Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3

Overview
NameArf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3
Smed IDSMED30030785
Length (bp)2062
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 (SMED30030785) t-SNE clustered cells

Violin plots show distribution of expression levels for Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 (SMED30030785) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 (SMED30030785) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 (SMED30030785) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030785

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30030785SMESG000075717.1 dd_Smed_v4_4301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030785SMESG000075717.1 dd_Smed_v4_4301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030785SMESG000075717.1 dd_Smed_v4_4301_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Human
Match: AGAP3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:HGNC Symbol;Acc:HGNC:16923])

HSP 1 Score: 289.271 bits (739), Expect = 2.527e-91
Identity = 153/283 (54.06%), Postives = 208/283 (73.50%), Query Frame = 2
Query:   92 MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRML-LNAKPSLPL----------ANNIQSRPTTPQVHTNN-CVTSSPY 904
            +A   P+      + +IR E+ RFESVHPNIYAIY++++ ++D      +++ I+E+V+SIEDSFVNSQEWTL R V  LK+GIVG+++SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q + W D V+FVFSLE E S + V +Y+ ++ SFR+ ++VP++LVGTQDAIS +NPRVIDDS+AR+++++L R  YYETCATYGLNVERVF DV  +++ L  K  L +          +++  S  + P VH N  C T S +
Sbjct:   53 LAGGPPQQFALSNSAAIRAEIQRFESVHPNIYAIYDLIERIEDL----ALQNQIREHVISIEDSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAISAANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCKSLPNSPSHSAVSAASIPAVHINQICATVSNF 331          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Human
Match: AGAP3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:HGNC Symbol;Acc:HGNC:16923])

HSP 1 Score: 290.041 bits (741), Expect = 7.449e-91
Identity = 150/273 (54.95%), Postives = 202/273 (73.99%), Query Frame = 2
Query:   92 MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPH 910
            +A   P+      + +IR E+ RFESVHPNIYAIY++++ ++D      +++ I+E+V+SIEDSFVNSQEWTL R V  LK+GIVG+++SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q + W D V+FVFSLE E S + V +Y+ ++ SFR+ ++VP++LVGTQDAIS +NPRVIDDS+AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H+     S P  H
Sbjct:   53 LAGGPPQQFALSNSAAIRAEIQRFESVHPNIYAIYDLIERIEDL----ALQNQIREHVISIEDSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAISAANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCKSLPNSPS-HSAVSAASIPAVH 320          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Human
Match: AGAP1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:HGNC Symbol;Acc:HGNC:16922])

HSP 1 Score: 289.271 bits (739), Expect = 1.853e-90
Identity = 144/250 (57.60%), Postives = 197/250 (78.80%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNC 886
            +IR E+ RFESVHPNIY+IYE+L+ +++     V+++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q ++W D VIFVFSLE E S + V  YY +M+++R+ +++P++LVGTQDAIS +NPRVIDD++AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C
Sbjct:   12 AIRAEIQRFESVHPNIYSIYELLERVEEP----VLQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQDAISSANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HSSVC 256          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Human
Match: AGAP1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:HGNC Symbol;Acc:HGNC:16922])

HSP 1 Score: 288.5 bits (737), Expect = 6.496e-86
Identity = 144/250 (57.60%), Postives = 197/250 (78.80%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNC 886
            +IR E+ RFESVHPNIY+IYE+L+ +++     V+++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q ++W D VIFVFSLE E S + V  YY +M+++R+ +++P++LVGTQDAIS +NPRVIDD++AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C
Sbjct:   12 AIRAEIQRFESVHPNIYSIYELLERVEEP----VLQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQDAISSANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HSSVC 256          

HSP 2 Score: 79.7221 bits (195), Expect = 9.334e-15
Identity = 50/117 (42.74%), Postives = 78/117 (66.67%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          D +K+++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  296 DVPPTANTPTPVRKQSKRRSNLF----TSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Human
Match: AGAP1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:HGNC Symbol;Acc:HGNC:16922])

HSP 1 Score: 288.886 bits (738), Expect = 1.310e-85
Identity = 144/250 (57.60%), Postives = 197/250 (78.80%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNC 886
            +IR E+ RFESVHPNIY+IYE+L+ +++     V+++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q ++W D VIFVFSLE E S + V  YY +M+++R+ +++P++LVGTQDAIS +NPRVIDD++AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C
Sbjct:   12 AIRAEIQRFESVHPNIYSIYELLERVEEP----VLQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQDAISSANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HSSVC 256          

HSP 2 Score: 80.1073 bits (196), Expect = 7.006e-15
Identity = 50/117 (42.74%), Postives = 78/117 (66.67%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          D +K+++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  296 DVPPTANTPTPVRKQSKRRSNLF----TSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 233.802 bits (595), Expect = 1.356e-65
Identity = 116/226 (51.33%), Postives = 164/226 (72.57%), Query Frame = 2
Query:  131 AQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCP-DKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRML 805
            ++ IR+E+ RFESVHP IY IY++L+ L D      I + I+E +VS+ED+FVNS EWTL R ++ +KLGIVG+  SGK+ALVHRYLTG+Y  DESPEGGRFKKEVV++G S LLLIRDEG    D Q   W D V+FVF++   +S + +     +MS +R+++D+P++LVGT+D IS+   RVI + + R++A+ + R  Y+ET +TYG NVERVF + C +++
Sbjct:   15 SEQIRSEIQRFESVHPCIYQIYDLLNLLPDG--CHAISEQIREQIVSVEDAFVNSHEWTLSRSISEMKLGIVGTSQSGKTALVHRYLTGTYTPDESPEGGRFKKEVVIEGQSHLLLIRDEGQQHLDVQFCQWVDAVVFVFNVCSIQSYDSIQALAHEMSKYRNISDLPLILVGTKDHISEKRARVITEDEGRQLAAQMKRCSYFETSSTYGTNVERVFKEACCKII 238          

HSP 2 Score: 74.3294 bits (181), Expect = 2.076e-13
Identity = 47/116 (40.52%), Postives = 74/116 (63.79%), Query Frame = 2
Query: 1403 PTPGSTPTQIRKTRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSS-NQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQ-VRGKEVDLKLTSIKIPG 1744
            PTP STP   RK RR S++F+           +++++ +  +   +G GR IP+KQ  L+KKSS + +N++ K +KYV L  D +LTY+ N+ +YM++   GKE+DLKL +I+I G
Sbjct:  411 PTPSSTPNTQRKNRRISNIFR--------QKDHQEEKSKMIESLNLGIGRAIPIKQGNLYKKSSKSALNREWK-KKYVCLYSDGRLTYHTNLKEYMDKTAHGKEMDLKLATIRITG 517          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 233.802 bits (595), Expect = 1.356e-65
Identity = 116/226 (51.33%), Postives = 164/226 (72.57%), Query Frame = 2
Query:  131 AQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCP-DKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRML 805
            ++ IR+E+ RFESVHP IY IY++L+ L D      I + I+E +VS+ED+FVNS EWTL R ++ +KLGIVG+  SGK+ALVHRYLTG+Y  DESPEGGRFKKEVV++G S LLLIRDEG    D Q   W D V+FVF++   +S + +     +MS +R+++D+P++LVGT+D IS+   RVI + + R++A+ + R  Y+ET +TYG NVERVF + C +++
Sbjct:   15 SEQIRSEIQRFESVHPCIYQIYDLLNLLPDG--CHAISEQIREQIVSVEDAFVNSHEWTLSRSISEMKLGIVGTSQSGKTALVHRYLTGTYTPDESPEGGRFKKEVVIEGQSHLLLIRDEGQQHLDVQFCQWVDAVVFVFNVCSIQSYDSIQALAHEMSKYRNISDLPLILVGTKDHISEKRARVITEDEGRQLAAQMKRCSYFETSSTYGTNVERVFKEACCKII 238          

HSP 2 Score: 74.3294 bits (181), Expect = 2.076e-13
Identity = 47/116 (40.52%), Postives = 74/116 (63.79%), Query Frame = 2
Query: 1403 PTPGSTPTQIRKTRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSS-NQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQ-VRGKEVDLKLTSIKIPG 1744
            PTP STP   RK RR S++F+           +++++ +  +   +G GR IP+KQ  L+KKSS + +N++ K +KYV L  D +LTY+ N+ +YM++   GKE+DLKL +I+I G
Sbjct:  411 PTPSSTPNTQRKNRRISNIFR--------QKDHQEEKSKMIESLNLGIGRAIPIKQGNLYKKSSKSALNREWK-KKYVCLYSDGRLTYHTNLKEYMDKTAHGKEMDLKLATIRITG 517          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 188.734 bits (478), Expect = 7.035e-50
Identity = 93/177 (52.54%), Postives = 130/177 (73.45%), Query Frame = 2
Query:  278 DSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCP-DKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRML 805
            D+FVNS EWTL R ++ +KLGIVG+  SGK+ALVHRYLTG+Y  DESPEGGRFKKEVV++G S LLLIRDEG    D Q   W D V+FVF++   +S + +     +MS +R+++D+P++LVGT+D IS+   RVI + + R++A+ + R  Y+ET +TYG NVERVF + C +++
Sbjct:  218 DAFVNSHEWTLSRSISEMKLGIVGTSQSGKTALVHRYLTGTYTPDESPEGGRFKKEVVIEGQSHLLLIRDEGQQHLDVQFCQWVDAVVFVFNVCSIQSYDSIQALAHEMSKYRNISDLPLILVGTKDHISEKRARVITEDEGRQLAAQMKRCSYFETSSTYGTNVERVFKEACCKII 394          

HSP 2 Score: 73.559 bits (179), Expect = 3.392e-13
Identity = 47/116 (40.52%), Postives = 74/116 (63.79%), Query Frame = 2
Query: 1403 PTPGSTPTQIRKTRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSS-NQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQ-VRGKEVDLKLTSIKIPG 1744
            PTP STP   RK RR S++F+           +++++ +  +   +G GR IP+KQ  L+KKSS + +N++ K +KYV L  D +LTY+ N+ +YM++   GKE+DLKL +I+I G
Sbjct:  567 PTPSSTPNTQRKNRRISNIFR--------QKDHQEEKSKMIESLNLGIGRAIPIKQGNLYKKSSKSALNREWK-KKYVCLYSDGRLTYHTNLKEYMDKTAHGKEMDLKLATIRITG 673          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 165.622 bits (418), Expect = 1.886e-42
Identity = 83/160 (51.88%), Postives = 117/160 (73.12%), Query Frame = 2
Query:  329 LKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCP-DKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRML 805
            +KLGIVG+  SGK+ALVHRYLTG+Y  DESPEGGRFKKEVV++G S LLLIRDEG    D Q   W D V+FVF++   +S + +     +MS +R+++D+P++LVGT+D IS+   RVI + + R++A+ + R  Y+ET +TYG NVERVF + C +++
Sbjct:    1 MKLGIVGTSQSGKTALVHRYLTGTYTPDESPEGGRFKKEVVIEGQSHLLLIRDEGQQHLDVQFCQWVDAVVFVFNVCSIQSYDSIQALAHEMSKYRNISDLPLILVGTKDHISEKRARVITEDEGRQLAAQMKRCSYFETSSTYGTNVERVFKEACCKII 160          

