Discoidin domain-containing receptor 2

Overview
NameDiscoidin domain-containing receptor 2
Smed IDSMED30030781
Length (bp)3457
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Discoidin domain-containing receptor 2 (SMED30030781) t-SNE clustered cells

Violin plots show distribution of expression levels for Discoidin domain-containing receptor 2 (SMED30030781) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Discoidin domain-containing receptor 2 (SMED30030781) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Discoidin domain-containing receptor 2 (SMED30030781) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030781

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030781SMESG000051409.1 SmedASXL_004853SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30030781SMESG000051409.1 dd_Smed_v4_22332_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30030781SMESG000051409.1 dd_Smed_v6_30771_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30030781SMESG000051409.1 dd_Smed_v6_22332_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30030781SMESG000051409.1 OX_Smed_1.0.10140ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 169.474 bits (428), Expect = 2.612e-42
Identity = 112/364 (30.77%), Postives = 177/364 (48.63%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLST-ENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSP---ETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G   + +  + +MD      +   + PR     +T  E + +GQ+G+         L     +  ++D+     +S  +   V +  L   ++  AR+ F  EI+I  RL +PNI  +LA+                     C  +  + +  +  E G++ + L+    P  S     T++Y +L F+A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAFGVTLWE  T C +QPY   S+ QV++N       Q  Q  YL +P ICP  +Y ++  CW      RP+F EIH+ L
Sbjct:  524 ADIVNLQGVTGGNTYSVPAV-TMDLLSGKDVAVEEFPR---KLLTFKEKLGEGQFGEVH-------LCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAV---------------------CITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMS-RNLYSGDYYRI----QGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQ-TYLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLL 849          

HSP 2 Score: 102.834 bits (255), Expect = 1.854e-21
Identity = 94/376 (25.00%), Postives = 163/376 (43.35%), Query Frame = 1
Query:  202 MEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPY------FLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRF--GGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVSENLSSSKLKP 1299
            M    +PD+  +ASS +   +   A   RL          E   AWCP          E++++D  +++ I  + T+GR   G+ +EF P  KI Y R+   R   ++    + ++  N++          P I+A  ++  PV  +    +C++  L+GC + D  VSY+   G          I  +D  +DG          +  GLG LTD  + L       + +      ++GW   +A+   YI I FE+++ RNFT +++    + ++ + IF +V   F+S     SE E +     + ++         T+ L H + + +K Q H  +   W++ SEI F S  A  N      SE L +S + P
Sbjct:   36 MSGGQIPDEDITASSQWSESTA--AKYGRL-------DSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD-GTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMN-VCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDG-----AVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATN-GYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEA---SEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADT--WMMFSEITFQSDAAMYN-----NSEALPTSPMAP 384          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 169.474 bits (428), Expect = 2.612e-42
Identity = 112/364 (30.77%), Postives = 177/364 (48.63%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLST-ENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSP---ETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G   + +  + +MD      +   + PR     +T  E + +GQ+G+         L     +  ++D+     +S  +   V +  L   ++  AR+ F  EI+I  RL +PNI  +LA+                     C  +  + +  +  E G++ + L+    P  S     T++Y +L F+A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAFGVTLWE  T C +QPY   S+ QV++N       Q  Q  YL +P ICP  +Y ++  CW      RP+F EIH+ L
Sbjct:  524 ADIVNLQGVTGGNTYSVPAV-TMDLLSGKDVAVEEFPR---KLLTFKEKLGEGQFGEVH-------LCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAV---------------------CITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMS-RNLYSGDYYRI----QGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQ-TYLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLL 849          

HSP 2 Score: 102.834 bits (255), Expect = 1.854e-21
Identity = 94/376 (25.00%), Postives = 163/376 (43.35%), Query Frame = 1
Query:  202 MEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPY------FLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRF--GGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVSENLSSSKLKP 1299
            M    +PD+  +ASS +   +   A   RL          E   AWCP          E++++D  +++ I  + T+GR   G+ +EF P  KI Y R+   R   ++    + ++  N++          P I+A  ++  PV  +    +C++  L+GC + D  VSY+   G          I  +D  +DG          +  GLG LTD  + L       + +      ++GW   +A+   YI I FE+++ RNFT +++    + ++ + IF +V   F+S     SE E +     + ++         T+ L H + + +K Q H  +   W++ SEI F S  A  N      SE L +S + P
Sbjct:   36 MSGGQIPDEDITASSQWSESTA--AKYGRL-------DSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD-GTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMN-VCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDG-----AVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATN-GYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEA---SEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADT--WMMFSEITFQSDAAMYN-----NSEALPTSPMAP 384          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 169.474 bits (428), Expect = 2.612e-42
Identity = 112/364 (30.77%), Postives = 177/364 (48.63%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLST-ENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSP---ETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G   + +  + +MD      +   + PR     +T  E + +GQ+G+         L     +  ++D+     +S  +   V +  L   ++  AR+ F  EI+I  RL +PNI  +LA+                     C  +  + +  +  E G++ + L+    P  S     T++Y +L F+A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAFGVTLWE  T C +QPY   S+ QV++N       Q  Q  YL +P ICP  +Y ++  CW      RP+F EIH+ L
Sbjct:  524 ADIVNLQGVTGGNTYSVPAV-TMDLLSGKDVAVEEFPR---KLLTFKEKLGEGQFGEVH-------LCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAV---------------------CITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMS-RNLYSGDYYRI----QGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQ-TYLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLL 849          

