Homeobox domain-containing protein

Overview
NameHomeobox domain-containing protein
Smed IDSMED30030789
Length (bp)1604
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox domain-containing protein (SMED30030789) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30030789) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox domain-containing protein (SMED30030789) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30030789) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030789

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30030789h1SMcG0009269 dd_Smed_v4_7324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030789h1SMcG0009269 dd_Smed_v4_7324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030789h1SMcG0009269 dd_Smed_v4_7324_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: PBX4 (PBX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:13403])

HSP 1 Score: 65.4698 bits (158), Expect = 7.264e-11
Identity = 32/88 (36.36%), Postives = 50/88 (56.82%), Query Frame = 2
Query:  764 LTSDKPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSSLNKKGHKNYCQITPAESTMD--EMG 1021
            L   +  R+NF+ Q   +L+++F++H + PYPS E  +EL++  GLT SQV  WF NKR R   N    +    I   ++ +D  E+G
Sbjct:  207 LLDARRKRRNFSKQATEVLNEYFYSHLNNPYPSEEAKEELARKGGLTISQVSNWFGNKRIRYKKNMGKFQEEATIYTGKTAVDTTEVG 294          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: PBX1 (PBX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:8632])

HSP 1 Score: 62.7734 bits (151), Expect = 2.372e-10
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   IL+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  149 RRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 202          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: PBX1 (PBX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:8632])

HSP 1 Score: 63.5438 bits (153), Expect = 2.765e-10
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   IL+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  132 RRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 185          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: PBX1 (PBX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:8632])

HSP 1 Score: 63.5438 bits (153), Expect = 3.145e-10
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   IL+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  149 RRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 202          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: PBX2 (PBX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8633])

HSP 1 Score: 63.929 bits (154), Expect = 3.491e-10
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q   +L+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  248 RRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 301          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-20 (Homeobox protein ceh-20 [Source:UniProtKB/Swiss-Prot;Acc:P41779])

HSP 1 Score: 60.077 bits (144), Expect = 1.233e-9
Identity = 38/127 (29.92%), Postives = 60/127 (47.24%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSSLNKKGHKN----YCQITPAESTMDEMGNNELCPDALL-AISPSSGSQNAFNTSIIKTSNNQHTSLTPLDYT 1150
            R+NF+ Q   +L+++F+ H   PYPS E  ++L++   +T SQV  WF NKR R   N    +     Y     A  T+  M  N   P  +L   + ++G  N +N   I   +  H  + P D +
Sbjct:  192 RRNFSKQATEVLNEYFYGHLSNPYPSEEAKEDLARQCNITVSQVSNWFGNKRIRYKKNMAKAQEEASMYAAKKNAHVTLGGMAGN---PYGMLPGAAAAAGLLNPYNPMNIPGQDTLHMGMPPFDLS 315          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-60 (C. Elegans Homeobox [Source:UniProtKB/TrEMBL;Acc:Q45EK2])

HSP 1 Score: 52.373 bits (124), Expect = 4.715e-7
Identity = 22/55 (40.00%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARS 949
            R+NF      IL +WF +H   PYPS ++  EL++   +  SQV  WF N+R R+
Sbjct:  184 RRNFDKNTTDILQNWFHDHRQNPYPSDQEKAELAKQCNIKISQVNNWFGNQRIRT 238          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: irx-1 (Putative iroquois-class homeodomain protein irx-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93348])

HSP 1 Score: 51.6026 bits (122), Expect = 7.446e-7
Identity = 29/75 (38.67%), Postives = 38/75 (50.67%), Query Frame = 2
Query:  722 DSHTNYSNKSSPGGLTSDKPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            D+H  Y     P GL   K  ++N T +    L DW  +H   PYPS  D   L+  +G+T +QV  WFAN R R
Sbjct:  104 DAHRLYH----PYGLDGIK--KRNATREATAPLKDWLHSHRKNPYPSKADKVMLAVGTGMTLTQVSTWFANARRR 172          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 51.6026 bits (122), Expect = 1.093e-6
Identity = 25/63 (39.68%), Postives = 30/63 (47.62%), Query Frame = 2
Query:  758 GGLTSDKPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            GG       R  F  Q    L  W F +   PYPS E  K+L++ +GLT  QV  WF N R R
Sbjct:  309 GGRIGKSRGRGIFPKQATNRLRQWLFQNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRR 371          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 51.2174 bits (121), Expect = 1.349e-6
Identity = 25/63 (39.68%), Postives = 30/63 (47.62%), Query Frame = 2
Query:  758 GGLTSDKPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            GG       R  F  Q    L  W F +   PYPS E  K+L++ +GLT  QV  WF N R R
Sbjct:  346 GGRIGKSRGRGIFPKQATNRLRQWLFQNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRR 408          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: exd (gene:FBgn0000611 transcript:FBtr0074137)