HSP 2 Score: 73.9442 bits (180), Expect = 2.622e-13
Identity = 47/116 (40.52%), Postives = 74/116 (63.79%), Query Frame = 2
Query: 1403 PTPGSTPTQIRKTRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSS-NQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQ-VRGKEVDLKLTSIKIPG 1744
            PTP STP   RK RR S++F+           +++++ +  +   +G GR IP+KQ  L+KKSS + +N++ K +KYV L  D +LTY+ N+ +YM++   GKE+DLKL +I+I G
Sbjct:  333 PTPSSTPNTQRKNRRISNIFR--------QKDHQEEKSKMIESLNLGIGRAIPIKQGNLYKKSSKSALNREWK-KKYVCLYSDGRLTYHTNLKEYMDKTAHGKEMDLKLATIRITG 439          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 163.696 bits (413), Expect = 7.229e-42
Identity = 81/165 (49.09%), Postives = 119/165 (72.12%), Query Frame = 2
Query:  314 RFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCP-DKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRML 805
            ++ +  ++GIVG+  SGK+ALVHRYLTG+Y  DESPEGGRFKKEVV++G S LLLIRDEG    D Q   W D V+FVF++   +S + +     +MS +R+++D+P++LVGT+D IS+   RVI + + R++A+ + R  Y+ET +TYG NVERVF + C +++
Sbjct:   26 KYYHKFRIGIVGTSQSGKTALVHRYLTGTYTPDESPEGGRFKKEVVIEGQSHLLLIRDEGQQHLDVQFCQWVDAVVFVFNVCSIQSYDSIQALAHEMSKYRNISDLPLILVGTKDHISEKRARVITEDEGRQLAAQMKRCSYFETSSTYGTNVERVFKEACCKII 190          

HSP 2 Score: 73.9442 bits (180), Expect = 2.622e-13
Identity = 47/116 (40.52%), Postives = 74/116 (63.79%), Query Frame = 2
Query: 1403 PTPGSTPTQIRKTRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSS-NQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQ-VRGKEVDLKLTSIKIPG 1744
            PTP STP   RK RR S++F+           +++++ +  +   +G GR IP+KQ  L+KKSS + +N++ K +KYV L  D +LTY+ N+ +YM++   GKE+DLKL +I+I G
Sbjct:  363 PTPSSTPNTQRKNRRISNIFR--------QKDHQEEKSKMIESLNLGIGRAIPIKQGNLYKKSSKSALNREWK-KKYVCLYSDGRLTYHTNLKEYMDKTAHGKEMDLKLATIRITG 469          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080546)

HSP 1 Score: 303.523 bits (776), Expect = 2.054e-90
Identity = 164/273 (60.07%), Postives = 206/273 (75.46%), Query Frame = 2
Query:   89 IMASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQ-SRPTTPQVHTNNCVTSSPY 904
            I+ +  P+ L S++  +IR E+ RFESVHP+IYAIYE++D L  AD    I  +I+++VV IEDSFVNSQEWT+ R V  L+LGIVGS+ SGKSALVHRYLTGSY+Q+ESPEGGRFKKEV +DG S LLLIRDEGG P+ Q + W D VIFVFSLE E S   V +YY +M+ FR+  ++P++LVGTQDAIS+ NPRVIDD++AR++AS+L R  YYETCATYGLNVERVF D C ++L      LPL   +Q +RPTTPQ    N +  +PY
Sbjct:   66 ILVAHPPQPLISNSL-AIRQEIQRFESVHPSIYAIYELIDLLPMADAQ--IAQSIRDHVVCIEDSFVNSQEWTISRSVPDLRLGIVGSLNSGKSALVHRYLTGSYMQEESPEGGRFKKEVFIDGQSYLLLIRDEGGAPEMQFAGWVDAVIFVFSLENEGSFNTVYNYYTKMAHFRNGQEIPMILVGTQDAISERNPRVIDDTRARKLASDLKRCSYYETCATYGLNVERVFQDACQKIL---SQRLPLPPQVQPARPTTPQ---GNRLGLAPY 329          

HSP 2 Score: 85.8853 bits (211), Expect = 6.781e-17
Identity = 48/110 (43.64%), Postives = 76/110 (69.09%), Query Frame = 2
Query: 1433 RKTRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNS 1762
            RK+RR+S+LF P           K  ++++ + + +GSGR IP+KQ YL+K+SS  +NK+ K +KYVTL +D +LTY+P+++DYM+ V GKE+ L+  ++K+PG   R S
Sbjct:  419 RKSRRRSNLFIP-------SSSKKADKEKEPKSSELGSGRSIPIKQGYLYKRSSKSLNKEWK-KKYVTLCDDGRLTYHPSLHDYMDDVHGKEIPLQYVTVKVPGQKPRGS 520          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080547)

HSP 1 Score: 252.292 bits (643), Expect = 3.759e-72
Identity = 134/210 (63.81%), Postives = 162/210 (77.14%), Query Frame = 2
Query:  278 DSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQ-SRPTTPQVHTNNCVTSSPY 904
            DSFVNSQEWT+ R V  L+LGIVGS+ SGKSALVHRYLTGSY+Q+ESPEGGRFKKEV +DG S LLLIRDEGG P+ Q + W D VIFVFSLE E S   V +YY +M+ FR+  ++P++LVGTQDAIS+ NPRVIDD++AR++AS+L R  YYETCATYGLNVERVF D C ++L      LPL   +Q +RPTTPQ    N +  +PY
Sbjct:   58 DSFVNSQEWTISRSVPDLRLGIVGSLNSGKSALVHRYLTGSYMQEESPEGGRFKKEVFIDGQSYLLLIRDEGGAPEMQFAGWVDAVIFVFSLENEGSFNTVYNYYTKMAHFRNGQEIPMILVGTQDAISERNPRVIDDTRARKLASDLKRCSYYETCATYGLNVERVFQDACQKIL---SQRLPLPPQVQPARPTTPQ---GNRLGLAPY 261          

HSP 2 Score: 85.5001 bits (210), Expect = 7.161e-17
Identity = 48/110 (43.64%), Postives = 76/110 (69.09%), Query Frame = 2
Query: 1433 RKTRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNS 1762
            RK+RR+S+LF P           K  ++++ + + +GSGR IP+KQ YL+K+SS  +NK+ K +KYVTL +D +LTY+P+++DYM+ V GKE+ L+  ++K+PG   R S
Sbjct:  351 RKSRRRSNLFIP-------SSSKKADKEKEPKSSELGSGRSIPIKQGYLYKRSSKSLNKEWK-KKYVTLCDDGRLTYHPSLHDYMDDVHGKEIPLQYVTVKVPGQKPRGS 452          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080548)

HSP 1 Score: 117.087 bits (292), Expect = 7.216e-27
Identity = 58/103 (56.31%), Postives = 76/103 (73.79%), Query Frame = 2
Query:  599 MSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQ-SRPTTPQVHTNNCVTSSPY 904
            M+ FR+  ++P++LVGTQDAIS+ NPRVIDD++AR++AS+L R  YYETCATYGLNVERVF D C ++L      LPL   +Q +RPTTPQ    N +  +PY
Sbjct:    1 MAHFRNGQEIPMILVGTQDAISERNPRVIDDTRARKLASDLKRCSYYETCATYGLNVERVFQDACQKIL---SQRLPLPPQVQPARPTTPQ---GNRLGLAPY 97          

HSP 2 Score: 85.8853 bits (211), Expect = 4.898e-17
Identity = 48/110 (43.64%), Postives = 76/110 (69.09%), Query Frame = 2
Query: 1433 RKTRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNS 1762
            RK+RR+S+LF P           K  ++++ + + +GSGR IP+KQ YL+K+SS  +NK+ K +KYVTL +D +LTY+P+++DYM+ V GKE+ L+  ++K+PG   R S
Sbjct:  187 RKSRRRSNLFIP-------SSSKKADKEKEPKSSELGSGRSIPIKQGYLYKRSSKSLNKEWK-KKYVTLCDDGRLTYHPSLHDYMDDVHGKEIPLQYVTVKVPGQKPRGS 288          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Zebrafish
Match: agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:ZFIN;Acc:ZDB-GENE-130405-1])

HSP 1 Score: 288.115 bits (736), Expect = 1.476e-85
Identity = 146/252 (57.94%), Postives = 195/252 (77.38%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVT 892
            +IR E+ RFESVHPNIY IYE+L+ ++D     ++++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q +LW D VIFVFSLE E S + V  YY +M+++R+  +VP++LVGTQDAIS +NPRVIDD++AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C  
Sbjct:   12 AIRGEIQRFESVHPNIYCIYELLERVEDP----LLQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFALWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTAEVPLVLVGTQDAISAANPRVIDDTRARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKVVAIRKKQQLSIGPCKSLPNSPS-HSSVCAA 258          

HSP 2 Score: 80.4925 bits (197), Expect = 3.886e-15
Identity = 48/117 (41.03%), Postives = 77/117 (65.81%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          + +++++    + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  296 DVPQTANTPTPVRKQSKRRSNLF----TSRKGSEPDREKKGMDGRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Zebrafish
Match: agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:ZFIN;Acc:ZDB-GENE-130405-1])

HSP 1 Score: 282.337 bits (721), Expect = 2.426e-83
Identity = 146/257 (56.81%), Postives = 195/257 (75.88%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPE-----GGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVT 892
            +IR E+ RFESVHPNIY IYE+L+ ++D     ++++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPE     GGRFKKE+V+DG S LLLIRDEGG P+ Q +LW D VIFVFSLE E S + V  YY +M+++R+  +VP++LVGTQDAIS +NPRVIDD++AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C  
Sbjct:   12 AIRGEIQRFESVHPNIYCIYELLERVEDP----LLQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEADVDAGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFALWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTAEVPLVLVGTQDAISAANPRVIDDTRARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKVVAIRKKQQLSIGPCKSLPNSPS-HSSVCAA 263          

HSP 2 Score: 80.4925 bits (197), Expect = 3.457e-15
Identity = 48/117 (41.03%), Postives = 77/117 (65.81%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          + +++++    + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  301 DVPQTANTPTPVRKQSKRRSNLF----TSRKGSEPDREKKGMDGRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 412          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Zebrafish
Match: agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:ZFIN;Acc:ZDB-GENE-110927-1])

HSP 1 Score: 234.572 bits (597), Expect = 4.345e-65
Identity = 126/216 (58.33%), Postives = 166/216 (76.85%), Query Frame = 2
Query:  275 EDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRML-------LNAKP--SLPLANNIQSRP--TTPQVHTNNCV 889
            +DSFVNSQEWTL R V  LK+GIVG+++SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q + W D V+FVFSLE E S + V +Y+ ++SS+R+  +VP++LVGTQDAIS +NPRVIDD++AR+++++L R+ YYETC+TYGLNVERVF DV  +++       L+  P  SLP + +  S P  + P VH N   
Sbjct:  330 QDSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLSSYRNAAEVPMVLVGTQDAISAANPRVIDDARARKLSNDLKRSTYYETCSTYGLNVERVFQDVAQKVVALRKKQQLSIGPCKSLPNSPSHSSVPAASIPSVHINQAA 545          

HSP 2 Score: 78.9518 bits (193), Expect = 1.293e-14
Identity = 64/187 (34.22%), Postives = 103/187 (55.08%), Query Frame = 2
Query: 1187 KSLPSPRSNAPQHQHSFESTHVYSEYNMLMSSGSSFIAQPPSLPASSAFDLSIHHRPEKSTASSADGIPKDPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            KSLP+  S++     S  S H+    N   + G +F     S+P++     SI  R  +    +A           +TPT IRK ++R+S++F       ++   + Q +  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  520 KSLPNSPSHSSVPAASIPSVHI----NQAANGGGAFSDYSSSVPSTP----SISQREMRIETVAAS----------NTPTPIRKQSKRRSNIF-------TSRKASDQTKSIESKTDSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCDNGLLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 680          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Zebrafish
Match: agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:ZFIN;Acc:ZDB-GENE-130405-1])

HSP 1 Score: 228.024 bits (580), Expect = 7.147e-64
Identity = 119/204 (58.33%), Postives = 155/204 (75.98%), Query Frame = 2
Query:  281 SFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVT 892
            S ++ QEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q +LW D VIFVFSLE E S + V  YY +M+++R+  +VP++LVGTQDAIS +NPRVIDD++AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C  
Sbjct:   26 SLIHIQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFALWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTAEVPLVLVGTQDAISAANPRVIDDTRARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKVVAIRKKQQLSIGPCKSLPNSPS-HSSVCAA 228          