HSP 2 Score: 102.834 bits (255), Expect = 1.854e-21
Identity = 94/376 (25.00%), Postives = 163/376 (43.35%), Query Frame = 1
Query:  202 MEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPY------FLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRF--GGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVSENLSSSKLKP 1299
            M    +PD+  +ASS +   +   A   RL          E   AWCP          E++++D  +++ I  + T+GR   G+ +EF P  KI Y R+   R   ++    + ++  N++          P I+A  ++  PV  +    +C++  L+GC + D  VSY+   G          I  +D  +DG          +  GLG LTD  + L       + +      ++GW   +A+   YI I FE+++ RNFT +++    + ++ + IF +V   F+S     SE E +     + ++         T+ L H + + +K Q H  +   W++ SEI F S  A  N      SE L +S + P
Sbjct:   36 MSGGQIPDEDITASSQWSESTA--AKYGRL-------DSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD-GTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMN-VCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDG-----AVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATN-GYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEA---SEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADT--WMMFSEITFQSDAAMYN-----NSEALPTSPMAP 384          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR1 (discoidin domain receptor tyrosine kinase 1 [Source:HGNC Symbol;Acc:HGNC:2730])

HSP 1 Score: 159.073 bits (401), Expect = 1.319e-41
Identity = 113/358 (31.56%), Postives = 173/358 (48.32%), Query Frame = 1
Query: 2398 PMGLIDTKLPRLQM--SSITTAELISQGQYGQNKKAILNE-----SLIRSRNLSGYRDEILNRKL----STENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAI---------VTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCI 3411
            P G +    PR+    S +   E + +GQ+G+     ++      SL    N+      ++  K+    +T+N +  L S ND         F  E++I  RL +PNI  +L +         +TD +E   G LN         F++ H     Q  +K     P    A   Q P T++Y  L+ +A+QIASGM+++     +HRDLA R+C+V  N  +KI + G    + +  DY  +         LPIRWMA E +   KF++ SDVWAFGVTLWEVL  C  QP+   ++ QV++N       Q  Q  YL+RP  CP+ +Y+++  CW    + RP F ++H FL    +
Sbjct:   51 PPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNASFSLFSRND---------FLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMEN--GDLNQ--------FLSAH-----QLEDKAAEGAPGDGQAA--QGP-TISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMS-RNLYAGDYYRV----QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQV-YLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL 375          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR1 (discoidin domain receptor tyrosine kinase 1 [Source:HGNC Symbol;Acc:HGNC:2730])

