAMAGRLDDF-IVNFEELRQNLPTT--YVSVRGTEEDSVNYRPYPEKAMWDAWDAYRTIIYPSLTAEQVQKIEFATQQVRLGLTQMAANIKT--IDGHLTDLSKAKKVGHVVVSLQANLAKLKSLMSDKPRLLEIAVKLFEENIAAKTPDEAAKLVVTYGPKLMAEVGRCRRLYEATRDVTESACGGVVTVMNGVWFVAGWITLVGT-VISIFGLLL 864          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Sea Lamprey
Match: prom1b (prominin 1 b [Source:ZFIN;Acc:ZDB-GENE-031003-1])

HSP 1 Score: 51.9878 bits (123), Expect = 9.096e-7
Identity = 87/384 (22.66%), Postives = 148/384 (38.54%), Query Frame = 1
Query: 1654 SALQIGMYLSLIFLALIMLVCTLTFLYGGKVETELCRYLRTNQPIVVTHNDTRLVLDEHINRFLQV-NLPKIAKSMPKSEFPLPKPRNVLYGLIKKCQKNEPILAAINA-----IESLDTAALSKPEVAAKFIRVGRQLLIESLNETDPKKMLPPDMKDSLQQASQLGMFKAID----TEESIRKVPRTPIFI-------TTNNGKEPMAITTFMDNVDKYIS--HY----VININDPVMKNKLNQDQKKMMLLFEQFNLITDRVRNIFSNMKYIPSIKPVVKSLSESLDKMLIILNNKTELFKIGNEYFDNIIVKSTPQKSAGIMAKFGPKMMSKLGHCRPIFEAYQSSIDTTCDIIVMKLNAYWLYLGAVGLLLTCILSIVF 2736
            +A+  G+  S IF  L+MLV T TF+ GG VE   C+ L                 D+++ +F    NL K    +P   F  P     + G+   C+ N+ I +A        ++SL        ++ +KF  +   L           K+L P +K SL   +  G+ K ID    T E  + + +  + +         NN  +  A+   +      I   HY    ++N +   +   LN  Q+  + L  +   + D++                 +SL  +    +II   KT +  I   YF++ +             KF   + +K+  C+P+     S     C  ++  LNA+W  LG   + L  I SI+F
Sbjct:  482 NAVSSGVAFSFIFSWLLMLVVTFTFVLGGNVEKLFCQALA----------------DKNLFKFFDTPNLFKPKHLLPGVLFNKPDLNMTIEGVYSDCKMNKGIYSAFQLSNLFNLDSLLNMTQYTNDITSKFDPINANL--------SDMKLLEPSVKQSLLDFATTGIDK-IDFSAFTAELNKGITKVDLLLFADELSEKANNLPQSGALANALRGHAASIRWIHYNQVVLLNSSMSTLNKSLNSLQRTSLALQSEITEVIDKL--------------DTAQSLINNNASQVIIGETKTYMKTIIG-YFESYVT----------WTKF--SISNKVATCKPVSNLVDSVDIIACSYVMDSLNAFWFGLGWATVFL--IPSIIF 811          
BLAST of Prominin (Prom) protein, putative vs. Planmine SMEST
Match: SMESG000010133.1 (SMESG000010133.1)

HSP 1 Score: 1682.92 bits (4357), Expect = 0.000e+0
Identity = 833/843 (98.81%), Postives = 838/843 (99.41%), Query Frame = 1