HSP 2 Score: 80.4925 bits (197), Expect = 3.833e-15
Identity = 48/117 (41.03%), Postives = 77/117 (65.81%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          + +++++    + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  266 DVPQTANTPTPVRKQSKRRSNLF----TSRKGSEPDREKKGMDGRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 377          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Zebrafish
Match: agap2 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 [Source:ZFIN;Acc:ZDB-GENE-061103-343])

HSP 1 Score: 199.904 bits (507), Expect = 5.065e-54
Identity = 106/230 (46.09%), Postives = 160/230 (69.57%), Query Frame = 2
Query:  116 LKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRML 805
            +K   + +IR EV R E++   I    + L+ ++D    Q ++  +K ++ SI+ S  NSQEWTL R +  L+LG++GS+ SGKSALV+R++TGSY+  ES EGGR+KKEV+++G S LLLIR+E G P  QL  W DG+I VFSLE E S + V   Y ++S+ R++ ++P++ VGTQD IS +N RVI+D + +++  ++ R  YYETCATYGLNV+RVF ++  +++
Sbjct:    5 IKVTNSTAIRAEVRRHENLQKTINKFIKQLERVED----QQLRTGLKVFLHSIQASCANSQEWTLTRTIPELRLGVLGSIRSGKSALVNRFITGSYLPLESHEGGRYKKEVLVEGQSQLLLIREESGPPSAQLCNWLDGLILVFSLENEASFQEVYKNYSELSAHRNIAEIPIIAVGTQDKISSTNARVIEDKRVQQLCIDVRRCTYYETCATYGLNVDRVFNEMTQKIV 230          

HSP 2 Score: 65.855 bits (159), Expect = 1.279e-10
Identity = 27/63 (42.86%), Postives = 45/63 (71.43%), Query Frame = 2
Query: 1556 IPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            +P+KQ  L+K+S   +NK+ K +KYVTL+    LTY+ N+N+++   +GKE+DL   ++K+PG
Sbjct:  333 VPIKQGTLWKRSERSLNKEWK-KKYVTLSNSGMLTYHSNINEFLQNAQGKEMDLLRVTVKVPG 394          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Xenopus
Match: stmn4 (stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072])

HSP 1 Score: 291.582 bits (745), Expect = 2.907e-86
Identity = 150/262 (57.25%), Postives = 200/262 (76.34%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPHGAMT 922
            +IR E+ RFESVHPNIY+IYE+L+ LD+      +++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q ++W D VIFVFSLE E S + V  YY +++++R+ +++P++LVGTQDAIS SNPRVIDDS+AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  HT+ C T     H + T
Sbjct:   88 AIRAEIQRFESVHPNIYSIYELLERLDEP----ALQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRLANYRNTSEIPMVLVGTQDAISCSNPRVIDDSRARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HTSVCSTQVSAVHISQT 344          

HSP 2 Score: 81.2629 bits (199), Expect = 3.061e-15
Identity = 51/117 (43.59%), Postives = 77/117 (65.81%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   STPT +RK ++R+S+LF          D +K ++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  372 DVPPAASTPTPVRKQSKRRSNLF----TSRKGSDPDKDKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 483          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Xenopus
Match: stmn4 (stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072])

HSP 1 Score: 240.35 bits (612), Expect = 3.491e-67
Identity = 126/216 (58.33%), Postives = 164/216 (75.93%), Query Frame = 2
Query:  275 EDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPHGAMT 922
            +D+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q ++W D VIFVFSLE E S + V  YY +++++R+ +++P++LVGTQDAIS SNPRVIDDS+AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  HT+ C T     H + T
Sbjct:  285 KDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRLANYRNTSEIPMVLVGTQDAISCSNPRVIDDSRARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HTSVCSTQVSAVHISQT 499          

HSP 2 Score: 81.2629 bits (199), Expect = 3.057e-15
Identity = 51/117 (43.59%), Postives = 77/117 (65.81%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   STPT +RK ++R+S+LF          D +K ++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  527 DVPPAASTPTPVRKQSKRRSNLF----TSRKGSDPDKDKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 638          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Xenopus
Match: stmn4 (stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072])

HSP 1 Score: 239.965 bits (611), Expect = 4.098e-67
Identity = 126/216 (58.33%), Postives = 164/216 (75.93%), Query Frame = 2
Query:  275 EDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPHGAMT 922
            +D+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q ++W D VIFVFSLE E S + V  YY +++++R+ +++P++LVGTQDAIS SNPRVIDDS+AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  HT+ C T     H + T
Sbjct:  285 KDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRLANYRNTSEIPMVLVGTQDAISCSNPRVIDDSRARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HTSVCSTQVSAVHISQT 499          

HSP 2 Score: 80.8777 bits (198), Expect = 4.344e-15
Identity = 51/117 (43.59%), Postives = 77/117 (65.81%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   STPT +RK ++R+S+LF          D +K ++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  527 DVPPAASTPTPVRKQSKRRSNLF----TSRKGSDPDKDKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 638          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Xenopus
Match: stmn4 (stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072])

HSP 1 Score: 240.35 bits (612), Expect = 5.421e-67
Identity = 126/216 (58.33%), Postives = 164/216 (75.93%), Query Frame = 2
Query:  275 EDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPHGAMT 922
            +D+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q ++W D VIFVFSLE E S + V  YY +++++R+ +++P++LVGTQDAIS SNPRVIDDS+AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  HT+ C T     H + T
Sbjct:  285 KDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRLANYRNTSEIPMVLVGTQDAISCSNPRVIDDSRARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HTSVCSTQVSAVHISQT 499          

HSP 2 Score: 81.2629 bits (199), Expect = 3.436e-15
Identity = 51/117 (43.59%), Postives = 77/117 (65.81%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   STPT +RK ++R+S+LF          D +K ++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  527 DVPPAASTPTPVRKQSKRRSNLF----TSRKGSDPDKDKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 638          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Xenopus
Match: stmn4 (stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072])

HSP 1 Score: 240.35 bits (612), Expect = 8.297e-67
Identity = 126/216 (58.33%), Postives = 164/216 (75.93%), Query Frame = 2
Query:  275 EDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPHGAMT 922
            +D+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q ++W D VIFVFSLE E S + V  YY +++++R+ +++P++LVGTQDAIS SNPRVIDDS+AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  HT+ C T     H + T
Sbjct:  364 KDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRLANYRNTSEIPMVLVGTQDAISCSNPRVIDDSRARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HTSVCSTQVSAVHISQT 578          

HSP 2 Score: 81.2629 bits (199), Expect = 3.356e-15
Identity = 51/117 (43.59%), Postives = 77/117 (65.81%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   STPT +RK ++R+S+LF          D +K ++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  606 DVPPAASTPTPVRKQSKRRSNLF----TSRKGSDPDKDKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 717          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Mouse
Match: Agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:MGI Symbol;Acc:MGI:2183446])

HSP 1 Score: 289.271 bits (739), Expect = 9.985e-91
Identity = 150/273 (54.95%), Postives = 202/273 (73.99%), Query Frame = 2
Query:   92 MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPH 910
            +A   P+      + +IR E+ RFESVHPNIYAIY++++ ++D      +++ I+E+V+SIEDSFVNSQEWTL R V  LK+GIVG+++SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q + W D V+FVFSLE E S + V +Y+ ++ SFR+ ++VP++LVGTQDAIS +NPRVIDDS+AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H+     S P  H
Sbjct:   52 LAGGPPQQFALSNSAAIRAEIQRFESVHPNIYAIYDLIERIEDL----ALQNQIREHVISIEDSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAISAANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCKSLPNSPS-HSAVSAASIPAVH 319          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Mouse
Match: Agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:MGI Symbol;Acc:MGI:2653690])

HSP 1 Score: 286.96 bits (733), Expect = 1.569e-85
Identity = 144/250 (57.60%), Postives = 196/250 (78.40%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNC 886
            +IR E+ RFESVHPNIY+IYE+L+ +++     V+++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q ++W D VIFVFSLE E S + V  YY +M+++R+ +++P++LVGTQDAIS +NPRVIDD +AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C
Sbjct:   12 AIRAEIQRFESVHPNIYSIYELLERVEEP----VLQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQDAISSTNPRVIDDVRARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HSSVC 256          

HSP 2 Score: 79.7221 bits (195), Expect = 7.046e-15
Identity = 50/117 (42.74%), Postives = 78/117 (66.67%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          D +K+++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  296 DVPPTANTPTPVRKQSKRRSNLF----TSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Mouse
Match: Agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:MGI Symbol;Acc:MGI:2653690])

HSP 1 Score: 287.73 bits (735), Expect = 2.287e-85
Identity = 144/250 (57.60%), Postives = 196/250 (78.40%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNC 886
            +IR E+ RFESVHPNIY+IYE+L+ +++     V+++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q ++W D VIFVFSLE E S + V  YY +M+++R+ +++P++LVGTQDAIS +NPRVIDD +AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C
Sbjct:   12 AIRAEIQRFESVHPNIYSIYELLERVEEP----VLQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQDAISSTNPRVIDDVRARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HSSVC 256          

HSP 2 Score: 80.1073 bits (196), Expect = 5.109e-15
Identity = 50/117 (42.74%), Postives = 78/117 (66.67%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          D +K+++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  296 DVPPTANTPTPVRKQSKRRSNLF----TSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Mouse
Match: Agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:MGI Symbol;Acc:MGI:2183446])

HSP 1 Score: 288.5 bits (737), Expect = 2.471e-85
Identity = 150/273 (54.95%), Postives = 202/273 (73.99%), Query Frame = 2
Query:   92 MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPH 910
            +A   P+      + +IR E+ RFESVHPNIYAIY++++ ++D      +++ I+E+V+SIEDSFVNSQEWTL R V  LK+GIVG+++SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q + W D V+FVFSLE E S + V +Y+ ++ SFR+ ++VP++LVGTQDAIS +NPRVIDDS+AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H+     S P  H
Sbjct:   52 LAGGPPQQFALSNSAAIRAEIQRFESVHPNIYAIYDLIERIEDL----ALQNQIREHVISIEDSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAISAANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCKSLPNSPS-HSAVSAASIPAVH 319          

HSP 2 Score: 80.4925 bits (197), Expect = 3.914e-15
Identity = 65/187 (34.76%), Postives = 108/187 (57.75%), Query Frame = 2
Query: 1187 KSLPSPRSNAPQHQHSFESTHVYSEYNMLMSSGSSFIAQPPSLPASSAFDLSIHHRPEKSTASSADGIPKDPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            KSLP+  S++     S  + H+    N   S+ S + +  PS P+ S  +L I     ++ A+S            STPT IRK ++R+S++F          D +++++  + +++ IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  + GKE+DL  T++K+PG
Sbjct:  299 KSLPNSPSHSAVSAASIPAVHINQATNGGSSAFSDYSSSVPSTPSISQRELRI-----ETIAAS------------STPTPIRKQSKRRSNIF----TSRKGADLDREKKAAECRVDSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPG 463          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Mouse
Match: Agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:MGI Symbol;Acc:MGI:2183446])

HSP 1 Score: 235.343 bits (599), Expect = 2.186e-68
Identity = 125/211 (59.24%), Postives = 160/211 (75.83%), Query Frame = 2
Query:  278 DSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPH 910
            DSFVNSQEWTL R V  LK+GIVG+++SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q + W D V+FVFSLE E S + V +Y+ ++ SFR+ ++VP++LVGTQDAIS +NPRVIDDS+AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H+     S P  H
Sbjct:  293 DSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAISAANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCKSLPNSPS-HSAVSAASIPAVH 502          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. UniProt/SwissProt
Match: sp|Q9NGC3|CEG1A_DROME (Centaurin-gamma-1A OS=Drosophila melanogaster OX=7227 GN=CenG1A PE=2 SV=2)