HSP 1 Score: 64.3142 bits (155), Expect = 8.667e-11
Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q + IL+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  242 RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIR 295          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: exd (gene:FBgn0000611 transcript:FBtr0074135)

HSP 1 Score: 64.3142 bits (155), Expect = 8.667e-11
Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q + IL+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  242 RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIR 295          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: exd (gene:FBgn0000611 transcript:FBtr0333322)

HSP 1 Score: 64.3142 bits (155), Expect = 8.667e-11
Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q + IL+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  242 RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIR 295          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: exd (gene:FBgn0000611 transcript:FBtr0333323)

HSP 1 Score: 64.3142 bits (155), Expect = 8.667e-11
Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q + IL+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  242 RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIR 295          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: CG11617 (gene:FBgn0031232 transcript:FBtr0308246)

HSP 1 Score: 55.0694 bits (131), Expect = 6.253e-8
Identity = 23/49 (46.94%), Postives = 31/49 (63.27%), Query Frame = 2
Query:  794 FTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKR 940
            FT    R+L DW     + PYPS E+ K+L+  +GLTY+Q+  WFAN R
Sbjct:   35 FTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWR 83          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: pbx4 (pre-B-cell leukemia transcription factor 4 [Source:ZFIN;Acc:ZDB-GENE-000201-18])

HSP 1 Score: 63.929 bits (154), Expect = 6.408e-12
Identity = 28/66 (42.42%), Postives = 40/66 (60.61%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSSLNKKGHKNYC 982
            R+NF  Q   +L+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R   N  G+   C
Sbjct:   56 RRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGGYPAPC 121          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: pbx4 (pre-B-cell leukemia transcription factor 4 [Source:ZFIN;Acc:ZDB-GENE-000201-18])

HSP 1 Score: 62.3882 bits (150), Expect = 3.916e-10
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   +L+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  235 RRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 288          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: pbx3a (pre-B-cell leukemia homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-031218-1])

HSP 1 Score: 61.6178 bits (148), Expect = 7.587e-10
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q   IL+++F++H   PYPS E  +EL++   +T SQV  WF NKR R
Sbjct:  227 RRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCAITVSQVSNWFGNKRIR 280          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: pbx3a (pre-B-cell leukemia homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-031218-1])

HSP 1 Score: 62.003 bits (149), Expect = 8.140e-10
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q   IL+++F++H   PYPS E  +EL++   +T SQV  WF NKR R
Sbjct:  227 RRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCAITVSQVSNWFGNKRIR 280          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: pbx2 (pre-B-cell leukemia homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-000405-5])

HSP 1 Score: 59.6918 bits (143), Expect = 1.077e-9
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q   +L+++F++H   PYPS E  +EL++   +T SQV  WF NKR R
Sbjct:   68 RRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKQCSITVSQVSNWFGNKRIR 121          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: esrp1 (epithelial splicing regulatory protein 1 [Source:Xenbase;Acc:XB-GENE-985138])

HSP 1 Score: 61.2326 bits (147), Expect = 1.694e-9
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q   IL+++F++H   PYPS E  +EL++   +T SQV  WF NKR R
Sbjct:  165 RRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIR 218          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: alcam (activated leukocyte cell adhesion molecule [Source:Xenbase;Acc:XB-GENE-491704])

HSP 1 Score: 60.8474 bits (146), Expect = 1.986e-9
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   IL+++F++H   PYPS E  +EL++   +T SQV  WF NKR R
Sbjct:  237 RRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCAITVSQVSNWFGNKRIR 290          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: alcam (activated leukocyte cell adhesion molecule [Source:Xenbase;Acc:XB-GENE-491704])

HSP 1 Score: 60.8474 bits (146), Expect = 2.138e-9
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   IL+++F++H   PYPS E  +EL++   +T SQV  WF NKR R
Sbjct:  237 RRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCAITVSQVSNWFGNKRIR 290          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: alcam (activated leukocyte cell adhesion molecule [Source:Xenbase;Acc:XB-GENE-491704])

HSP 1 Score: 60.8474 bits (146), Expect = 2.147e-9
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   IL+++F++H   PYPS E  +EL++   +T SQV  WF NKR R
Sbjct:  237 RRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCAITVSQVSNWFGNKRIR 290          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: alcam (activated leukocyte cell adhesion molecule [Source:Xenbase;Acc:XB-GENE-491704])

HSP 1 Score: 60.4622 bits (145), Expect = 2.252e-9
Identity = 28/76 (36.84%), Postives = 43/76 (56.58%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSSLNKKGHKNYCQITPAESTMD 1012
            R+NF  Q   IL+++F++H   PYPS E  +EL++   +T SQV  WF NKR R   N    +    I  A++ ++
Sbjct:  237 RRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCAITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVN 312          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Pbx2 (pre B cell leukemia homeobox 2 [Source:MGI Symbol;Acc:MGI:1341793])