Query:  325 MESFANIILNNAQTVHDGGLINSILQNVQILNNSNVKRDIMPYVVSSRMTGGYVAALFFGILWILALISAMVYMFYLYFKRPNSNTNRKPIRRQFLAVRSFFAKGDKNSFSFVYSXXXXXXXXXXXXXXXXXCFCLTNANQIHRSIGESAQSYNANSTAKPNAILPALKKSLYHIRNYLSTFADNARQNTASTVDEIIQATKDMQKETQKDFNKKLMTRLGVENTFKYGQEMTNIVVKFYDISNALLNNQTQYNGVIQELYPRVMNPTFRLFDFIGEIRNSFKQLPDCDEGCKQFEAFFNQPFAEVEGFPETSFATSFLFVMKQQNKTRESVIAQTQHGRKEMNKTMAKTEEKMKRLLDIDGTVRNMTGETWTKMEMNFVKIVELIDNITMKLNSDNVSNKASRYSGLLLAVLFVPIFLGIVVLFFALSVATSLHVWPEKRPHSALQIGMYLSLIFLALIMLVCTLTFLYGGKVETELCRYLRTNQPIVVTHNDTRLVLDEHINRFLQVNLPKIAKSMPKSEFPLPKPRNVLYGLIKKCQKNEPILAAINAIESLDTAALSKPEVAAKFIRVGRQLLIESLNETDPKKMLPPDMKDSLQQASQLGMFKAIDTEESIRKVPRTPIFITTNNGKEPMAITTFMDNVDKYISHYVININDPVMKNKLNQDQKKMMLLFEQFNLITDRVRNIFSNMKYIPSIKPVVKSLSESLDKMLIILNNKTELFKIGNEYFDNIIVKSTPQKSAGIMAKFGPKMMSKLGHCRPIFEAYQSSIDTTCDIIVMKLNAYWLYLGAVGLLLTCILSIVFLMLNSSGQDSSLPYEADKEKEANVAKSLIKENELESTKV 2853
            MESFANIILNNAQTVHDGGLINSILQNVQILNNSNVKRDIMPYVVSSRMTGGYVAALFFGILWILALISAMVYMFYLYFKRPNSNTNRKPIRRQFL V++FFAKGDKNSFSFVYSFQIVVIVIF+IPIFLLLCFCLTNANQI  SIGESAQSYNANSTAKPNAILPALKKSLYHIRNYLSTFADNARQNTASTVDEIIQATKDMQKETQKDFNKKLMTRLGVENTFKYGQEMTNIVVKFYDISNALLNNQTQYNGVIQELYPRVMNPTFRLFDFIGEIRNSFKQLPDCDEGCKQFE FFNQPFAEVEGFPETSFATSFLFVMKQQNKTRESVIAQTQHGRKEMNKTMAKTEEKMKRLLDIDGTVRNMTGETWTKMEMNFVKIVELIDNITMKLNSDNVSNKASRYSGLLLAVLFVPIFLGIVVLFFALSVATSLHVWPEKRPHSALQIGMYLSLIFLALIMLVCTLTFLYGGKVETELCRYLRTNQP VVTHNDTRLVLDEHINRFLQVNLPKIAKSMPKSEFPLPKPRNVLYGLIKKCQKNEPILAAINAIESLDTAALSKPEVAAKFIRVGRQLLIESLNETDPKKMLPPDMKDSLQQASQLGMFKAIDTEESIRKVPRTPIFITTNNGKEPMAITTFMDNVDKYISHYVI+INDPVMKNKLNQDQKKMMLLFEQFNLITDRV+NIFSNMKYIPSIKPVVKSLSESLDKMLIILNNKTELFKIGNEYFDNIIVKSTPQKSAGIMAKFGPKMMSKLGHCRPIFEAYQSSIDTTCDIIVMKLNAYWLYLGAVGLLLTCILSIVFLMLNSSGQDSSLPYEADKEKEANVAKSLIKENELESTKV
Sbjct:    1 MESFANIILNNAQTVHDGGLINSILQNVQILNNSNVKRDIMPYVVSSRMTGGYVAALFFGILWILALISAMVYMFYLYFKRPNSNTNRKPIRRQFLPVKNFFAKGDKNSFSFVYSFQIVVIVIFSIPIFLLLCFCLTNANQIRHSIGESAQSYNANSTAKPNAILPALKKSLYHIRNYLSTFADNARQNTASTVDEIIQATKDMQKETQKDFNKKLMTRLGVENTFKYGQEMTNIVVKFYDISNALLNNQTQYNGVIQELYPRVMNPTFRLFDFIGEIRNSFKQLPDCDEGCKQFETFFNQPFAEVEGFPETSFATSFLFVMKQQNKTRESVIAQTQHGRKEMNKTMAKTEEKMKRLLDIDGTVRNMTGETWTKMEMNFVKIVELIDNITMKLNSDNVSNKASRYSGLLLAVLFVPIFLGIVVLFFALSVATSLHVWPEKRPHSALQIGMYLSLIFLALIMLVCTLTFLYGGKVETELCRYLRTNQPKVVTHNDTRLVLDEHINRFLQVNLPKIAKSMPKSEFPLPKPRNVLYGLIKKCQKNEPILAAINAIESLDTAALSKPEVAAKFIRVGRQLLIESLNETDPKKMLPPDMKDSLQQASQLGMFKAIDTEESIRKVPRTPIFITTNNGKEPMAITTFMDNVDKYISHYVISINDPVMKNKLNQDQKKMMLLFEQFNLITDRVKNIFSNMKYIPSIKPVVKSLSESLDKMLIILNNKTELFKIGNEYFDNIIVKSTPQKSAGIMAKFGPKMMSKLGHCRPIFEAYQSSIDTTCDIIVMKLNAYWLYLGAVGLLLTCILSIVFLMLNSSGQDSSLPYEADKEKEANVAKSLIKENELESTKV 