HSP 1 Score: 303.523 bits (776), Expect = 2.059e-89
Identity = 164/273 (60.07%), Postives = 206/273 (75.46%), Query Frame = 2
Query:   89 IMASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQ-SRPTTPQVHTNNCVTSSPY 904
            I+ +  P+ L S++  +IR E+ RFESVHP+IYAIYE++D L  AD    I  +I+++VV IEDSFVNSQEWT+ R V  L+LGIVGS+ SGKSALVHRYLTGSY+Q+ESPEGGRFKKEV +DG S LLLIRDEGG P+ Q + W D VIFVFSLE E S   V +YY +M+ FR+  ++P++LVGTQDAIS+ NPRVIDD++AR++AS+L R  YYETCATYGLNVERVF D C ++L      LPL   +Q +RPTTPQ    N +  +PY
Sbjct:   66 ILVAHPPQPLISNSL-AIRQEIQRFESVHPSIYAIYELIDLLPMADAQ--IAQSIRDHVVCIEDSFVNSQEWTISRSVPDLRLGIVGSLNSGKSALVHRYLTGSYMQEESPEGGRFKKEVFIDGQSYLLLIRDEGGAPEMQFAGWVDAVIFVFSLENEGSFNTVYNYYTKMAHFRNGQEIPMILVGTQDAISERNPRVIDDTRARKLASDLKRCSYYETCATYGLNVERVFQDACQKIL---SQRLPLPPQVQPARPTTPQ---GNRLGLAPY 329          

HSP 2 Score: 85.8853 bits (211), Expect = 6.797e-16
Identity = 48/110 (43.64%), Postives = 76/110 (69.09%), Query Frame = 2
Query: 1433 RKTRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNS 1762
            RK+RR+S+LF P           K  ++++ + + +GSGR IP+KQ YL+K+SS  +NK+ K +KYVTL +D +LTY+P+++DYM+ V GKE+ L+  ++K+PG   R S
Sbjct:  419 RKSRRRSNLFIP-------SSSKKADKEKEPKSSELGSGRSIPIKQGYLYKRSSKSLNKEWK-KKYVTLCDDGRLTYHPSLHDYMDDVHGKEIPLQYVTVKVPGQKPRGS 520          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. UniProt/SwissProt
Match: sp|Q6NRL1|AGAP1_XENLA (Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=agap1 PE=2 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 3.779e-87
Identity = 151/262 (57.63%), Postives = 201/262 (76.72%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPHGAMT 922
            +IR E+ RFESVHPNIY+IYE+L+ LD+     V+++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q ++W D VIFVFSLE E S + V  YY +++++R+ +++P++LVGTQDAIS SNPRVIDDS+AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  HT+ C T     H + T
Sbjct:   12 AIRAEIQRFESVHPNIYSIYELLERLDEP----VLQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRLANYRNTSEIPMVLVGTQDAISGSNPRVIDDSRARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HTSVCSTQVSAVHISQT 268          

HSP 2 Score: 82.0333 bits (201), Expect = 8.893e-15
Identity = 51/117 (43.59%), Postives = 78/117 (66.67%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   STPT +RK ++R+S+LF          D +K ++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL+++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  296 DVPPAASTPTPVRKQSKRRSNLF----TSRKGSDPDKDKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLSDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. UniProt/SwissProt
Match: sp|Q9UPQ3|AGAP1_HUMAN (Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4)

HSP 1 Score: 288.886 bits (738), Expect = 6.291e-85
Identity = 144/250 (57.60%), Postives = 197/250 (78.80%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNC 886
            +IR E+ RFESVHPNIY+IYE+L+ +++     V+++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q ++W D VIFVFSLE E S + V  YY +M+++R+ +++P++LVGTQDAIS +NPRVIDD++AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C
Sbjct:   12 AIRAEIQRFESVHPNIYSIYELLERVEEP----VLQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQDAISSANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HSSVC 256          

HSP 2 Score: 80.1073 bits (196), Expect = 3.365e-14
Identity = 50/117 (42.74%), Postives = 78/117 (66.67%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          D +K+++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  296 DVPPTANTPTPVRKQSKRRSNLF----TSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. UniProt/SwissProt
Match: sp|Q96P47|AGAP3_HUMAN (Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=AGAP3 PE=1 SV=2)

HSP 1 Score: 288.115 bits (736), Expect = 1.432e-84
Identity = 150/273 (54.95%), Postives = 202/273 (73.99%), Query Frame = 2
Query:   92 MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPH 910
            +A   P+      + +IR E+ RFESVHPNIYAIY++++ ++D      +++ I+E+V+SIEDSFVNSQEWTL R V  LK+GIVG+++SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q + W D V+FVFSLE E S + V +Y+ ++ SFR+ ++VP++LVGTQDAIS +NPRVIDDS+AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H+     S P  H
Sbjct:   17 LAGGPPQQFALSNSAAIRAEIQRFESVHPNIYAIYDLIERIEDL----ALQNQIREHVISIEDSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAISAANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCKSLPNSPS-HSAVSAASIPAVH 284          

HSP 2 Score: 84.7297 bits (208), Expect = 1.256e-15
Identity = 65/187 (34.76%), Postives = 108/187 (57.75%), Query Frame = 2
Query: 1187 KSLPSPRSNAPQHQHSFESTHVYSEYNMLMSSGSSFIAQPPSLPASSAFDLSIHHRPEKSTASSADGIPKDPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            KSLP+  S++     S  + H+    N   S+ S + +  PS P+ S  +L I     ++ A+S            STPT IRK ++R+S++F          D +++++  + +++ IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  + GKE+DL  T++K+PG
Sbjct:  264 KSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRI-----ETIAAS------------STPTPIRKQSKRRSNIF----TSRKGADLDREKKAAECKVDSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPG 428          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. UniProt/SwissProt
Match: sp|Q8BXK8|AGAP1_MOUSE (Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Agap1 PE=1 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 1.600e-84
Identity = 144/250 (57.60%), Postives = 196/250 (78.40%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNC 886
            +IR E+ RFESVHPNIY+IYE+L+ +++     V+++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q ++W D VIFVFSLE E S + V  YY +M+++R+ +++P++LVGTQDAIS +NPRVIDD +AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C
Sbjct:   12 AIRAEIQRFESVHPNIYSIYELLERVEEP----VLQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQDAISSTNPRVIDDVRARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HSSVC 256          

HSP 2 Score: 80.1073 bits (196), Expect = 3.574e-14
Identity = 50/117 (42.74%), Postives = 78/117 (66.67%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          D +K+++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  296 DVPPTANTPTPVRKQSKRRSNLF----TSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. TrEMBL
Match: W6USK9 (Centaurin-gamma-1A OS=Echinococcus granulosus OX=6210 GN=EGR_00570 PE=4 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.033e-101
Identity = 226/556 (40.65%), Postives = 325/556 (58.45%), Query Frame = 2
Query:  140 IRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQ------------DAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPHGAMTQPKRSCSTSNDSNNNFTRTGSYVVSQPQNYXXXXXXXXXXXXXXXXXXXXDNMGPPVRPNESRTRVSQNNTTKFTENLQNSIDYEAYLKSL-PSPRSNAPQHQHSFESTHVYSEYNMLMSSGSSFIAQPPSLPASSAFDLSIHHRP--EKSTASSADGIPKDPPTPGSTPTQIRKTRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNS 1762
            I+ E+ RFESVHP+IYA+Y++++ L D   +++ +      V S+ED+FVNSQEWTL   V  +KLG++GSV SGKSALVHRYLTG+Y++DESPEGGRFKKEVVLDG+S LLLIRDEGG PD+Q S W DG +FVFSL+ EES  VV DY++++ +FR + D+P++LVGTQ            D+ SDSNPRVIDD+KARR+A++L +  YYETC+TYGLNVERVF D C ++             +QSRP    + +     S+P                      F R   + V Q +  P  P+         P  +  D M  P+      +++          NL N +  ++ L+ +  +  +    +QH      V +  N  +++  S  A  P    S   D+  H+ P  E        G  +DP TP STPTQ RK+R KS+LF+           +  ++++++ ++GIGSGR IP+KQ YL+K++   +NK+ K +KYV LT+DA+L Y+P++ DY+    GKE+DL   ++KIPGV +R +
Sbjct:   18 IKQEIARFESVHPSIYAMYDLIEALTDRRQAEMFR----RQVASVEDAFVNSQEWTLGHTVPQIKLGLLGSVNSGKSALVHRYLTGTYLKDESPEGGRFKKEVVLDGMSYLLLIRDEGGAPDEQFSRWIDGAVFVFSLDSEESFRVVCDYFERLDTFREIRDLPIILVGTQGRYPLSNIDIYIDSTSDSNPRVIDDAKARRLANSLNKCPYYETCSTYGLNVERVFQDACVKI-------------VQSRPDLSYLLS----ASTP---------------------QFQRGQQFQVFQQRAQPPYPMQPPFPLQHVPSNSYRDRMIQPI------SQIHSATMGGVDPNLSNCMSTQSSLQCMHANTTARGGTYQHRLPPLPVDNATNGSINTSGSGSALTPQSNDSRRSDM--HNNPGFEPDFGDEPRGEARDPLTPSSTPTQSRKSRPKSNLFR---------KTDDAREKEKKVVDGIGSGRSIPIKQGYLYKRTCKPLNKEWKTKKYVALTDDARLIYHPSIQDYVQNSHGKEIDLSRVTVKIPGVIFRQT 514          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. TrEMBL
Match: A0A034VHS8 (Centaurin-gamma-1A (Fragment) OS=Bactrocera dorsalis OX=27457 GN=CEG1A PE=4 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 1.936e-92
Identity = 155/244 (63.52%), Postives = 191/244 (78.28%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQ 868
            +IR E+ RFESVHP+IYAIY+++D L  AD    I   I+++VV IEDSFVNSQEWT+ R V  L+LGIVGS+ SGKSALVHRYLTGSY+Q+ESPEGGRFKKEV +DG S LLLIRDEGG P+ Q + W D VIFVFSLE E S   + +YY +M+ FR+  D+P++LVGTQDAIS+ NPRVIDDS+AR++A++L R  YYETCATYGLNVERVF D C ++L   +  +PL   + SRPTTPQ
Sbjct:   67 AIRQEIQRFESVHPSIYAIYDLIDLLPIADAQ--IAQQIRDHVVCIEDSFVNSQEWTISRSVPDLRLGIVGSLNSGKSALVHRYLTGSYMQEESPEGGRFKKEVFIDGQSYLLLIRDEGGPPEMQFAAWVDAVIFVFSLENESSFNTIYNYYNKMAHFRNGQDLPMILVGTQDAISERNPRVIDDSRARKLANDLKRCSYYETCATYGLNVERVFQDACQKIL---QQRIPLPPTVNSRPTTPQ 305          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. TrEMBL
Match: A0A0K8VVB8 (Centaurin-gamma-1A (Fragment) OS=Bactrocera latifrons OX=174628 GN=cenG1A_4 PE=4 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 6.375e-92
Identity = 155/244 (63.52%), Postives = 191/244 (78.28%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQ 868
            +IR E+ RFESVHP+IYAIY+++D L  AD    I   I+++VV IEDSFVNSQEWT+ R V  L+LGIVGS+ SGKSALVHRYLTGSY+Q+ESPEGGRFKKEV +DG S LLLIRDEGG P+ Q + W D VIFVFSLE E S   + +YY +M+ FR+  D+P++LVGTQDAIS+ NPRVIDDS+AR++A++L R  YYETCATYGLNVERVF D C ++L   +  +PL   + SRPTTPQ
Sbjct:   71 AIRQEIQRFESVHPSIYAIYDLIDLLPIADAQ--IAQQIRDHVVCIEDSFVNSQEWTISRSVPDLRLGIVGSLNSGKSALVHRYLTGSYMQEESPEGGRFKKEVFIDGQSYLLLIRDEGGPPEMQFAAWVDAVIFVFSLENESSFNTIYNYYNKMAHFRNGQDLPMILVGTQDAISERNPRVIDDSRARKLANDLKRCSYYETCATYGLNVERVFQDACQKIL---QQRIPLPPTVNSRPTTPQ 309          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. TrEMBL
Match: A0A0A1WDC1 (Centaurin-gamma-1A (Fragment) OS=Zeugodacus cucurbitae OX=28588 GN=cenG1A_3 PE=4 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 8.129e-92
Identity = 155/244 (63.52%), Postives = 191/244 (78.28%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQ 868
            +IR E+ RFESVHP+IYAIY+++D L  AD    I   I+++VV IEDSFVNSQEWT+ R V  L+LGIVGS+ SGKSALVHRYLTGSY+Q+ESPEGGRFKKEV +DG S LLLIRDEGG P+ Q + W D VIFVFSLE E S   + +YY +M+ FR+  D+P++LVGTQDAIS+ NPRVIDDS+AR++A++L R  YYETCATYGLNVERVF D C ++L   +  +PL   + SRPTTPQ
Sbjct:   67 AIRQEIQRFESVHPSIYAIYDLIDLLPIADAQ--IAQQIRDHVVCIEDSFVNSQEWTISRSVPDLRLGIVGSLNSGKSALVHRYLTGSYMQEESPEGGRFKKEVFIDGQSYLLLIRDEGGPPEMQFAAWVDAVIFVFSLENESSFNTIYNYYNKMAHFRNGQDLPMILVGTQDAISERNPRVIDDSRARKLANDLKRCSYYETCATYGLNVERVFQDACQKIL---QQRIPLPPTVNSRPTTPQ 305          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. TrEMBL
Match: A0A2H6NJ52 (Uncharacterized protein (Fragment) OS=Micrurus lemniscatus carvalhoi OX=129465 PE=4 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 1.954e-89
Identity = 149/262 (56.87%), Postives = 201/262 (76.72%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPHGAMT 922
            +IR E+ RFESVHPNIY+IYE+L+ +++     V+++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q ++W D VIFVFSLE E S + V  YY +M+++R+ N++P+LLVGTQDAIS +NPRVIDD +AR+++++L R +YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C T     H + T
Sbjct:   15 AIRAEIHRFESVHPNIYSIYELLERVEEP----VLQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVIDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNANEIPMLLVGTQDAISSNNPRVIDDIRARKLSNDLKRCIYYETCATYGLNVERVFQDVAQKIVSTRKKHQLSIGPCKSLPNSPS-HSSVCSTHVSAVHISQT 271          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Cavefish
Match: agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:NCBI gene;Acc:103044997])