HSP 1 Score: 63.929 bits (154), Expect = 1.648e-10
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q   +L+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  166 RRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 219          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Pbx2 (pre B cell leukemia homeobox 2 [Source:MGI Symbol;Acc:MGI:1341793])

HSP 1 Score: 63.929 bits (154), Expect = 1.903e-10
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q   +L+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  188 RRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 241          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Pbx2 (pre B cell leukemia homeobox 2 [Source:MGI Symbol;Acc:MGI:1341793])

HSP 1 Score: 63.929 bits (154), Expect = 2.194e-10
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q   +L+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  248 RRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 301          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Pbx1 (pre B cell leukemia homeobox 1 [Source:MGI Symbol;Acc:MGI:97495])

HSP 1 Score: 63.5438 bits (153), Expect = 2.885e-10
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   IL+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  237 RRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 290          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Pbx1 (pre B cell leukemia homeobox 1 [Source:MGI Symbol;Acc:MGI:97495])

HSP 1 Score: 63.1586 bits (152), Expect = 2.886e-10
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   IL+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  237 RRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 290          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BYU1|PBX4_HUMAN (Pre-B-cell leukemia transcription factor 4 OS=Homo sapiens OX=9606 GN=PBX4 PE=1 SV=2)

HSP 1 Score: 65.4698 bits (158), Expect = 3.489e-10
Identity = 32/88 (36.36%), Postives = 50/88 (56.82%), Query Frame = 2
Query:  764 LTSDKPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSSLNKKGHKNYCQITPAESTMD--EMG 1021
            L   +  R+NF+ Q   +L+++F++H + PYPS E  +EL++  GLT SQV  WF NKR R   N    +    I   ++ +D  E+G
Sbjct:  207 LLDARRKRRNFSKQATEVLNEYFYSHLNNPYPSEEAKEELARKGGLTISQVSNWFGNKRIRYKKNMGKFQEEATIYTGKTAVDTTEVG 294          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q29CT2|EXD_DROPS (Homeobox protein extradenticle OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=exd PE=3 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 8.458e-10
Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q + IL+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  242 RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIR 295          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P40427|EXD_DROME (Homeobox protein extradenticle OS=Drosophila melanogaster OX=7227 GN=exd PE=1 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 8.688e-10
Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q + IL+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  242 RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIR 295          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7PMT1|EXD_ANOGA (Homeobox protein extradenticle OS=Anopheles gambiae OX=7165 GN=exd PE=3 SV=2)

HSP 1 Score: 64.3142 bits (155), Expect = 9.182e-10
Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q + IL+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  230 RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIR 283          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|O35984|PBX2_MOUSE (Pre-B-cell leukemia transcription factor 2 OS=Mus musculus OX=10090 GN=Pbx2 PE=1 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.535e-9
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q   +L+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  248 RRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 301          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A183AB77 (Homeobox domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS4212 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 5.771e-21
Identity = 46/65 (70.77%), Postives = 54/65 (83.08%), Query Frame = 2
Query:  758 GGLTSDKPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSS 952
            GG    +PHRQNFT  QNRIL++W+  H  KPYPST+DTKEL+ +SGL+YSQVKKWFANKRARSS
Sbjct: 1141 GGTHQGRPHRQNFTPTQNRILTEWYSKHKAKPYPSTDDTKELATISGLSYSQVKKWFANKRARSS 1205          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A158QIB4 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9066 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.394e-20
Identity = 47/61 (77.05%), Postives = 53/61 (86.89%), Query Frame = 2
Query:  776 KPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSSLN 958
            +PHRQNFT+ QNRIL+DW+  H  KPYPSTEDTK LS L+GLTYSQVKKWFANKRAR+S N
Sbjct:  711 RPHRQNFTANQNRILNDWYNEHHYKPYPSTEDTKHLSNLAGLTYSQVKKWFANKRARTSSN 771          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A504YRQ6 (Homeobox protein extradenticle OS=Fasciola gigantica OX=46835 GN=FGIG_04928 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 3.339e-20
Identity = 44/59 (74.58%), Postives = 52/59 (88.14%), Query Frame = 2
Query:  776 KPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSS 952
            +PHRQNFT  QNRIL++W+  H  KPYPST+DTKEL+ +SGL+YSQVKKWFANKRARSS
Sbjct:  899 RPHRQNFTPTQNRILTEWYSKHKAKPYPSTDDTKELATISGLSYSQVKKWFANKRARSS 957          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A5J4NT31 (Homeobox domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0007302 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 3.700e-20
Identity = 45/59 (76.27%), Postives = 52/59 (88.14%), Query Frame = 2
Query:  776 KPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSS 952
            +PHRQNFT  QNRIL++W+  H  KPYPSTEDTKEL+ +SGL+YSQVKKWFANKRARSS
Sbjct: 1467 RPHRQNFTPAQNRILTEWYQTHQSKPYPSTEDTKELANISGLSYSQVKKWFANKRARSS 1525          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A0R3SL17 (Homeobox domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS5630 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 5.652e-20
Identity = 45/61 (73.77%), Postives = 52/61 (85.25%), Query Frame = 2
Query:  776 KPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSSLN 958
            +PHRQNFT+ QNRIL+DW+  H  KPYP+TEDTK LS L+GLTY QVKKWFANKRAR+S N
Sbjct:  359 RPHRQNFTANQNRILNDWYNEHHYKPYPTTEDTKHLSNLAGLTYPQVKKWFANKRARTSSN 419          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: pbx1a (pre-B-cell leukemia homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-000405-1])