HSP 1 Score: 159.073 bits (401), Expect = 1.319e-41
Identity = 113/358 (31.56%), Postives = 173/358 (48.32%), Query Frame = 1
Query: 2398 PMGLIDTKLPRLQM--SSITTAELISQGQYGQNKKAILNE-----SLIRSRNLSGYRDEILNRKL----STENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAI---------VTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCI 3411
            P G +    PR+    S +   E + +GQ+G+     ++      SL    N+      ++  K+    +T+N +  L S ND         F  E++I  RL +PNI  +L +         +TD +E   G LN         F++ H     Q  +K     P    A   Q P T++Y  L+ +A+QIASGM+++     +HRDLA R+C+V  N  +KI + G    + +  DY  +         LPIRWMA E +   KF++ SDVWAFGVTLWEVL  C  QP+   ++ QV++N       Q  Q  YL+RP  CP+ +Y+++  CW    + RP F ++H FL    +
Sbjct:   51 PPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNASFSLFSRND---------FLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMEN--GDLNQ--------FLSAH-----QLEDKAAEGAPGDGQAA--QGP-TISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMS-RNLYAGDYYRV----QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQV-YLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL 375          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 138.272 bits (347), Expect = 4.240e-33
Identity = 89/329 (27.05%), Postives = 156/329 (47.42%), Query Frame = 1
Query: 2416 TKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIY-DMIRECWHPTEDYRPNFHEIHMFLQ 3399
            T LP +    +     I QG++G+     L                        EN  V +  L+  S ++  S F+ EI++   L +PN+  ++ +                     C +   +   ++  E G++       +Y  ++P T+     I I +Q+A+G+ ++E    +HRD+A R+C+V+    VKI + G    S +  +Y  +         LPIRWMA E+L   KFS+ SDVW FGVT+WE+ + C+++PY   ++  V++NL + + +  S    L+RP++CP ++Y + I  CW+     RP+F  +H+ LQ
Sbjct:  487 TTLPEIARDKLICVSRIGQGEFGEVDLCQL------------------------ENRKVAVKKLHGISQADEFS-FHREIRVLGSLKHPNVVEVVGV---------------------CTIQKPILCIMEYMENGDLK------SYILKNP-TIQTSQCISICTQLAAGLAYLESCNFVHRDIAARNCLVDGEGNVKIADFG-MARSLYSQEYYKVE----GKFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYSDMTDDDVVENLQS-MSSTGSLKQVLSRPRMCPSKLYNEQILPCWNYESSRRPSFENVHLHLQ 756          

HSP 2 Score: 89.7373 bits (221), Expect = 6.639e-18
Identity = 95/343 (27.70%), Postives = 150/343 (43.73%), Query Frame = 1
Query:  223 DDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGV------IFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVS 1230
            D++ SASSSF  +ST   H        R++ +  +G AWCP  + +S   EW+++ F    VI  + T+GR  +G  +E+    KI Y R        Y+       IP N D     R     AIIA  I+I PV     + +C++  +FGC F DS V Y+   GD  S     GI+  D  +DG+         L  G+G L D      ++  +    ++GW          + ++FE+ + RN + + I        T + F K    F S T L S   KD S   V  N              + +++ +  + K++L+    + W+ +SE+NF S
Sbjct:    8 DEQISASSSFDLQSTGPQHA-------RAHQESGSG-AWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSN-STRTVCMRVEVFGCPFDDSLVFYNVDQGDLQS-----GISYHDFSYDGNLANSPH---LTGGIGKLYDGEVGKNNV-FVNHHKWVGWRRKRNGN---VKLAFEFSELRNISGILI-------HTSNEFKKSAKAFSSATVLFSINGKDFSDTIVHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFES 322          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 138.272 bits (347), Expect = 4.240e-33
Identity = 89/329 (27.05%), Postives = 156/329 (47.42%), Query Frame = 1
Query: 2416 TKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIY-DMIRECWHPTEDYRPNFHEIHMFLQ 3399
            T LP +    +     I QG++G+     L                        EN  V +  L+  S ++  S F+ EI++   L +PN+  ++ +                     C +   +   ++  E G++       +Y  ++P T+     I I +Q+A+G+ ++E    +HRD+A R+C+V+    VKI + G    S +  +Y  +         LPIRWMA E+L   KFS+ SDVW FGVT+WE+ + C+++PY   ++  V++NL + + +  S    L+RP++CP ++Y + I  CW+     RP+F  +H+ LQ
Sbjct:  487 TTLPEIARDKLICVSRIGQGEFGEVDLCQL------------------------ENRKVAVKKLHGISQADEFS-FHREIRVLGSLKHPNVVEVVGV---------------------CTIQKPILCIMEYMENGDLK------SYILKNP-TIQTSQCISICTQLAAGLAYLESCNFVHRDIAARNCLVDGEGNVKIADFG-MARSLYSQEYYKVE----GKFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYSDMTDDDVVENLQS-MSSTGSLKQVLSRPRMCPSKLYNEQILPCWNYESSRRPSFENVHLHLQ 756          