HSP 1 Score: 289.271 bits (739), Expect = 5.659e-86
Identity = 146/250 (58.40%), Postives = 196/250 (78.40%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNC 886
            +IR E+ RFESVHPNIY+IYE+L+ +D+     ++++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q +LW D VIFVFSLE E S + V  Y+ +M+++R+  DVP++LVGTQDAIS +NPRVIDD++AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C
Sbjct:   12 AIRAEIQRFESVHPNIYSIYELLERVDEP----LLQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFALWVDAVIFVFSLEDEISFQTVYHYFSRMANYRNTADVPLVLVGTQDAISAANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HSSVC 256          

HSP 2 Score: 80.8777 bits (198), Expect = 2.703e-15
Identity = 49/117 (41.88%), Postives = 78/117 (66.67%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          + +K+++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  296 DVPQTANTPTPVRKQSKRRSNLF----TSRKGSEPDKEKKGLEGRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Cavefish
Match: agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:NCBI gene;Acc:103044997])

HSP 1 Score: 239.58 bits (610), Expect = 8.669e-67
Identity = 123/204 (60.29%), Postives = 159/204 (77.94%), Query Frame = 2
Query:  275 EDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNC 886
            +D+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q +LW D VIFVFSLE E S + V  Y+ +M+++R+  DVP++LVGTQDAIS +NPRVIDD++AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C
Sbjct:  477 DDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFALWVDAVIFVFSLEDEISFQTVYHYFSRMANYRNTADVPLVLVGTQDAISAANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HSSVC 679          

HSP 2 Score: 80.4925 bits (197), Expect = 3.369e-15
Identity = 49/117 (41.88%), Postives = 78/117 (66.67%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          + +K+++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  719 DVPQTANTPTPVRKQSKRRSNLF----TSRKGSEPDKEKKGLEGRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 830          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Cavefish
Match: agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:NCBI gene;Acc:103044997])

HSP 1 Score: 239.58 bits (610), Expect = 9.767e-67
Identity = 123/204 (60.29%), Postives = 159/204 (77.94%), Query Frame = 2
Query:  275 EDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNC 886
            +D+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q +LW D VIFVFSLE E S + V  Y+ +M+++R+  DVP++LVGTQDAIS +NPRVIDD++AR+++++L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C
Sbjct:  477 DDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFALWVDAVIFVFSLEDEISFQTVYHYFSRMANYRNTADVPLVLVGTQDAISAANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HSSVC 679          

HSP 2 Score: 80.4925 bits (197), Expect = 3.663e-15
Identity = 49/117 (41.88%), Postives = 78/117 (66.67%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          + +K+++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  719 DVPQTANTPTPVRKQSKRRSNLF----TSRKGSEPDKEKKGLEGRADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 830          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Cavefish
Match: agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:NCBI gene;Acc:103021555])

HSP 1 Score: 233.802 bits (595), Expect = 9.728e-65
Identity = 119/197 (60.41%), Postives = 157/197 (79.70%), Query Frame = 2
Query:  275 EDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTP 865
            +DSFVNSQEWTL R V  LK+GIVG+++SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q + W D V+FVFSLE E S + V +Y+ ++SS+R+  +VP++LVGTQDAIS +NPRVIDD++AR+++++L R+ YYETC+TYGLNVERVF DV  +++   K         +S P +P
Sbjct:  489 QDSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLSSYRNAAEVPMVLVGTQDAISATNPRVIDDARARKLSNDLKRSTYYETCSTYGLNVERVFQDVAQKVVALRKKQQLAIGPCKSLPNSP 685          

HSP 2 Score: 78.1814 bits (191), Expect = 2.023e-14
Identity = 63/187 (33.69%), Postives = 103/187 (55.08%), Query Frame = 2
Query: 1187 KSLPSPRSNAPQHQHSFESTHVYSEYNMLMSSGSSFIAQPPSLPASSAFDLSIHHRPEKSTASSADGIPKDPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            KSLP+  S++     +  S H+    N   + G +F     S+P++     SI  R  +    +A           +TPT IRK ++R+S++F       ++   ++Q +    + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  679 KSLPNSPSHSSVPAAAIPSVHI----NQAANGGGAFSDYSSSVPSTP----SISQREMRIETIAAS----------NTPTPIRKQSKRRSNIF-------TSRKASEQTKSTDCKTDSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCDNGLLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 839          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Cavefish
Match: agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:NCBI gene;Acc:103021555])

HSP 1 Score: 233.802 bits (595), Expect = 1.060e-64
Identity = 119/197 (60.41%), Postives = 157/197 (79.70%), Query Frame = 2
Query:  275 EDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTP 865
            +DSFVNSQEWTL R V  LK+GIVG+++SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q + W D V+FVFSLE E S + V +Y+ ++SS+R+  +VP++LVGTQDAIS +NPRVIDD++AR+++++L R+ YYETC+TYGLNVERVF DV  +++   K         +S P +P
Sbjct:  517 QDSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLSSYRNAAEVPMVLVGTQDAISATNPRVIDDARARKLSNDLKRSTYYETCSTYGLNVERVFQDVAQKVVALRKKQQLAIGPCKSLPNSP 713          

HSP 2 Score: 78.1814 bits (191), Expect = 1.968e-14
Identity = 47/110 (42.73%), Postives = 74/110 (67.27%), Query Frame = 2
Query: 1418 TPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            TPT IRK ++R+S++F       ++   ++Q +    + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  766 TPTPIRKQSKRRSNIF-------TSRKASEQTKSTDCKTDSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCDNGLLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 867          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006444.1 (pep scaffold:Pmarinus_7.0:GL477103:5377:54062:-1 gene:ENSPMAG00000005792.1 transcript:ENSPMAT00000006444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 237.269 bits (604), Expect = 3.796e-69
Identity = 125/216 (57.87%), Postives = 162/216 (75.00%), Query Frame = 2
Query:  263 VVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPH 910
            V+   DSFVNSQEWTL R V  LK+GI+G++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+++DG S LLLIRDEGG P+ Q + W D VIFVFSLE E S + V +YY +++S R+ +++P+LLVGTQDAIS SNPRVIDD++AR+++++L R  YYETCATYGLNVER+F DV  +++   K         +S P +P  HTN    + P  H
Sbjct:    1 VLCPADSFVNSQEWTLSRSVPELKVGILGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIIVDGQSYLLLIRDEGGPPEPQFASWVDAVIFVFSLEDEISFQTVYNYYSRLASVRNASELPLLLVGTQDAISASNPRVIDDARARKLSNDLKRCTYYETCATYGLNVERIFQDVAQKIVAMRKKQQLSIGQCKSLPNSPS-HTNMSTGAIPSVH 215          

HSP 2 Score: 80.8777 bits (198), Expect = 4.307e-16
Identity = 51/118 (43.22%), Postives = 77/118 (65.25%), Query Frame = 2
Query: 1397 DP-PTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            DP P    TPT +RK ++R+S+LF          D  K+++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  247 DPLPVSSGTPTPVRKQSKRRSNLF----TSRKGSDTEKEKKSVEAKSDNIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGILTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 359          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009914.1 (pep scaffold:Pmarinus_7.0:GL476634:533628:626389:1 gene:ENSPMAG00000008958.1 transcript:ENSPMAT00000009914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.711 bits (439), Expect = 1.575e-46
Identity = 98/186 (52.69%), Postives = 131/186 (70.43%), Query Frame = 2
Query:  338 GIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQ----DAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKP---SLPLANNIQSRPTTPQVH 874
            GIVG+   GKSALVHR+LTG+Y+++ESPEGGRFKKE+V DG S LLLIRDEG  P +Q + W DGV+ VF+L  E S + V+ Y+QQ+SS  S++++P LLVGTQ    DAI   +PR ++D++ARR+ S L    YYETCATYGLNVERVF +V  R++   K    S+ L   + + P+   +H
Sbjct:    1 GIVGTCGCGKSALVHRFLTGAYVREESPEGGRFKKEMVADGQSLLLLIRDEGAPPTEQFASWLDGVMLVFALSDETSFQSVARYHQQLSSLCSLSELPTLLVGTQVVPADAIGPGSPRTVEDARARRLCSELRIGTYYETCATYGLNVERVFQEVAQRIVATRKKQQLSIGLCKPMVTPPSASALH 186          

HSP 2 Score: 77.0258 bits (188), Expect = 6.490e-15
Identity = 33/65 (50.77%), Postives = 48/65 (73.85%), Query Frame = 2
Query: 1550 RLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            R IP+KQ +L K+SS+ +NK+ K +KYVTL +   LTY+P++ DYM  V GK +DL  T++K+PG
Sbjct:  268 REIPIKQGFLMKRSSSSLNKEWK-KKYVTLCDSGTLTYHPSLQDYMQNVHGKAIDLLRTTVKVPG 331          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006472.1 (pep scaffold:Pmarinus_7.0:GL480358:1874:25019:-1 gene:ENSPMAG00000005839.1 transcript:ENSPMAT00000006472.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 5.330e-19
Identity = 52/118 (44.07%), Postives = 78/118 (66.10%), Query Frame = 2
Query:  512 LSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTP 865
             + W D V+FVFSLE E S + V +YY ++S+ R+M D+P++LVGTQ + S      ++ ++AR+++ +L R  YYETCATYGLNVERVF DV  +++   K S       +S P++P
Sbjct:    1 FAAWMDAVVFVFSLEDEISFQTVYNYYSRLSASRNMADMPIVLVGTQASHSMITWHTVNXARARKLSGDLKRCTYYETCATYGLNVERVFQDVAQKVVAMRKKSQLSVGPCRSLPSSP 118          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004483.1 (pep scaffold:Pmarinus_7.0:GL488409:2831:7637:-1 gene:ENSPMAG00000004086.1 transcript:ENSPMAT00000004483.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 1.237e-17
Identity = 42/87 (48.28%), Postives = 59/87 (67.82%), Query Frame = 2
Query:  653 DAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLD--VCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYP 907
            DAIS +NPRVIDD++AR+++++L R  YYETC+TYGLNVERVF D  V  +++ + K         +S P +P  HT  CV+S+  P
Sbjct:    5 DAISATNPRVIDDTRARKLSNDLKRCTYYETCSTYGLNVERVFQDGAVAQKIVASRKKQQVSIGQCKSLPNSPS-HT--CVSSAAMP 88          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002363.1 (pep scaffold:Pmarinus_7.0:GL476468:219091:252970:1 gene:ENSPMAG00000002151.1 transcript:ENSPMAT00000002363.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 3.600e-13
Identity = 29/62 (46.77%), Postives = 45/62 (72.58%), Query Frame = 2
Query: 1559 PVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            P+ +  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:    1 PISKGVLLKRSGKSLNKEWK-KKYVTLCDNGILTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 61          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Yeast
Match: RSR1 (GTP-binding protein of the Ras superfamily; required for bud site selection, morphological changes in response to mating pheromone, and efficient cell fusion; localized to the plasma membrane; significantly similar to mammalian Rap GTPases [Source:SGD;Acc:S000003384])