843          
The following BLAST results are available for this feature:
BLAST of Prominin (Prom) protein, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4N4861.844e-7026.23Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A183WSI62.491e-6825.34Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A074ZPJ98.230e-6725.42Uncharacterized protein OS=Opisthorchis viverrini ... [more]
H2KNI21.139e-6625.28Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A419PG133.310e-6625.28Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prom1b9.096e-722.66prominin 1 b [Source:ZFIN;Acc:ZDB-GENE-031003-1][more]
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000010133.10.000e+098.81SMESG000010133.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030797 ID=SMED30030797|Name=Prominin (Prom) protein, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=3485bp
GATTTATTGGATTAAGTTTAAATTTTACACGACATAAGGATATTTGCATA
ACGCTTTACCTTTGCTCTTTTCATTTAGTATGTGTAATATAAATGCATAC
AATTGTGTAATTTTATAAAAAAATTGATTTTCATTCATCATGCGACTGAA
CATGGTAATGCACACATTTGTCACATGTAAGATTGATTCTATTATTAAAA
ACCAAAAAAATGAATTTCATTCGTTAGCTTGCCAACCAATTATTATTTAT
TTAATTATTACATTATCTTTGTAAAATTAAGATTGATATTAATTTTTTTC
AATATTTTACAATCAATCACAATTATGGAGAGTTTTGCAAATATAATTCT
TAACAATGCTCAAACAGTTCATGATGGTGGATTAATCAATTCCATATTGC
AAAATGTTCAAATTTTGAACAATTCTAATGTAAAAAGGGATATTATGCCC
TATGTTGTGTCCTCAAGAATGACCGGTGGATATGTTGCTGCCTTATTTTT
TGGAATTCTTTGGATTTTAGCTTTGATATCAGCAATGGTTTATATGTTTT
ATTTATATTTTAAACGTCCAAATTCAAATACTAATCGTAAGCCTATACGA
AGACAATTTTTAGCAGTGAGAAGCTTTTTCGCGAAAGGTGATAAAAATTC
GTTTTCTTTTGTATATTCTTTTCAGATAGTAGTAATTGTTATTTTTGCTA
TTCCTATATTTTTGTTACTTTGTTTCTGTTTGACAAATGCCAATCAAATT
CATCGTTCGATAGGTGAGTCTGCTCAAAGCTATAATGCTAATTCTACAGC
AAAACCAAATGCTATTCTACCAGCATTGAAAAAATCACTTTATCATATTC
GAAATTATTTATCTACATTTGCTGACAACGCTAGACAAAATACTGCTTCA