HSP 2 Score: 89.7373 bits (221), Expect = 6.639e-18
Identity = 95/343 (27.70%), Postives = 150/343 (43.73%), Query Frame = 1
Query:  223 DDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGV------IFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVS 1230
            D++ SASSSF  +ST   H        R++ +  +G AWCP  + +S   EW+++ F    VI  + T+GR  +G  +E+    KI Y R        Y+       IP N D     R     AIIA  I+I PV     + +C++  +FGC F DS V Y+   GD  S     GI+  D  +DG+         L  G+G L D      ++  +    ++GW          + ++FE+ + RN + + I        T + F K    F S T L S   KD S   V  N              + +++ +  + K++L+    + W+ +SE+NF S
Sbjct:    8 DEQISASSSFDLQSTGPQHA-------RAHQESGSG-AWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSN-STRTVCMRVEVFGCPFDDSLVFYNVDQGDLQS-----GISYHDFSYDGNLANSPH---LTGGIGKLYDGEVGKNNV-FVNHHKWVGWRRKRNGN---VKLAFEFSELRNISGILI-------HTSNEFKKSAKAFSSATVLFSINGKDFSDTIVHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFES 322          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 138.272 bits (347), Expect = 4.946e-33
Identity = 89/329 (27.05%), Postives = 156/329 (47.42%), Query Frame = 1
Query: 2416 TKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIY-DMIRECWHPTEDYRPNFHEIHMFLQ 3399
            T LP +    +     I QG++G+     L                        EN  V +  L+  S ++  S F+ EI++   L +PN+  ++ +                     C +   +   ++  E G++       +Y  ++P T+     I I +Q+A+G+ ++E    +HRD+A R+C+V+    VKI + G    S +  +Y  +         LPIRWMA E+L   KFS+ SDVW FGVT+WE+ + C+++PY   ++  V++NL + + +  S    L+RP++CP ++Y + I  CW+     RP+F  +H+ LQ
Sbjct:  517 TTLPEIARDKLICVSRIGQGEFGEVDLCQL------------------------ENRKVAVKKLHGISQADEFS-FHREIRVLGSLKHPNVVEVVGV---------------------CTIQKPILCIMEYMENGDLK------SYILKNP-TIQTSQCISICTQLAAGLAYLESCNFVHRDIAARNCLVDGEGNVKIADFG-MARSLYSQEYYKVE----GKFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYSDMTDDDVVENLQS-MSSTGSLKQVLSRPRMCPSKLYNEQILPCWNYESSRRPSFENVHLHLQ 786          

HSP 2 Score: 89.7373 bits (221), Expect = 7.066e-18
Identity = 95/343 (27.70%), Postives = 150/343 (43.73%), Query Frame = 1
Query:  223 DDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGV------IFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVS 1230
            D++ SASSSF  +ST   H        R++ +  +G AWCP  + +S   EW+++ F    VI  + T+GR  +G  +E+    KI Y R        Y+       IP N D     R     AIIA  I+I PV     + +C++  +FGC F DS V Y+   GD  S     GI+  D  +DG+         L  G+G L D      ++  +    ++GW          + ++FE+ + RN + + I        T + F K    F S T L S   KD S   V  N              + +++ +  + K++L+    + W+ +SE+NF S
Sbjct:   38 DEQISASSSFDLQSTGPQHA-------RAHQESGSG-AWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSN-STRTVCMRVEVFGCPFDDSLVFYNVDQGDLQS-----GISYHDFSYDGNLANSPH---LTGGIGKLYDGEVGKNNV-FVNHHKWVGWRRKRNGN---VKLAFEFSELRNISGILI-------HTSNEFKKSAKAFSSATVLFSINGKDFSDTIVHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFES 352          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 127.487 bits (319), Expect = 1.033e-29
Identity = 90/325 (27.69%), Postives = 152/325 (46.77%), Query Frame = 1
Query: 2440 SSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAI--VTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIH---LPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQ 3399
            S ++  E I +GQ+G     I    L     ++          ++ + C       +D +++E R++   EI+      +PN+  ++ +  + +S+   F  + H          +LH  ++++          +T+    F           ++IA+QIA GM+++     +HRDLA R+C+V     +KI + G   +S +  DY       Y  +H   +P+RWM+ E++   +FS  SDVW+FGVTLWE+ +   +QPY   SN QV++ + N         H L  P  CP  IY ++ ECWH   + RP F EI   LQ
Sbjct:  429 SQLSVREKIGEGQFGVVHSGIYTSGLFAPEPMA----------VAVKKCR------HDATNAE-RAQLEQEIRAVATFDHPNVIKLIGVCYMDNSLLAVFEYMVHG---------DLHELLKVRVPPADHDMGGITEANAEF-----------LYIATQIALGMEYLASMSFVHRDLATRNCLVGDTRTIKIADFGLMRTS-YGSDY-------YKMLHRSWMPVRWMSKEAIEQGRFSEASDVWSFGVTLWEIWSF-GRQPYEGASNQQVIELVAN--------RHLLECPHNCPTNIYSLMVECWHENIERRPTFSEIRSRLQ 699          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 127.872 bits (320), Expect = 1.143e-29
Identity = 90/325 (27.69%), Postives = 152/325 (46.77%), Query Frame = 1
Query: 2440 SSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAI--VTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIH---LPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQ 3399
            S ++  E I +GQ+G     I    L     ++          ++ + C       +D +++E R++   EI+      +PN+  ++ +  + +S+   F  + H          +LH  ++++          +T+    F           ++IA+QIA GM+++     +HRDLA R+C+V     +KI + G   +S +  DY       Y  +H   +P+RWM+ E++   +FS  SDVW+FGVTLWE+ +   +QPY   SN QV++ + N         H L  P  CP  IY ++ ECWH   + RP F EI   LQ
Sbjct:  588 SQLSVREKIGEGQFGVVHSGIYTSGLFAPEPMA----------VAVKKCR------HDATNAE-RAQLEQEIRAVATFDHPNVIKLIGVCYMDNSLLAVFEYMVHG---------DLHELLKVRVPPADHDMGGITEANAEF-----------LYIATQIALGMEYLASMSFVHRDLATRNCLVGDTRTIKIADFGLMRTS-YGSDY-------YKMLHRSWMPVRWMSKEAIEQGRFSEASDVWSFGVTLWEIWSF-GRQPYEGASNQQVIELVAN--------RHLLECPHNCPTNIYSLMVECWHENIERRPTFSEIRSRLQ 858          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Ddr (gene:FBgn0053531 transcript:FBtr0344771)