HSP 1 Score: 63.1586 bits (152), Expect = 2.231e-10
Identity = 35/104 (33.65%), Postives = 52/104 (50.00%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSSLNKKGHKNYCQITPAESTMDEMGNNELCPDALLAISPSSGSQNAFNTS 1096
            R+NF  Q   IL+++F++H   PYPS E  +EL++   +T SQV  WF NKR R   N    +    +  A++ +              AISP+  S  +FN S
Sbjct:  233 RRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANMYAAKTAVTA------------AISPTPSSAGSFNMS 324          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: pbx4 (PBX homeobox 4 [Source:NCBI gene;Acc:103036062])

HSP 1 Score: 62.7734 bits (151), Expect = 4.103e-10
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   +L+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  234 RRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 287          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: pbx4 (PBX homeobox 4 [Source:NCBI gene;Acc:103036062])

HSP 1 Score: 62.003 bits (149), Expect = 7.239e-10
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   +L+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  272 RRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 325          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: pbx4 (PBX homeobox 4 [Source:NCBI gene;Acc:103036062])

HSP 1 Score: 61.6178 bits (148), Expect = 7.242e-10
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   +L+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  272 RRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 325          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000040519.1 (pre-B-cell leukemia transcription factor 3 [Source:NCBI gene;Acc:103029164])

HSP 1 Score: 60.8474 bits (146), Expect = 1.072e-9
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q   IL+++F++H   PYPS E  +EL++   +T SQV  WF NKR R
Sbjct:  238 RRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIR 291          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: six1a (SIX homeobox 1a [Source:NCBI gene;Acc:494168])

HSP 1 Score: 45.4394 bits (106), Expect = 4.030e-6
Identity = 20/49 (40.82%), Postives = 29/49 (59.18%), Query Frame = 2
Query:  794 FTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKR 940
            F  +   +L DW+      PYPS  + +EL+Q +GLT +QV  WF N+R
Sbjct:  105 FKERSRGVLRDWY---AHNPYPSPREKRELAQATGLTTTQVSNWFKNRR 150          
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Match: CUP9 (Homeodomain-containing transcriptional repressor; regulates expression of PTR2, which encodes a major peptide transporter; imported peptides activate ubiquitin-dependent proteolysis, resulting in degradation of Cup9p and de-repression of PTR2 transcription; CUP9 has a paralog, TOS8, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000006098])

HSP 1 Score: 50.8322 bits (120), Expect = 2.232e-7
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R N   +  +IL+ W  NH + PYP+ ++ +EL   +GLT  Q+  WF N R R
Sbjct:  166 RSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 219          
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Match: TOS8 (Homeodomain-containing protein and putative transcription factor; found associated with chromatin; target of SBF transcription factor; induced during meiosis and under cell-damaging conditions; TOS8 has a paralog, CUP9, that arose from the whole genome duplication [Source:SGD;Acc:S000003064])

HSP 1 Score: 50.447 bits (119), Expect = 2.514e-7
Identity = 29/91 (31.87%), Postives = 42/91 (46.15%), Query Frame = 2
Query:  680 SKVLEKHDSSCDLMDSHTNYSNKSSPGGLTSDKPH--RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
             K+L  + S+  +  S+  YS K         K H  R N       IL+ W   H + PYP+ ++ +EL   +GLT  Q+  WF N R R
Sbjct:  166 GKMLSGNISTNSVRGSNNGYSAKEK-----KHKAHGKRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRR 251          
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Match: HMRA2 (Silenced copy of a2 at HMR; similarity to Alpha2p; required along with a1p for inhibiting expression of the HO endonuclease in a/alpha HO/HO diploid cells with an active mating-type interconversion system [Source:SGD;Acc:S000000692])

HSP 1 Score: 44.2838 bits (103), Expect = 3.991e-6
Identity = 21/60 (35.00%), Postives = 34/60 (56.67%), Query Frame = 2
Query:  770 SDKPHR-QNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            S KP+R   FT +  RIL  WF  + + PY  T+  + L + + L+  Q+K W +N+R +
Sbjct:   36 STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRK 95          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO43361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYQ8])