ACTGTCGATGAAATAATCCAAGCTACTAAAGATATGCAAAAGGAAACCCA
GAAGGATTTTAACAAGAAACTCATGACACGATTAGGAGTTGAAAATACCT
TTAAATATGGACAAGAAATGACAAATATTGTGGTCAAGTTTTATGATATT
TCTAATGCTTTATTGAACAATCAGACACAGTATAATGGCGTGATTCAAGA
ACTGTATCCTAGGGTTATGAATCCGACTTTTAGATTGTTTGATTTTATTG
GAGAAATCAGAAACAGTTTCAAACAACTTCCAGATTGCGATGAAGGATGT
AAACAATTTGAGGCGTTTTTTAATCAGCCATTTGCAGAAGTTGAAGGATT
TCCAGAAACAAGCTTTGCGACTTCATTTTTGTTTGTCATGAAACAACAAA
ACAAAACCCGTGAATCAGTGATTGCTCAAACTCAGCACGGTCGGAAGGAA
ATGAATAAAACAATGGCTAAAACCGAGGAAAAAATGAAACGTTTGCTAGA
TATTGACGGCACAGTACGTAATATGACTGGTGAGACGTGGACTAAAATGG
AAATGAATTTCGTCAAAATTGTTGAACTAATTGATAATATTACAATGAAA
TTAAATAGTGATAATGTTTCAAATAAAGCATCCCGATATTCAGGATTGTT
ATTAGCTGTGCTTTTCGTTCCAATTTTTCTTGGAATTGTTGTGCTGTTTT
TTGCCTTGTCAGTGGCAACATCACTTCACGTTTGGCCAGAAAAACGCCCT
CACTCTGCTTTGCAAATCGGAATGTACTTGAGTTTGATATTTTTAGCATT
AATAATGTTAGTATGCACTCTTACATTTTTATACGGTGGTAAAGTTGAAA
CCGAACTTTGCCGATATTTACGTACGAATCAGCCGATAGTCGTTACGCAT
AATGATACAAGGTTGGTATTAGATGAACACATTAACAGATTTTTACAAGT
TAATCTGCCCAAAATTGCCAAATCTATGCCGAAATCAGAGTTTCCGCTTC
CAAAACCCAGAAATGTTTTATATGGATTGATAAAGAAATGCCAGAAAAAC
GAGCCAATTCTTGCCGCAATCAATGCCATTGAAAGTTTAGATACAGCTGC
GTTGAGTAAACCGGAAGTAGCAGCAAAATTCATTCGTGTTGGCCGACAGT
TACTAATTGAAAGTTTAAATGAAACTGATCCTAAAAAGATGCTCCCACCA
GATATGAAAGATTCCCTCCAACAAGCATCACAACTTGGAATGTTTAAAGC
GATTGATACCGAAGAAAGTATTCGAAAAGTTCCTCGTACTCCTATTTTTA
TTACAACGAACAACGGTAAAGAACCGATGGCTATAACGACTTTTATGGAC
AATGTAGACAAGTATATATCGCATTATGTCATCAACATTAATGATCCCGT
AATGAAAAATAAATTGAACCAAGACCAAAAGAAAATGATGTTGTTGTTTG
AACAATTCAATTTAATAACTGATCGAGTTAGAAATATTTTCTCAAACATG
AAATACATTCCATCAATAAAACCAGTGGTGAAAAGTCTCAGTGAAAGTCT
TGATAAAATGTTGATAATTTTAAACAACAAAACTGAATTATTCAAAATCG
GCAATGAATATTTTGATAATATTATTGTTAAATCCACTCCTCAGAAATCC
GCTGGAATTATGGCCAAATTCGGACCAAAAATGATGTCGAAGCTTGGACA
TTGCCGGCCAATATTTGAAGCATATCAATCTTCAATAGATACGACTTGCG
ACATTATTGTGATGAAACTTAATGCGTATTGGCTTTATTTGGGTGCTGTT
GGTTTGTTGCTCACTTGTATTTTGTCGATTGTCTTTTTAATGTTGAATTC
GAGCGGCCAAGATTCTTCTCTGCCATACGAAGCCGATAAGGAAAAGGAAG
CAAATGTAGCCAAATCACTTATTAAAGAAAATGAATTAGAATCTACCAAA
GTCTAGAGTTAGAACAATTGGTTTATTTATGGATTGAAATCTTTTTTTTG
TAAAGTTCCATTGTGTAGTTGAAAAAATATTTTATCAAGTGATTTTGCCA