HSP 1 Score: 177.178 bits (448), Expect = 8.360e-45
Identity = 99/283 (34.98%), Postives = 165/283 (58.30%), Query Frame = 1
Query: 2590 VILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAIL-AIVTDS---VEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQIS-SPFDVDYLSIP-LSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFH-YLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGY 3417
            V + +L   ++   R +F ++ +   +LS+PN+A ++ A + D    +  D+          + C  +L+ +++    E   +            + ++L++G L++IA+QIASGMKH+E+   +HRDLA RSC++   L VK+ + G  I+ S +  DY  +   +   S  +PIRWMA ES+   KF++KSDVW+F V LWE+LT   +QPY + S+  V++N+   L+ ++ + H  L  P  CP+EIYD++ ECW   E  RP+F EIH++LQRK +G+
Sbjct:  786 VAVATLRPGANDHLRKEFRSKAKQLAQLSDPNVARLVGACLRDEPICIVQDY----------SHCLGDLNQFLQEHVAETSGL-----------MAKKSLSFGCLVYIATQIASGMKHLEQMNFVHRDLATRSCIIGPELCVKVCSIGTVINRSAYASDYCQLEGFTGRQSQPMPIRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAREQPYEHLSDKSVIENIG--LIYRDYKMHELLPMPPNCPREIYDLMCECWQRDESSRPSFREIHLYLQRKNLGF 1045          

HSP 2 Score: 122.479 bits (306), Expect = 8.543e-28
Identity = 106/451 (23.50%), Postives = 196/451 (43.46%), Query Frame = 1
Query:  202 MEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRA----WLGSLEGLRDPY-FLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIF------TMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVSENLSSSKLKPNIQKRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDTTL--TVATISGLILLVIFISIIAVIFYKMKQKR 1512
            ME   + D + +ASS+  +        ARL           NG AWCP    S    E+++VD   +++++ I T+GR G+G   E+     I Y R    +   +++++ + ++P N +  ++      P++ AS +++YP   YD + +C++  + GC + +  VSYS   G      + + I  SD+ +DG +   +      NGLG L D +     +   + GL   Y ++GW        P + I FE+E  RN + + I +  + S+ + +F    + F           +  S   VQ +    ++       T+ L H +G  V  QLH     RW+++SEI F+S+    NF     +    S   +  +Q+    E+ R +            +         E +T+    + T+ G I++ + ++ I +I  + K  R
Sbjct:  112 MESGAIADFQITASSA-HDMGNVGPQHARLKI-------DNNGGAWCPKHMVSRGLTEYLQVDLLGVHLVSAIRTQGRFGKGQGQEYTEAYVIEYWRPGLKKWIRWRSLQGKEVLPGNINTYSEVENVLQPSVFASKVRLYPYSQYD-RTVCLRAEIVGCAWEEGIVSYSIPKG----MQRGMDIDLSDKTYDGYEEGDH----YVNGLGQLVDGQRGKDNFRADINGLGKGYEWIGWRNDTLLGRP-VEIIFEFETVRNLSAVIIHTNNMFSKDVQVFVHAKVFFSIGG-------RHFSGEPVQFSYMPDLVLDHARDVTIKLHHRLGRYV--QLHLYFAARWMMISEITFISAPVVGNFTDELANGEKQSVTSEYPLQR---DEVGRAISSGGERSQHTTQVISPKPIDHQEPETSFVGVIITVLGTIIM-LLVAFILLIVARNKHVR 531          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Ddr (gene:FBgn0053531 transcript:FBtr0344770)