HSP 1 Score: 57.3806 bits (137), Expect = 4.338e-9
Identity = 22/54 (40.74%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q   IL+++F++H   PYPS E  +EL++   ++ +Q+  WF NKR R
Sbjct:  202 RRNFSKQATEILNEYFYSHLSNPYPSEEAKEELARKCNISVAQISNWFGNKRIR 255          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO36439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIN3])

HSP 1 Score: 53.5286 bits (127), Expect = 7.010e-8
Identity = 27/63 (42.86%), Postives = 31/63 (49.21%), Query Frame = 2
Query:  758 GGLTSDKPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            GG  S K  R  F      I+  W F H   PYPS E  + L+Q +GLT  QV  WF N R R
Sbjct:  234 GGKKSQK-KRGIFPKAATNIMKAWLFQHLTHPYPSEEQKRSLAQETGLTILQVNNWFINARRR 295          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO41982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2T4])

HSP 1 Score: 46.9802 bits (110), Expect = 4.297e-7
Identity = 21/55 (38.18%), Postives = 29/55 (52.73%), Query Frame = 2
Query:  782 HRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
             R+N T +    L  W F H   PYP+  +   L+ L+ +T +QV  WFAN R R
Sbjct:    2 RRKNATRETTSTLKAWLFEHRKNPYPTKGEKIMLAILTKMTLTQVSTWFANARRR 56          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO39375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC9])

HSP 1 Score: 46.9802 bits (110), Expect = 9.672e-6
Identity = 21/65 (32.31%), Postives = 31/65 (47.69%), Query Frame = 2
Query:  752 SPGGLTSDKPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            +P    + K  R     Q   I+  W F H   PYP+ ++ + ++Q + LT  QV  WF N R R
Sbjct:  190 TPQQSATVKSKRGVLPKQATSIMKTWLFQHIMHPYPTEDEKRSIAQQTNLTILQVNNWFINARRR 254          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: pbx1a (pre-B-cell leukemia transcription factor 1 [Source:NCBI gene;Acc:101160104])

HSP 1 Score: 63.5438 bits (153), Expect = 1.926e-10
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   IL+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  235 RRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 288          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: pbx2 (pre-B-cell leukemia transcription factor 1 [Source:NCBI gene;Acc:101172525])

HSP 1 Score: 63.5438 bits (153), Expect = 1.988e-10
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q   +L+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  251 RRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKQCGITVSQVSNWFGNKRIR 304          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: pbx1a (pre-B-cell leukemia transcription factor 1 [Source:NCBI gene;Acc:101160104])

HSP 1 Score: 63.1586 bits (152), Expect = 2.017e-10
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   IL+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  235 RRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 288          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: pbx2 (pre-B-cell leukemia transcription factor 1 [Source:NCBI gene;Acc:101172525])

HSP 1 Score: 63.5438 bits (153), Expect = 2.096e-10
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF+ Q   +L+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  251 RRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKQCGITVSQVSNWFGNKRIR 304          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: pbx4 (pre-B-cell leukemia transcription factor 1 [Source:NCBI gene;Acc:101159440])

HSP 1 Score: 62.003 bits (149), Expect = 4.203e-10
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            R+NF  Q   +L+++F++H   PYPS E  +EL++  G+T SQV  WF NKR R
Sbjct:  235 RRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIR 288          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000049852.1 (SMESG000049852.1)

HSP 1 Score: 457.988 bits (1177), Expect = 0.000e+0
Identity = 222/227 (97.80%), Postives = 222/227 (97.80%), Query Frame = 2
Query:  506 FPIKDNSKKSQIQSRNRNGHSENVTYMPKSEPNNENLFNRSFLESNLSLDTKSSQMDLSKVLEKHDSSCDLMDSHTNYSNKSSPGGLTSDKPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSSLNKKGHKNYCQITPAESTMDEMGNNELCPDALLAISPSSGSQNAFNTSIIKTSNNQHTSLTPLDYTQLHQEEPQSPEK 1186
             P K   KKSQIQSRNRNGHSENVTYMPKSEPNNENLFNRSFLESNLSLDTKSSQMDLSKVLEKHDSSCDLMDSHTNYSNKSSPGGLTSDKPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSSLNKKGHKNYCQITPAESTMDEMGNNELCPDALLAISPSSGSQNAFNTSIIKTSNNQHTSLTPLDYTQLHQEEPQSPEK
Sbjct:  474 LPHKRQFKKSQIQSRNRNGHSENVTYMPKSEPNNENLFNRSFLESNLSLDTKSSQMDLSKVLEKHDSSCDLMDSHTNYSNKSSPGGLTSDKPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSSLNKKGHKNYCQITPAESTMDEMGNNELCPDALLAISPSSGSQNAFNTSIIKTSNNQHTSLTPLDYTQLHQEEPQSPEK 700          