HSP 1 Score: 51.2174 bits (121), Expect = 1.740e-7
Identity = 49/176 (27.84%), Postives = 90/176 (51.14%), Query Frame = 2
Query:  332 KLGIVGSVTSGKSALVHRYLTGSYIQDESPE-GGRFKKEVVLDGLSSLLLIRDEGGCPD----KQLSLWSD-GVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQ-DAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLAN 838
            KL ++G+   GKS L  +++ G Y+    P     ++K + +D     L I D  G       ++L + S  G + V+S+   +SLE + +  +Q+   +  + VP++L+G + D I   N RVI   +   ++S  GR  +YET A    NV+ VF+D+  +++ N   S+ + +
Sbjct:    5 KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTIEIDNKVFDLEILDTAGIAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVLRIKDSDRVPMVLIGNKADLI---NERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIRNEMESVAVKD 177          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Nematostella
Match: EDO42956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S052])

HSP 1 Score: 154.451 bits (389), Expect = 3.238e-39
Identity = 99/214 (46.26%), Postives = 140/214 (65.42%), Query Frame = 2
Query:  251 IKEYVVSIEDSFVNSQEWTLPRFVN--VLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAK--PSLPLANNIQSRPTTPQVHTN 880
            ++E V  +E+S +NS E+T  +  +  VLKLG+VGS  SGKS LVHRYLTGS  + ES  G R KKEV+ +G S LLL+RDE G PD Q + W D VIFVFSL+ E S  V+S YY +M+ +R+++DVP+LLV  +D ++D  P++I DS+ R++ ++L + VY E  A  G NV+R+F  +    L+ AK  P L   + +QS PT  +   N
Sbjct:    1 MRELVNGLEESLLNSPEFTATKISSNLVLKLGVVGSSVSGKSFLVHRYLTGSCAKMESFTG-RHKKEVIYEGQSHLLLVRDETGPPDLQFTQWVDAVIFVFSLDDELSYNVISGYYAKMAQYRNISDVPILLVAMKDGVNDEQPKMISDSRIRKLITDLKQCVYMEASALTGNNVDRIF-QIAIEKLIQAKNGPVLTSYDPVQS-PTIREGEAN 211          

HSP 2 Score: 81.6481 bits (200), Expect = 4.977e-16
Identity = 37/65 (56.92%), Postives = 50/65 (76.92%), Query Frame = 2
Query: 1550 RLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            R IP+KQ YL+K+SSN I ++ K +KYVTL +D  L YYPNM+DYM+ V  K ++LK T++KIPG
Sbjct:  271 RAIPIKQGYLYKRSSNSIKQEWK-KKYVTLLDDGSLVYYPNMHDYMDDVHAKVLNLKHTTVKIPG 334          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Nematostella
Match: EDO39047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB93])

HSP 1 Score: 56.6102 bits (135), Expect = 2.820e-9
Identity = 43/165 (26.06%), Postives = 82/165 (49.70%), Query Frame = 2
Query:  332 KLGIVGSVTSGKSALVHRYLTGSYIQDESPE-GGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSD-------GVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRM 802
            KL ++GS   GKSAL  +++ G +++   P     ++K+V +DG   +L I D  G   +Q +   D       G + V+S+  + +   + D  +Q+   +  +DVP++LVG +  + D   RV+   + + +A       + ET A   +NV  +F D+  ++
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGT--EQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEDE--RVVGKDQGQNLAKQFANCTFLETSAKAKINVNEIFYDLVRQI 165          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Nematostella
Match: EDO45827 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV2])

HSP 1 Score: 46.9802 bits (110), Expect = 6.300e-6
Identity = 44/159 (27.67%), Postives = 79/159 (49.69%), Query Frame = 2
Query:  332 KLGIVGSVTSGKSALVHRYLTGSYIQDESP-EGGRFKKEVVLDGLSSLLLIRDEGGCPD-----KQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDV 790
            K+ +VGS   GKSAL  +++   +++D  P +   ++K+ +LDG    + I D  G  D            +G + VFS+ + ES    +++ +Q+   +  + +P LLVG +  ++D   R +   + +  A   G   Y ET A    NV++VF D+
Sbjct:   13 KVIMVGSGGVGKSALTLQFMYEEFVEDYEPTKADSYRKKAILDGEECQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEPESFAATTEFREQILRVKGDDKIPFLLVGNKSDLTD--KRQVTSEEGQSKADEWG-VPYVETSAKTRSNVDKVFFDL 168          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Medaka
Match: agap1 (arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 [Source:NCBI gene;Acc:101165954])

HSP 1 Score: 290.426 bits (742), Expect = 5.927e-87
Identity = 146/252 (57.94%), Postives = 196/252 (77.78%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVT 892
            +IR E+ RFESVHPNIY+IYE+L+ +++     ++++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q +LW D VIFVFSLE E S + V  YY ++++FR+  ++P++LVGTQDAIS +NPRVIDDS+AR++++ L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C T
Sbjct:   12 AIRAEIQRFESVHPNIYSIYELLERVEEP----LLQNQIREHVIAIEDAFVNSQEWTLSRTVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSHLLLIRDEGGPPEAQFALWVDAVIFVFSLEDEISFQTVYHYYNRLANFRNTTELPLVLVGTQDAISSTNPRVIDDSRARKLSNELKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HSSVCTT 258          

HSP 2 Score: 77.7962 bits (190), Expect = 1.898e-14
Identity = 48/117 (41.03%), Postives = 77/117 (65.81%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          +  K+++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE++L  T++K+PG
Sbjct:  296 DVPPATNTPTPVRKQSKRRSNLF----TSRKANEPEKEKKGLEARADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEINLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Medaka
Match: agap1 (arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 [Source:NCBI gene;Acc:101165954])

HSP 1 Score: 290.426 bits (742), Expect = 1.758e-86
Identity = 146/252 (57.94%), Postives = 196/252 (77.78%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVT 892
            +IR E+ RFESVHPNIY+IYE+L+ +++     ++++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q +LW D VIFVFSLE E S + V  YY ++++FR+  ++P++LVGTQDAIS +NPRVIDDS+AR++++ L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C T
Sbjct:   12 AIRAEIQRFESVHPNIYSIYELLERVEEP----LLQNQIREHVIAIEDAFVNSQEWTLSRTVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSHLLLIRDEGGPPEAQFALWVDAVIFVFSLEDEISFQTVYHYYNRLANFRNTTELPLVLVGTQDAISSTNPRVIDDSRARKLSNELKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HSSVCTT 258          

HSP 2 Score: 78.1814 bits (191), Expect = 1.683e-14
Identity = 48/117 (41.03%), Postives = 77/117 (65.81%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          +  K+++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE++L  T++K+PG
Sbjct:  296 DVPPATNTPTPVRKQSKRRSNLF----TSRKANEPEKEKKGLEARADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEINLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Medaka
Match: agap1 (arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 [Source:NCBI gene;Acc:101165954])

HSP 1 Score: 284.648 bits (727), Expect = 2.907e-84
Identity = 146/257 (56.81%), Postives = 196/257 (76.26%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPE-----GGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVT 892
            +IR E+ RFESVHPNIY+IYE+L+ +++     ++++ I+E+V++IED+FVNSQEWTL R V  LK+GIVG++ SGKSALVHRYLTG+Y+Q+ESPE     GGRFKKE+V+DG S LLLIRDEGG P+ Q +LW D VIFVFSLE E S + V  YY ++++FR+  ++P++LVGTQDAIS +NPRVIDDS+AR++++ L R  YYETCATYGLNVERVF DV  +++   K         +S P +P  H++ C T
Sbjct:   12 AIRAEIQRFESVHPNIYSIYELLERVEEP----LLQNQIREHVIAIEDAFVNSQEWTLSRTVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEADVDAGGRFKKEIVVDGQSHLLLIRDEGGPPEAQFALWVDAVIFVFSLEDEISFQTVYHYYNRLANFRNTTELPLVLVGTQDAISSTNPRVIDDSRARKLSNELKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS-HSSVCTT 263          

HSP 2 Score: 78.5666 bits (192), Expect = 1.397e-14
Identity = 48/117 (41.03%), Postives = 77/117 (65.81%), Query Frame = 2
Query: 1397 DPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            D P   +TPT +RK ++R+S+LF          +  K+++  + + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE++L  T++K+PG
Sbjct:  301 DVPPATNTPTPVRKQSKRRSNLF----TSRKANEPEKEKKGLEARADSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEINLLRTTVKVPG 412          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Medaka
Match: agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:NCBI gene;Acc:101174700])

HSP 1 Score: 235.343 bits (599), Expect = 3.018e-65
Identity = 124/212 (58.49%), Postives = 162/212 (76.42%), Query Frame = 2
Query:  275 EDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPH 910
            +DSFVNSQEWTL R V  LK+GIVG+++SGKSALVHRYLTG+Y+Q+ESPEGGRFKKE+V+DG S LLLIRDEGG P+ Q + W D V+FVFSLE E S + V +Y+ ++SS+R+  +VP++LVGTQDAIS +NPRVIDDS+AR+++++L R  YYETC+TYGLNVERVF DV  +++   K         +S P +P  H++    S P  H
Sbjct:  511 QDSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLSSYRNTAEVPMVLVGTQDAISAANPRVIDDSRARKLSNDLKRCTYYETCSTYGLNVERVFQDVAQKIVAMRKKQQLSIGPCKSLPNSPS-HSSVPAASIPSVH 721          

HSP 2 Score: 77.7962 bits (190), Expect = 2.316e-14
Identity = 64/187 (34.22%), Postives = 102/187 (54.55%), Query Frame = 2
Query: 1187 KSLPSPRSNAPQHQHSFESTHVYSEYNMLMSSGSSFIAQPPSLPASSAFDLSIHHRPEKSTASSADGIPKDPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            KSLP+  S++     S  S H+    N   + G +F     S+P++     SI  R  +    +A           +TPT IRK ++R+S++F       ++   ++Q +    + + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL  +  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  701 KSLPNSPSHSSVPAASIPSVHI----NQAANGGGAFSDYSSSVPSTP----SISQREMRIETIAAS----------NTPTPIRKQSKRRSNIF-------TSRKASEQTKSVDSKTDSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCSNGLLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 861          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Medaka
Match: agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:NCBI gene;Acc:101174700])