AATTCAACAAGGCATTTACTGATATTGTTATGCCAAGAAACTCTTGTTAA
AATAAAATTATTCTAGTCAAATACTGGCTATAAAATCTTTTTTATTTTGC
TTAATATTTCATTCCAATGTACATTATTTTATATAGAAATTTGCGGAACT
TAGTGAGGTGTAAAGTGATAATAAATTTATTTTCAGAAAAGTAAAGTGTT
GGTTACGGTGTTTTTCGCAATTACAAATCCATAAGAATATAATATTAAGA
ATTCATAATTGTCTACACTTGTTTTGCTGTGACTGCTTTCAACCAATCAA
TCTGTCTGTCTGTGAAATTCTGTAAAAATGTAGCATTACGTCATGGTTAA
AAATGAATTAGTGTTACGTTCTATTCTCAATTTGCATTTTTGTGTTGTGT
AAAAAACTTCTAATTCAGCGATGGAAATCATTTTTTTGGTAATGGGCCTT
TTTAAAAATTAAATACTCAACAGGAGTACTTTTTAGGAATGCAGAATTTT
TAATTACATAACAGACATATAAAACCAATCATGTA
back to top

protein sequence of SMED30030797-orf-1

>SMED30030797-orf-1 ID=SMED30030797-orf-1|Name=SMED30030797-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=844bp
MESFANIILNNAQTVHDGGLINSILQNVQILNNSNVKRDIMPYVVSSRMT
GGYVAALFFGILWILALISAMVYMFYLYFKRPNSNTNRKPIRRQFLAVRS
FFAKGDKNSFSFVYSFQIVVIVIFAIPIFLLLCFCLTNANQIHRSIGESA
QSYNANSTAKPNAILPALKKSLYHIRNYLSTFADNARQNTASTVDEIIQA
TKDMQKETQKDFNKKLMTRLGVENTFKYGQEMTNIVVKFYDISNALLNNQ
TQYNGVIQELYPRVMNPTFRLFDFIGEIRNSFKQLPDCDEGCKQFEAFFN
QPFAEVEGFPETSFATSFLFVMKQQNKTRESVIAQTQHGRKEMNKTMAKT
EEKMKRLLDIDGTVRNMTGETWTKMEMNFVKIVELIDNITMKLNSDNVSN
KASRYSGLLLAVLFVPIFLGIVVLFFALSVATSLHVWPEKRPHSALQIGM
YLSLIFLALIMLVCTLTFLYGGKVETELCRYLRTNQPIVVTHNDTRLVLD
EHINRFLQVNLPKIAKSMPKSEFPLPKPRNVLYGLIKKCQKNEPILAAIN
AIESLDTAALSKPEVAAKFIRVGRQLLIESLNETDPKKMLPPDMKDSLQQ
ASQLGMFKAIDTEESIRKVPRTPIFITTNNGKEPMAITTFMDNVDKYISH
YVININDPVMKNKLNQDQKKMMLLFEQFNLITDRVRNIFSNMKYIPSIKP
VVKSLSESLDKMLIILNNKTELFKIGNEYFDNIIVKSTPQKSAGIMAKFG
PKMMSKLGHCRPIFEAYQSSIDTTCDIIVMKLNAYWLYLGAVGLLLTCIL
SIVFLMLNSSGQDSSLPYEADKEKEANVAKSLIKENELESTKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008795Prominin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 340..360
NoneNo IPR availableTMHMMTMhelixcoord: 785..807
NoneNo IPR availableTMHMMTMhelixcoord: 53..75
NoneNo IPR availableTMHMMTMhelixcoord: 112..134
NoneNo IPR availableTMHMMTMhelixcoord: 448..470
NoneNo IPR availableTMHMMTMhelixcoord: 406..428
IPR008795PromininPFAMPF05478Prominincoord: 304..798
e-value: 1.1E-17
score: 63.4
IPR008795PromininPANTHERPTHR22730PROMININ PROM PROTEINcoord: 305..824