HSP 2 Score: 290.426 bits (742), Expect = 0.000e+0
Identity = 172/172 (100.00%), Postives = 172/172 (100.00%), Query Frame = 1
Query:   16 PLLSNPQTCIELIKLTLGQMLAKSNEQNRLPIPGFNPASFXXXXXXXXXXXXXXXXXXXXXVVNSNSTTNQSELAFSSQNPEVDAILSNLQQNNMLKSLHSNSFDSNHHMLTHQQSAMFLNHKSARSSPNMTKNLFIENIPKNGNGALSPIFNSKKSADNSTKLPHKRQFKK 531
            PLLSNPQTCIELIKLTLGQMLAKSNEQNRLPIPGFNPASFLQPQFQLPPNIIPLLLPTLAPVVNSNSTTNQSELAFSSQNPEVDAILSNLQQNNMLKSLHSNSFDSNHHMLTHQQSAMFLNHKSARSSPNMTKNLFIENIPKNGNGALSPIFNSKKSADNSTKLPHKRQFKK
Sbjct:  311 PLLSNPQTCIELIKLTLGQMLAKSNEQNRLPIPGFNPASFLQPQFQLPPNIIPLLLPTLAPVVNSNSTTNQSELAFSSQNPEVDAILSNLQQNNMLKSLHSNSFDSNHHMLTHQQSAMFLNHKSARSSPNMTKNLFIENIPKNGNGALSPIFNSKKSADNSTKLPHKRQFKK 482          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000014778.1 (SMESG000014778.1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.276e-19
Identity = 47/92 (51.09%), Postives = 61/92 (66.30%), Query Frame = 2
Query:  716 LMDSHTNYSNKSSPGGLTSDKP--HRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSSLNKKGHKNYCQ 985
            L ++H + S + SP G ++ +   HR NF+  QN IL +W+  H  KPYPSTE+TK L+ L GL+Y QVKKWFANKRARSS  +K     CQ
Sbjct:  303 LFENHLSSSIQKSPEGSSTSQRNLHRNNFSPLQNHILLEWYDKHKHKPYPSTEETKHLAALCGLSYPQVKKWFANKRARSSFYQKDEIISCQ 394          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000022232.1 (SMESG000022232.1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.033e-10
Identity = 25/58 (43.10%), Postives = 38/58 (65.52%), Query Frame = 2
Query:  773 DKPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            ++  R+NF+ +   IL+++F++H   PYPS E   EL++  G+T SQV  WF NKR R
Sbjct:   37 ERRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIR 94          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000022232.1 (SMESG000022232.1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.071e-10
Identity = 26/58 (44.83%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  785 RQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRARSSLN 958
            R+NF+ +   IL+++F++H   PYPS E   EL++  G+T SQV  WF NKR R   N
Sbjct:    8 RRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIRYKKN 65          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000022232.1 (SMESG000022232.1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.269e-10
Identity = 25/58 (43.10%), Postives = 38/58 (65.52%), Query Frame = 2
Query:  773 DKPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQLSGLTYSQVKKWFANKRAR 946
            ++  R+NF+ +   IL+++F++H   PYPS E   EL++  G+T SQV  WF NKR R
Sbjct:   49 ERRKRRNFSKEATEILNEYFYSHLANPYPSEEAKDELAKKCGITVSQVSNWFGNKRIR 106          
The following BLAST results are available for this feature:
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PBX47.264e-1136.36PBX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:13403][more]
PBX12.372e-1048.15PBX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:8632][more]
PBX12.765e-1048.15PBX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:8632][more]
PBX13.145e-1048.15PBX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:8632][more]
PBX23.491e-1046.30PBX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8633][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-201.233e-929.92Homeobox protein ceh-20 [Source:UniProtKB/Swiss-P... [more]
ceh-604.715e-740.00C. Elegans Homeobox [Source:UniProtKB/TrEMBL;Acc:... [more]
irx-17.446e-738.67Putative iroquois-class homeodomain protein irx-1 ... [more]
unc-621.093e-639.68Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-621.349e-639.68Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exd8.667e-1148.15gene:FBgn0000611 transcript:FBtr0074137[more]
exd8.667e-1148.15gene:FBgn0000611 transcript:FBtr0074135[more]
exd8.667e-1148.15gene:FBgn0000611 transcript:FBtr0333322[more]
exd8.667e-1148.15gene:FBgn0000611 transcript:FBtr0333323[more]
CG116176.253e-846.94gene:FBgn0031232 transcript:FBtr0308246[more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pbx46.408e-1242.42pre-B-cell leukemia transcription factor 4 [Source... [more]
pbx43.916e-1046.30pre-B-cell leukemia transcription factor 4 [Source... [more]
pbx3a7.587e-1046.30pre-B-cell leukemia homeobox 3a [Source:ZFIN;Acc:Z... [more]
pbx3a8.140e-1046.30pre-B-cell leukemia homeobox 3a [Source:ZFIN;Acc:Z... [more]
pbx21.077e-944.44pre-B-cell leukemia homeobox 2 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
esrp11.694e-946.30epithelial splicing regulatory protein 1 [Source:X... [more]
alcam1.986e-946.30activated leukocyte cell adhesion molecule [Source... [more]
alcam2.138e-946.30activated leukocyte cell adhesion molecule [Source... [more]
alcam2.147e-946.30activated leukocyte cell adhesion molecule [Source... [more]
alcam2.252e-936.84activated leukocyte cell adhesion molecule [Source... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pbx21.648e-1046.30pre B cell leukemia homeobox 2 [Source:MGI Symbol;... [more]
Pbx21.903e-1046.30pre B cell leukemia homeobox 2 [Source:MGI Symbol;... [more]