HSP 1 Score: 223.787 bits (569), Expect = 1.023e-62
Identity = 127/258 (49.22%), Postives = 177/258 (68.60%), Query Frame = 2
Query:  137 SIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPH 910
            +IR E+ RFESVHPNIYAIY++++ +DD      +++ I+E+V+SIEDSFVNSQEWTL R V  LK+     V++   +L H ++     +      GRFKKE+V+DG S LLLIRDEGG P+ Q + W D V+FVFSLE E S + V +Y+ ++SS+R+  +VP++LVGTQDAIS +NPRVIDDS+AR+++++L R  YYETC+TYGLNVERVF DV  +++   K         +S P +P  H++    S P  H
Sbjct:   52 AIRAEIHRFESVHPNIYAIYDLIERIDDL----ALQNQIREHVISIEDSFVNSQEWTLSRSVPELKV-----VSNIFMSLFHSFMDSCQFKS-----GRFKKEIVVDGQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLSSYRNTAEVPMVLVGTQDAISAANPRVIDDSRARKLSNDLKRCTYYETCSTYGLNVERVFQDVAQKIVAMRKKQQLSIGPCKSLPNSPS-HSSVPAASIPSVH 294          

HSP 2 Score: 79.337 bits (194), Expect = 7.008e-15
Identity = 59/187 (31.55%), Postives = 93/187 (49.73%), Query Frame = 2
Query: 1187 KSLPSPRSNAPQHQHSFESTHVYSEYNMLMSSGSSFIAQPPSLPASSAFDLSIHHRPEKSTASSADGIPKDPPTPGSTPTQIRK-TRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 1744
            KSLP+  S++     S  S H+    N   + G +F     S+P++     SI  R  +    +A           +TPT IRK ++R+S++F      +     + +              R IP+KQ  L K+S   +NK+ K +KYVTL  +  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  274 KSLPNSPSHSSVPAASIPSVHI----NQAANGGGAFSDYSSSVPSTP----SISQREMRIETIAAS----------NTPTPIRKQSKRRSNIFTSRKASEQTKSVDSKTDSIGSG-------RAIPIKQGILLKRSGKSLNKEWK-KKYVTLCSNGLLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 434          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Planmine SMEST
Match: SMESG000075717.1 (SMESG000075717.1)

HSP 1 Score: 1026.93 bits (2654), Expect = 0.000e+0
Identity = 580/592 (97.97%), Postives = 586/592 (98.99%), Query Frame = 2
Query:   92 MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPHGAMTQPKRSCSTSNDSNNNFTRTGSYVVSQPQNYXXXXXXXXXXXXXXXXXXXXDNMGPPVRPNESRTRVSQNNTTKFTENLQNSIDYEAYLKSLPSPRSNAPQHQHSFESTHVYSEYNMLMSSGSSFIAQPPSLPASSAFDLSIHHRPEKSTASSADGIPKDPPTPGSTPTQIRKTRRKSHLFKPHXXXXXX--XXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQEHI 1861
            MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIFVFSLEKEESLEVVSDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNI+SRPTTPQVHTNNCVTSSPYPHGAMTQPKRSCSTSNDSNNNFTRTGSYVVSQPQNYPQQPIAKEEEPIPPPLPARPDNMGPPVRPNESRTRVSQ+NTTKFTENLQNSIDYEAYLKSLPSPRSNAPQHQHS ESTHVYSEYNMLMSSGSSFIAQPPSLPASSAFDLSIHHRPEKSTASSADGIPKDPPTPGSTPTQIRKTRRKSHLFKPHSDKDSN   +K +QQQQQQQQINGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLPSTPSATPQQTPFQNMQQMAKSKANSSQ ++
Sbjct:    1 MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIFVFSLEKEESLEVVSDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIRSRPTTPQVHTNNCVTSSPYPHGAMTQPKRSCSTSNDSNNNFTRTGSYVVSQPQNYPQQPIAKEEEPIPPPLPARPDNMGPPVRPNESRTRVSQSNTTKFTENLQNSIDYEAYLKSLPSPRSNAPQHQHSLESTHVYSEYNMLMSSGSSFIAQPPSLPASSAFDLSIHHRPEKSTASSADGIPKDPPTPGSTPTQIRKTRRKSHLFKPHSDKDSNIDKNKQQQQQQQQQQINGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLPSTPSATPQQTPFQNMQQMAKSKANSSQAYL 592          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Planmine SMEST
Match: SMESG000075717.1 (SMESG000075717.1)

HSP 1 Score: 1025.39 bits (2650), Expect = 0.000e+0
Identity = 580/590 (98.31%), Postives = 585/590 (99.15%), Query Frame = 2
Query:   92 MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPHGAMTQPKRSCSTSNDSNNNFTRTGSYVVSQPQNYXXXXXXXXXXXXXXXXXXXXDNMGPPVRPNESRTRVSQNNTTKFTENLQNSIDYEAYLKSLPSPRSNAPQHQHSFESTHVYSEYNMLMSSGSSFIAQPPSLPASSAFDLSIHHRPEKSTASSADGIPKDPPTPGSTPTQIRKTRRKSHLFKPHXXXXXX--XXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQE 1855
            MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIFVFSLEKEESLEVVSDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNI+SRPTTPQVHTNNCVTSSPYPHGAMTQPKRSCSTSNDSNNNFTRTGSYVVSQPQNYPQQPIAKEEEPIPPPLPARPDNMGPPVRPNESRTRVSQ+NTTKFTENLQNSIDYEAYLKSLPSPRSNAPQHQHS ESTHVYSEYNMLMSSGSSFIAQPPSLPASSAFDLSIHHRPEKSTASSADGIPKDPPTPGSTPTQIRKTRRKSHLFKPHSDKDSN   +K +QQQQQQQQINGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLPSTPSATPQQTPFQNMQQMAKSKANSSQ+
Sbjct:    1 MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIFVFSLEKEESLEVVSDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIRSRPTTPQVHTNNCVTSSPYPHGAMTQPKRSCSTSNDSNNNFTRTGSYVVSQPQNYPQQPIAKEEEPIPPPLPARPDNMGPPVRPNESRTRVSQSNTTKFTENLQNSIDYEAYLKSLPSPRSNAPQHQHSLESTHVYSEYNMLMSSGSSFIAQPPSLPASSAFDLSIHHRPEKSTASSADGIPKDPPTPGSTPTQIRKTRRKSHLFKPHSDKDSNIDKNKQQQQQQQQQQINGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLPSTPSATPQQTPFQNMQQMAKSKANSSQD 590          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Planmine SMEST
Match: SMESG000075717.1 (SMESG000075717.1)

HSP 1 Score: 663.685 bits (1711), Expect = 0.000e+0
Identity = 366/397 (92.19%), Postives = 374/397 (94.21%), Query Frame = 2
Query:   92 MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIQSRPTTPQVHTNNCVTSSPYPHGAMTQPKRSCSTSNDSNNNFTRTGSYVVSQPQNYXXXXXXXXXXXXXXXXXXXXDNMGPPVRPNESRTRVSQNNTTKFTENLQNSIDYE---------AYLKSLPSPRSNAPQHQHSFESTHVY 1255
            MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIFVFSLEKEESLEVVSDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNI+SRPTTPQVHTNNCVTSSPYPHGAMTQPKRSCSTSNDSNNNFTRTGSYVVSQPQNYPQQPIAKEEEPIPPPLPARPDNMGPPVRPNESRTRVSQ+NTTKFTENLQNSIDYE            K  P+P S   Q + +   +H++
Sbjct:    1 MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIFVFSLEKEESLEVVSDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANNIRSRPTTPQVHTNNCVTSSPYPHGAMTQPKRSCSTSNDSNNNFTRTGSYVVSQPQNYPQQPIAKEEEPIPPPLPARPDNMGPPVRPNESRTRVSQSNTTKFTENLQNSIDYEEKSTASSADGIPKDPPTPGSTPTQIRKTRRKSHLF 397          

HSP 2 Score: 246.128 bits (627), Expect = 6.415e-70
Identity = 161/168 (95.83%), Postives = 164/168 (97.62%), Query Frame = 2
Query: 1358 EKSTASSADGIPKDPPTPGSTPTQIRKTRRKSHLFKPHXXXXXX--XXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQE 1855
            EKSTASSADGIPKDPPTPGSTPTQIRKTRRKSHLFKPHSDKDSN   +K +QQQQQQQQINGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLPSTPSATPQQTPFQNMQQMAKSKANSSQ+
Sbjct:  363 EKSTASSADGIPKDPPTPGSTPTQIRKTRRKSHLFKPHSDKDSNIDKNKQQQQQQQQQQINGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLPSTPSATPQQTPFQNMQQMAKSKANSSQD 530          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Planmine SMEST
Match: SMESG000018614.1 (SMESG000018614.1)

HSP 1 Score: 235.728 bits (600), Expect = 2.798e-66
Identity = 130/229 (56.77%), Postives = 173/229 (75.55%), Query Frame = 2
Query:  110 KLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSS-LLLIRDEGGC-PDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRS---MNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVF 781
            K +KS   ++I+ E+ RFESVHP IY IY++LD + +  +S      I+E+V  IEDSF+NSQEWTL   ++ ++LG++G+  SGKS+L+HRYLTG+YIQ+E  EGGRFKKEV+LDG  S L++IRD+G   PD Q S W DGVIFVFSLEKEESL V+   + Q+   R+     ++P +LVGTQD IS+SNPRVIDDS+AR++A++L  + YYETCATYGLNVE+VF
Sbjct:   14 KFIKS---KTIKQEINRFESVHPCIYEIYDLLDQISELKIS----SQIREFVHCIEDSFINSQEWTLTHGIHEIRLGVLGASCSGKSSLIHRYLTGTYIQNEYDEGGRFKKEVILDGDDSYLMMIRDDGAEPPDYQFSNWVDGVIFVFSLEKEESLNVLYKLHDQLFKLRNNSVCGELPCILVGTQDYISESNPRVIDDSRARKLAADLKMSAYYETCATYGLNVEKVF 235          

HSP 2 Score: 86.2705 bits (212), Expect = 3.913e-17
Identity = 37/71 (52.11%), Postives = 51/71 (71.83%), Query Frame = 2
Query: 1550 RLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNS 1762
            R IP+KQ  L+K+  ++     + +KYVTLT DA+LTY+PN+NDYM  V GKE+DL   +IKIPG+ YR+ 
Sbjct:  455 RAIPMKQGLLYKRRGDKTLAKERTKKYVTLTSDARLTYHPNLNDYMEDVHGKEIDLSRVTIKIPGIVYRHG 525          
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Planmine SMEST
Match: SMESG000018614.1 (SMESG000018614.1)

HSP 1 Score: 235.728 bits (600), Expect = 4.199e-66
Identity = 130/229 (56.77%), Postives = 173/229 (75.55%), Query Frame = 2
Query:  110 KLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVIKDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYLTGSYIQDESPEGGRFKKEVVLDGLSS-LLLIRDEGGC-PDKQLSLWSDGVIXXXXXXXXXXXXXXXDYYQQMSSFRS---MNDVPVLLVGTQDAISDSNPRVIDDSKARRMASNLGRAVYYETCATYGLNVERVF 781
            K +KS   ++I+ E+ RFESVHP IY IY++LD + +  +S      I+E+V  IEDSF+NSQEWTL   ++ ++LG++G+  SGKS+L+HRYLTG+YIQ+E  EGGRFKKEV+LDG  S L++IRD+G   PD Q S W DGVIFVFSLEKEESL V+   + Q+   R+     ++P +LVGTQD IS+SNPRVIDDS+AR++A++L  + YYETCATYGLNVE+VF
Sbjct:   14 KFIKS---KTIKQEINRFESVHPCIYEIYDLLDQISELKIS----SQIREFVHCIEDSFINSQEWTLTHGIHEIRLGVLGASCSGKSSLIHRYLTGTYIQNEYDEGGRFKKEVILDGDDSYLMMIRDDGAEPPDYQFSNWVDGVIFVFSLEKEESLNVLYKLHDQLFKLRNNSVCGELPCILVGTQDYISESNPRVIDDSRARKLAADLKMSAYYETCATYGLNVEKVF 235          