HSP 1 Score: 177.178 bits (448), Expect = 8.360e-45
Identity = 99/283 (34.98%), Postives = 165/283 (58.30%), Query Frame = 1
Query: 2590 VILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAIL-AIVTDS---VEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQIS-SPFDVDYLSIP-LSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFH-YLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGY 3417
            V + +L   ++   R +F ++ +   +LS+PN+A ++ A + D    +  D+          + C  +L+ +++    E   +            + ++L++G L++IA+QIASGMKH+E+   +HRDLA RSC++   L VK+ + G  I+ S +  DY  +   +   S  +PIRWMA ES+   KF++KSDVW+F V LWE+LT   +QPY + S+  V++N+   L+ ++ + H  L  P  CP+EIYD++ ECW   E  RP+F EIH++LQRK +G+
Sbjct:  786 VAVATLRPGANDHLRKEFRSKAKQLAQLSDPNVARLVGACLRDEPICIVQDY----------SHCLGDLNQFLQEHVAETSGL-----------MAKKSLSFGCLVYIATQIASGMKHLEQMNFVHRDLATRSCIIGPELCVKVCSIGTVINRSAYASDYCQLEGFTGRQSQPMPIRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAREQPYEHLSDKSVIENIG--LIYRDYKMHELLPMPPNCPREIYDLMCECWQRDESSRPSFREIHLYLQRKNLGF 1045          

HSP 2 Score: 122.479 bits (306), Expect = 8.543e-28
Identity = 106/451 (23.50%), Postives = 196/451 (43.46%), Query Frame = 1
Query:  202 MEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRA----WLGSLEGLRDPY-FLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIF------TMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVSENLSSSKLKPNIQKRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDTTL--TVATISGLILLVIFISIIAVIFYKMKQKR 1512
            ME   + D + +ASS+  +        ARL           NG AWCP    S    E+++VD   +++++ I T+GR G+G   E+     I Y R    +   +++++ + ++P N +  ++      P++ AS +++YP   YD + +C++  + GC + +  VSYS   G      + + I  SD+ +DG +   +      NGLG L D +     +   + GL   Y ++GW        P + I FE+E  RN + + I +  + S+ + +F    + F           +  S   VQ +    ++       T+ L H +G  V  QLH     RW+++SEI F+S+    NF     +    S   +  +Q+    E+ R +            +         E +T+    + T+ G I++ + ++ I +I  + K  R
Sbjct:  112 MESGAIADFQITASSA-HDMGNVGPQHARLKI-------DNNGGAWCPKHMVSRGLTEYLQVDLLGVHLVSAIRTQGRFGKGQGQEYTEAYVIEYWRPGLKKWIRWRSLQGKEVLPGNINTYSEVENVLQPSVFASKVRLYPYSQYD-RTVCLRAEIVGCAWEEGIVSYSIPKG----MQRGMDIDLSDKTYDGYEEGDH----YVNGLGQLVDGQRGKDNFRADINGLGKGYEWIGWRNDTLLGRP-VEIIFEFETVRNLSAVIIHTNNMFSKDVQVFVHAKVFFSIGG-------RHFSGEPVQFSYMPDLVLDHARDVTIKLHHRLGRYV--QLHLYFAARWMMISEITFISAPVVGNFTDELANGEKQSVTSEYPLQR---DEVGRAISSGGERSQHTTQVISPKPIDHQEPETSFVGVIITVLGTIIM-LLVAFILLIVARNKHVR 531          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Ror (gene:FBgn0010407 transcript:FBtr0079978)