Pbx22.194e-1046.30pre B cell leukemia homeobox 2 [Source:MGI Symbol;... [more]
Pbx12.885e-1048.15pre B cell leukemia homeobox 1 [Source:MGI Symbol;... [more]
Pbx12.886e-1048.15pre B cell leukemia homeobox 1 [Source:MGI Symbol;... [more]
back to top
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BYU1|PBX4_HUMAN3.489e-1036.36Pre-B-cell leukemia transcription factor 4 OS=Homo... [more]
sp|Q29CT2|EXD_DROPS8.458e-1048.15Homeobox protein extradenticle OS=Drosophila pseud... [more]
sp|P40427|EXD_DROME8.688e-1048.15Homeobox protein extradenticle OS=Drosophila melan... [more]
sp|Q7PMT1|EXD_ANOGA9.182e-1048.15Homeobox protein extradenticle OS=Anopheles gambia... [more]
sp|O35984|PBX2_MOUSE1.535e-946.30Pre-B-cell leukemia transcription factor 2 OS=Mus ... [more]
back to top
BLAST of Homeobox domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183AB775.771e-2170.77Homeobox domain-containing protein OS=Echinostoma ... [more]
A0A158QIB41.394e-2077.05Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A504YRQ63.339e-2074.58Homeobox protein extradenticle OS=Fasciola giganti... [more]
A0A5J4NT313.700e-2076.27Homeobox domain-containing protein OS=Paragonimus ... [more]
A0A0R3SL175.652e-2073.77Homeobox domain-containing protein OS=Hymenolepis ... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pbx1a2.231e-1033.65pre-B-cell leukemia homeobox 1a [Source:ZFIN;Acc:Z... [more]
pbx44.103e-1046.30PBX homeobox 4 [Source:NCBI gene;Acc:103036062][more]
pbx47.239e-1046.30PBX homeobox 4 [Source:NCBI gene;Acc:103036062][more]
pbx47.242e-1046.30PBX homeobox 4 [Source:NCBI gene;Acc:103036062][more]
ENSAMXT00000040519.11.072e-946.30pre-B-cell leukemia transcription factor 3 [Source... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
six1a4.030e-640.82SIX homeobox 1a [Source:NCBI gene;Acc:494168][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
CUP92.232e-738.89Homeodomain-containing transcriptional repressor; ... [more]
TOS82.514e-731.87Homeodomain-containing protein and putative transc... [more]
HMRA23.991e-635.00Silenced copy of a2 at HMR; similarity to Alpha2p;... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO433614.338e-940.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364397.010e-842.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419824.297e-738.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393759.672e-632.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pbx1a1.926e-1048.15pre-B-cell leukemia transcription factor 1 [Source... [more]
pbx21.988e-1046.30pre-B-cell leukemia transcription factor 1 [Source... [more]
pbx1a2.017e-1048.15pre-B-cell leukemia transcription factor 1 [Source... [more]
pbx22.096e-1046.30pre-B-cell leukemia transcription factor 1 [Source... [more]
pbx44.203e-1046.30pre-B-cell leukemia transcription factor 1 [Source... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049852.10.000e+097.80SMESG000049852.1[more]
SMESG000014778.12.276e-1951.09SMESG000014778.1[more]
SMESG000022232.11.033e-1043.10SMESG000022232.1[more]
SMESG000022232.11.071e-1044.83SMESG000022232.1[more]
SMESG000022232.11.269e-1043.10SMESG000022232.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030789 ID=SMED30030789|Name=Homeobox domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1604bp
AATGTTATTAATAACCCCCTTCTTTCTAACCCACAAACATGTATCGAACT
CATCAAACTTACACTCGGTCAAATGCTCGCTAAATCCAACGAACAAAATC
GCTTACCAATACCTGGTTTTAATCCAGCTTCATTTCTTCAACCGCAATTT
CAATTGCCTCCAAATATTATTCCATTACTCCTTCCAACTCTCGCTCCGGT
AGTAAACTCTAATTCGACAACCAATCAATCGGAACTCGCCTTTTCATCTC
AAAACCCAGAAGTCGACGCAATTCTCTCGAATCTCCAACAAAATAACATG
CTGAAAAGCCTCCACTCGAACTCTTTTGACTCAAATCATCACATGTTGAC
CCACCAACAGTCGGCAATGTTTTTGAATCACAAATCTGCGCGATCTTCGC
CAAACATGACGAAAAATTTGTTCATTGAAAATATACCAAAAAATGGAAAC
GGAGCTTTGTCGCCAATATTCAACAGCAAAAAATCGGCCGATAATTCAAC
CAAACTTCCCCATAAAAGACAATTCAAAAAAAAGTCAAATTCAATCTAGA
AATCGGAACGGACATTCCGAAAACGTTACTTACATGCCAAAATCTGAACC
AAACAATGAAAATTTATTCAACCGCTCGTTTCTCGAATCAAACTTGTCTT
TGGACACGAAATCCAGCCAAATGGATTTGAGCAAAGTGTTGGAGAAACAC
GATTCAAGTTGCGATCTGATGGATTCCCACACGAACTACAGCAACAAATC
ATCGCCAGGCGGACTGACATCTGACAAACCCCATCGACAGAATTTCACCA
GCCAACAAAATAGAATTCTTTCAGATTGGTTCTTTAATCATTGCGACAAA
CCTTATCCGTCAACTGAAGACACCAAAGAACTTTCTCAACTCAGTGGATT
GACATATTCTCAAGTGAAAAAATGGTTCGCCAATAAACGAGCCAGATCGT
CATTAAACAAAAAAGGTCACAAAAACTACTGCCAAATAACACCAGCAGAA
TCGACAATGGATGAAATGGGAAACAACGAATTGTGTCCCGACGCCTTATT
GGCAATCTCACCTTCATCAGGATCTCAAAACGCCTTCAACACCAGTATCA
TCAAAACGTCAAACAACCAGCACACATCATTAACACCCCTTGATTACACT
CAGCTCCATCAAGAGGAACCCCAATCTCCAGAAAAATAAAAGCCTTCATA
GATTTTTCTTATCAAATATTATTTCTGCAACTGTTCTAAATGACTTGGAC
AAAGTCTTTTCATTTTGGATCTATTTTTTTTGCATGAAGATTTTTTCATT
TTTTGTTGGAAATCTATTTCTGTGCTGTCAAATCTTTTCACTCTTGTGCC
TTCGTTTGTAAAGGCTCTATTCGATAGACCATTTCAGAGTTTGACTTTTT
TTTACTGTAAATTCTCATTTCTGTTTCGGATGGATTTCGTTCTTCAAATT
TCCTCCTCCTTCAGCATGCAATTTTATTATTTTATTCGATTCGATGGTGC
TTCGTATGTATATAAATGAGATTTCTTTTATTGGAATTGTACATTGGCCC
TTGTGAAACTCACTGTTATGATAAATTCAACAATAAAACACTTTTGTGAT
TTCG
back to top