HSP 2 Score: 95.9005 bits (237), Expect = 3.963e-20
Identity = 49/116 (42.24%), Postives = 66/116 (56.90%), Query Frame = 2
Query: 1415 STPTQIRKTRRKSHLFKPHXXXXXXXXXXXXXXXXXXXXXXXXXXRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNS 1762
             TP Q+RK RR+S LFK      +N                    R IP+KQ  L+K+  ++     + +KYVTLT DA+LTY+PN+NDYM  V GKE+DL   +IKIPG+ YR+ 
Sbjct:  454 GTPNQVRKVRRRSTLFKTEKKTSANGIGVG---------------RAIPMKQGLLYKRRGDKTLAKERTKKYVTLTSDARLTYHPNLNDYMEDVHGKEIDLSRVTIKIPGIVYRHG 554          
The following BLAST results are available for this feature:
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AGAP32.527e-9154.06ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
AGAP37.449e-9154.95ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
AGAP11.853e-9057.60ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
AGAP16.496e-8657.60ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
AGAP11.310e-8557.60ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
back to top
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnt-21.356e-6551.33Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-21.356e-6551.33Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-27.035e-5052.54Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-21.886e-4251.88Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-27.229e-4249.09Arf-GAP with ANK repeat and PH domain-containing p... [more]
back to top
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CenG1A2.054e-9060.07gene:FBgn0028509 transcript:FBtr0080546[more]
CenG1A3.759e-7263.81gene:FBgn0028509 transcript:FBtr0080547[more]
CenG1A7.216e-2756.31gene:FBgn0028509 transcript:FBtr0080548[more]
back to top
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agap11.476e-8557.94ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap12.426e-8356.81ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap34.345e-6558.33ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap17.147e-6458.33ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap25.065e-5446.09ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
back to top
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stmn42.907e-8657.25stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072][more]
stmn43.491e-6758.33stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072][more]
stmn44.098e-6758.33stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072][more]
stmn45.421e-6758.33stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072][more]
stmn48.297e-6758.33stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072][more]
back to top
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Agap39.985e-9154.95ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
Agap11.569e-8557.60ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
Agap12.287e-8557.60ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
Agap32.471e-8554.95ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
Agap32.186e-6859.24ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
back to top
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NGC3|CEG1A_DROME2.059e-8960.07Centaurin-gamma-1A OS=Drosophila melanogaster OX=7... [more]
sp|Q6NRL1|AGAP1_XENLA3.779e-8757.63Arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
sp|Q9UPQ3|AGAP1_HUMAN6.291e-8557.60Arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
sp|Q96P47|AGAP3_HUMAN1.432e-8454.95Arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
sp|Q8BXK8|AGAP1_MOUSE1.600e-8457.60Arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
back to top
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6USK91.033e-10140.65Centaurin-gamma-1A OS=Echinococcus granulosus OX=6... [more]
A0A034VHS81.936e-9263.52Centaurin-gamma-1A (Fragment) OS=Bactrocera dorsal... [more]
A0A0K8VVB86.375e-9263.52Centaurin-gamma-1A (Fragment) OS=Bactrocera latifr... [more]
A0A0A1WDC18.129e-9263.52Centaurin-gamma-1A (Fragment) OS=Zeugodacus cucurb... [more]
A0A2H6NJ521.954e-8956.87Uncharacterized protein (Fragment) OS=Micrurus lem... [more]
back to top
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agap15.659e-8658.40ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap18.669e-6760.29ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap19.767e-6760.29ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap39.728e-6560.41ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap31.060e-6460.41ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
back to top
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006444.13.796e-6957.87pep scaffold:Pmarinus_7.0:GL477103:5377:54062:-1 g... [more]
ENSPMAT00000009914.11.575e-4652.69pep scaffold:Pmarinus_7.0:GL476634:533628:626389:1... [more]
ENSPMAT00000006472.15.330e-1944.07pep scaffold:Pmarinus_7.0:GL480358:1874:25019:-1 g... [more]
ENSPMAT00000004483.11.237e-1748.28pep scaffold:Pmarinus_7.0:GL488409:2831:7637:-1 ge... [more]
ENSPMAT00000002363.13.600e-1346.77pep scaffold:Pmarinus_7.0:GL476468:219091:252970:1... [more]
back to top
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RSR11.740e-727.84GTP-binding protein of the Ras superfamily; requir... [more]
back to top
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO429563.238e-3946.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390472.820e-926.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458276.300e-627.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agap15.927e-8757.94arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
agap11.758e-8657.94arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
agap12.907e-8456.81arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
agap33.018e-6558.49ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap31.023e-6249.22ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
back to top
BLAST of Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075717.10.000e+097.97SMESG000075717.1[more]
SMESG000075717.10.000e+098.31SMESG000075717.1[more]
SMESG000075717.16.415e-7092.19SMESG000075717.1[more]
SMESG000018614.12.798e-6656.77SMESG000018614.1[more]
SMESG000018614.14.199e-6656.77SMESG000018614.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030785 ID=SMED30030785|Name=Arf-GAP with GTPase ANK repeat and PH domain-containing protein 1/3|organism=Schmidtea mediterranea sexual|type=transcript|length=2062bp
TGATATAATTGTAAACATTTGAAATTTAAAATTTCTATTTTTTTATTGCT
ACATTTTCTTAATTATTTTAAGTTAATTAAAATATGATATTATGGCAAGT
AAAAACCCTAAATTATTAAAAAGTGATGCAGCGCAGTCCATTCGAAATGA
AGTATTACGTTTCGAAAGTGTCCATCCAAATATTTACGCGATTTATGAAA
TATTAGATCATTTGGATGATGCAGATGTTAGTCAAGTAATAAAAGATACA
ATTAAAGAATATGTAGTCTCAATTGAAGATAGTTTTGTTAATAGTCAAGA
ATGGACTTTGCCAAGATTTGTTAATGTTTTGAAATTGGGAATTGTTGGAT
CAGTGACAAGTGGAAAATCTGCACTTGTTCATAGATATTTGACTGGGTCA
TATATACAAGACGAATCTCCAGAAGGTGGTCGATTTAAAAAAGAAGTTGT
TTTAGACGGTTTAAGTAGTTTGTTATTAATCCGAGATGAAGGTGGATGCC
CGGACAAACAGTTAAGTTTATGGTCTGACGGTGTGATTTTTGTTTTTAGT
TTGGAAAAGGAAGAGAGCCTGGAAGTTGTCAGTGACTATTATCAACAAAT
GAGCTCTTTTCGAAGCATGAACGATGTTCCAGTGTTACTTGTAGGCACTC
AAGACGCTATAAGTGATAGTAATCCTAGAGTAATAGATGATTCAAAGGCG
CGAAGAATGGCATCTAACTTAGGACGAGCTGTTTACTATGAAACATGTGC
TACGTATGGCTTGAATGTTGAGCGGGTATTTCTCGATGTATGTTCGCGGA
TGCTCCTCAATGCCAAACCCAGTCTTCCTTTAGCCAATAATATTCAGTCT
AGGCCAACAACTCCTCAAGTTCATACAAACAATTGCGTCACCTCATCTCC
ATATCCACATGGCGCAATGACACAACCAAAAAGAAGTTGCAGCACCTCGA
ATGACAGCAACAATAATTTTACTCGAACTGGTAGCTACGTAGTTTCTCAA
CCTCAAAATTATCCACAACAACCCATTGCTAAAGAAGAAGAACCAATTCC
ACCTCCCCTACCAGCTAGACCAGATAACATGGGTCCCCCAGTGAGACCCA
ATGAATCGCGGACTCGTGTGTCACAAAACAACACGACTAAATTCACGGAA
AACCTTCAAAATTCTATTGATTATGAAGCATACCTCAAATCTTTACCTAG
TCCTCGCAGTAATGCACCACAGCATCAACATTCATTCGAATCAACTCATG
TTTACTCAGAATATAATATGCTGATGAGCAGTGGTTCTTCTTTCATCGCA
CAGCCGCCGTCTCTTCCTGCATCTTCCGCTTTCGATTTATCTATTCATCA
TCGCCCAGAAAAGTCAACTGCCAGCAGCGCAGATGGTATACCAAAAGATC
CTCCCACTCCCGGTAGCACTCCAACTCAGATTCGTAAAACTAGAAGAAAG
TCACATTTGTTTAAACCGCATTCAGACAAAGATTCAAACATAGACAAGAA
CAAGCAGCAGCAACAACAACAACAGCAGATAAACGGTATTGGCAGTGGCA
GATTGATTCCAGTAAAGCAGAACTATTTATTCAAGAAATCCAGTAATCAA
ATAAATAAAGACCGGAAAAACCGGAAATATGTCACGTTAACGGAAGATGC
CAAGTTAACATATTATCCAAATATGAATGATTACATGAATCAAGTGAGAG
GCAAAGAAGTTGATCTTAAACTTACCTCAATCAAAATTCCAGGTGTTCCA
TATCGAAACAGCTGCTTACCATCCACTCCAAGTGCTACTCCCCAACAAAC
ACCTTTTCAAAATATGCAACAAATGGCCAAATCGAAAGCAAACAGTTCAC
AAGAACACATTGGTCCTACTCTTGTATCTGATTCCATGACCACTGGTGGG
TTTTTCCCTTCGTGAATGAAAACAAGTCTTTCCCTTCATTTTTTTACTCA
CTGTATTTATGGTGTTTCTAAGTCTGATTTCTTTGGGATTGTTTACAATG
GTGATTTTTAAGTGGTGGTCATTTTACAGACTGGTGGGATAGAGCACGGG
GCTGAAAATGAT
back to top

protein sequence of SMED30030785-orf-1

>SMED30030785-orf-1 ID=SMED30030785-orf-1|Name=SMED30030785-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=608bp
MASKNPKLLKSDAAQSIRNEVLRFESVHPNIYAIYEILDHLDDADVSQVI
KDTIKEYVVSIEDSFVNSQEWTLPRFVNVLKLGIVGSVTSGKSALVHRYL
TGSYIQDESPEGGRFKKEVVLDGLSSLLLIRDEGGCPDKQLSLWSDGVIF
VFSLEKEESLEVVSDYYQQMSSFRSMNDVPVLLVGTQDAISDSNPRVIDD
SKARRMASNLGRAVYYETCATYGLNVERVFLDVCSRMLLNAKPSLPLANN
IQSRPTTPQVHTNNCVTSSPYPHGAMTQPKRSCSTSNDSNNNFTRTGSYV
VSQPQNYPQQPIAKEEEPIPPPLPARPDNMGPPVRPNESRTRVSQNNTTK
FTENLQNSIDYEAYLKSLPSPRSNAPQHQHSFESTHVYSEYNMLMSSGSS
FIAQPPSLPASSAFDLSIHHRPEKSTASSADGIPKDPPTPGSTPTQIRKT
RRKSHLFKPHSDKDSNIDKNKQQQQQQQQINGIGSGRLIPVKQNYLFKKS
SNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIP
GVPYRNSCLPSTPSATPQQTPFQNMQQMAKSKANSSQEHIGPTLVSDSMT
TGGFFPS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0046872metal ion binding
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0005096GTPase activator activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011993PH-like_dom_sf
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0007165signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 80..101
score: 35.61
coord: 215..237
score: 28.84
coord: 177..190
score: 29.07
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 77..240
e-value: 1.1E-7
score: -2.4
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 80..240
e-value: 1.6E-5
score: -40.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 64..242
e-value: 1.7E-52
score: 179.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 331..355
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 470..486
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 338..355
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 421..487
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 568..609
NoneNo IPR availablePANTHERPTHR45819FAMILY NOT NAMEDcoord: 366..574
coord: 11..273
NoneNo IPR availablePANTHERPTHR45819:SF2ARF-GAP WITH GTPASE, ANK REPEAT AND PH DOMAIN-CONTAINING PROTEIN 3coord: 366..574
coord: 11..273
NoneNo IPR availablePROSITEPS51419RABcoord: 68..283
score: 10.961
IPR001806Small GTPasePFAMPF00071Rascoord: 81..237
e-value: 4.0E-15
score: 55.8
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 489..603
e-value: 2.9E-21
score: 78.1
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 78..237