HSP 1 Score: 128.257 bits (321), Expect = 6.767e-30
Identity = 93/304 (30.59%), Postives = 152/304 (50.00%), Query Frame = 1
Query: 2542 YRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFM---NLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIH----LPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGYFNTEN 3432
            Y+ ++L    +T   TV + +L + +S + +  F  EI++   L + NI  IL +V          LN +   +   +M   +LH ++   +  +G+                +L+    + IA QI+ GM+++     +HRDLA R+C+VN  L VKI++ G         D  S   SDY  +     LP+RWM  ES+   KF+++SDVW+FGV LWE+ ++   QPYY +SN +V++      L ++ Q   L+ P+ CP  +Y ++ ECWH     RP F +I   L+    G+F   N
Sbjct:  425 YKGQLLQPNKTT--ITVAIKALKENASVKTQQDFKREIELISDLKHQNIVCILGVV----------LNKEPYCMLFEYMANGDLHEFLISNSPTEGK----------------SLSQLEFLQIALQISEGMQYLSAHHYVHRDLAARNCLVNEGLVVKISDFG------LSRDIYS---SDYYRVQSKSLLPVRWMPSESILYGKFTTESDVWSFGVVLWEIYSY-GMQPYYGFSNQEVIN------LIRSRQL--LSAPENCPTAVYSLMIECWHEQSVKRPTFTDISNRLKTWHEGHFKASN 682          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Abl (gene:FBgn0000017 transcript:FBtr0330136)

HSP 1 Score: 127.487 bits (319), Expect = 3.709e-29
Identity = 68/177 (38.42%), Postives = 102/177 (57.63%), Query Frame = 1
Query: 2869 ETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQ 3399
            ETL+  +L+++A+QIASGM ++E +  +HRDLA R+C+V  N  VK+ + G  ++     D  +     +     PI+W APE L   KFS+KSDVWAFGV LWE+ T+    PY        + ++Y+ L     + + + RP  CP E+YD++R+CW      RP F  IH  L+
Sbjct:  480 ETLDAVALLYMATQIASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFG--LARLMRDDTYTA----HAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATY-GMSPYPAID----LTDVYHKL----DKGYRMERPPGCPPEVYDLMRQCWQWDATDRPTFKSIHHALE 641          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Abl (gene:FBgn0000017 transcript:FBtr0345369)

HSP 1 Score: 127.487 bits (319), Expect = 3.719e-29
Identity = 68/177 (38.42%), Postives = 102/177 (57.63%), Query Frame = 1
Query: 2869 ETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQ 3399
            ETL+  +L+++A+QIASGM ++E +  +HRDLA R+C+V  N  VK+ + G  ++     D  +     +     PI+W APE L   KFS+KSDVWAFGV LWE+ T+    PY        + ++Y+ L     + + + RP  CP E+YD++R+CW      RP F  IH  L+
Sbjct:  462 ETLDAVALLYMATQIASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFG--LARLMRDDTYTA----HAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATY-GMSPYPAID----LTDVYHKL----DKGYRMERPPGCPPEVYDLMRQCWQWDATDRPTFKSIHHALE 623          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr2b (discoidin domain receptor tyrosine kinase 2b [Source:ZFIN;Acc:ZDB-GENE-060503-361])

HSP 1 Score: 171.4 bits (433), Expect = 3.829e-43
Identity = 116/329 (35.26%), Postives = 169/329 (51.37%), Query Frame = 1
Query: 2413 DTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMN--LHVYI-RLQTTEKGEITKPLTDCAYPFQSPET-LNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIH 3387
            D  L       +T  E + +GQ+G+     L E+      +  + D+I       +   V + +L + +   AR+ F  EI+I  RL +PNI  +LA+  +S        +  C  ITE   N  L+ ++ R Q  E G             Q+  T ++YG+LI +ASQI+SGMK++     +HRDLA R+C+V MN  +KI + G    + +  DY  I         LPIRWM+ ES+   KF+  SDVWAFGVTLWE+LT C +QPY  +++ QV++N       QN Q  YL RP  CP+ +Y ++  CW      RP F EIH
Sbjct:  544 DGALEEFPRDRLTFKEKLGEGQFGE---VHLCEAEGMQEFMKDHCDDI-----CVDPMLVAVKTLREDADKNARNDFMKEIRIISRLRDPNIIRLLAVCVES--------DPLC-MITEYMENGDLNQFLSRHQLQEDG------------VQADSTSISYGTLINMASQISSGMKYLSSLNFVHRDLATRNCLVGMNNIIKIADFGMS-RNLYRGDYYRIQ----GRAVLPIRWMSWESILLGKFTMASDVWAFGVTLWEILTLCKEQPYAQFTDEQVIENTGEFFRDQNKQV-YLLRPACCPESLYSLMLNCWRRNAKERPTFLEIH 837          