protein sequence of SMED30030789-orf-1

>SMED30030789-orf-1 ID=SMED30030789-orf-1|Name=SMED30030789-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=249bp
METELCRQYSTAKNRPIIQPNFPIKDNSKKSQIQSRNRNGHSENVTYMPK
SEPNNENLFNRSFLESNLSLDTKSSQMDLSKVLEKHDSSCDLMDSHTNYS
NKSSPGGLTSDKPHRQNFTSQQNRILSDWFFNHCDKPYPSTEDTKELSQL
SGLTYSQVKKWFANKRARSSLNKKGHKNYCQITPAESTMDEMGNNELCPD
ALLAISPSSGSQNAFNTSIIKTSNNQHTSLTPLDYTQLHQEEPQSPEK*
back to top

protein sequence of SMED30030789-orf-2

>SMED30030789-orf-2 ID=SMED30030789-orf-2|Name=SMED30030789-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=183bp
NVINNPLLSNPQTCIELIKLTLGQMLAKSNEQNRLPIPGFNPASFLQPQF
QLPPNIIPLLLPTLAPVVNSNSTTNQSELAFSSQNPEVDAILSNLQQNNM
LKSLHSNSFDSNHHMLTHQQSAMFLNHKSARSSPNMTKNLFIENIPKNGN
GALSPIFNSKKSADNSTKLPHKRQFKKKSNSI*
back to top
Aliases
The feature 'Homeobox domain-containing protein' has the following synonyms
Synonym
pbx4*
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR008422Homeobox_KN_domain
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 158..182