HSP 2 Score: 95.9005 bits (237), Expect = 1.533e-19
Identity = 93/365 (25.48%), Postives = 168/365 (46.03%), Query Frame = 1
Query:  217 LPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSH-FNEWIEVDFKSINVINGIFTKGR---GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPV-DPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLE-----GLRDPY-FLGWYVSNAS-PIPYIPISFEYEKRRNFTKL-------QIFSYQLPSQTIDIFSKVNLKFQSNTKLESE--IEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAEN 1248
            + D+  SASS +   +   A   RL +        +   AWCP   A +H   E++++D ++++ +  + T+GR   G GN  EF    +I Y R+   R   ++  + + +I  N++A         P IIA  ++  PV DP  + ++C++  L+GC++ D  VSYS   G  M+  +   I  +D  +DG          +  GLG LTD    L         G+   Y ++GW  +NAS P   + ++FE+++ RNFT +       Q+    + +  + +F +    F+S+   E      K  + +     RF     T+ L + + + ++ +   +++  W++ SEI F S  A  N
Sbjct:   37 IQDEDISASSQWSESTA--ARYGRLDF-------DDGDGAWCPDVMAEAHSLKEFLQIDLRTLHFVTLVGTQGRHADGVGN--EFAQRYRIKYSRD-GTRWVSWRDRQGRQIIEGNSNAYDIVLKDLEPPIIARFVRFMPVTDP--SMIVCMRVELYGCEWLDGLVSYSAPAGQQMT-FRGQQIYLNDTVYDG-----AVSSSMAEGLGQLTDGSWGLDDFTKSQVYGVWPGYDYVGW--TNASLPGGSVEMTFEFDRVRNFTSMKINLLVQQVHCNNMYAWGVKMFRQAVCSFRSDADWEPNPVFFKPKADSISPSARF----ITVALGNRMASAIRCRFAFSDI--WMMFSEIAFQSDTAVYN 373          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr2a (discoidin domain receptor tyrosine kinase 2a [Source:ZFIN;Acc:ZDB-GENE-090316-2])

HSP 1 Score: 170.629 bits (431), Expect = 6.864e-43
Identity = 113/330 (34.24%), Postives = 167/330 (50.61%), Query Frame = 1
Query: 2413 DTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILT--SLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            D  +       +T  E + +GQ+G+         L  +  +  + D+  +  + TEN TV++    L   ++  AR+ F  EI+I  RL +PNI  +LA+   S        +  C  ITE   N  +   L   E   +   L++         T++Y +L  +ASQIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAFGVTLWE+LT C +QPY   S+ QV++N       Q  Q  YL +P +CP  +Y ++  CWH     RP+F EIH  L
Sbjct:  564 DVAVEEFSRKLLTFKEKLGEGQFGEVH-------LCEAEGMQDFMDKDFSFDV-TENQTVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCMSS--------DPLC-MITEYMENGDLNQFLSRHEPEGMIALLSNAP-------TVSYSNLHHMASQIASGMKYLSSLNFVHRDLATRNCLVGKNFTIKIADFGMS-RNLYSGDYYRI----QGRAVLPIRWMSWESILLGKFTTSSDVWAFGVTLWEMLTFCKEQPYSQLSDEQVIENTGEFFRDQRRQI-YLPQPPMCPDPVYKLMLSCWHRNTKERPSFQEIHHTL 863          

HSP 2 Score: 105.531 bits (262), Expect = 1.535e-22
Identity = 92/325 (28.31%), Postives = 153/325 (47.08%), Query Frame = 1
Query:  322 ENGNAWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGRGEGNFV-EFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPY-------FLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLE------SEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAEN 1248
            E   AWCP   A   +  E++++D +S++ I  + T+GR  G    EF  T KI Y R+   R   ++  + + +I  N +A         P IIA  ++  PV   D  M +C++  L+GC++ D  VSY++  G  MS +    I  +D  +DG          +  GLG LTD    L     L   Y       ++GW  + + P  Y+ I FE+++ RNFT +++    + S+ +  F KV   F+S    E      S +  DV+ +     RF     T+ L +++ + +K Q + +++  W++ SEI F S  A  N
Sbjct:   75 EGDGAWCPEIPAEPENMKEFLQIDLRSLHFITLVGTQGRHAGGIGNEFAQTYKIKYSRD-GSRWISWRNRQGKEVIEGNRNAYDIVLKDLEPPIIARFVRFMPV--IDHSMNVCMRVELYGCEWLDGLVSYNSPLGQQMSLNGQ-HIYLNDSVYDGAM-----SYSMTEGLGQLTDGMCGLDDFT-LSHVYNVWPGYDYVGW-TNESFPNGYVEIMFEFDRTRNFTTMKVHCNNMFSRRVKTFQKVVCYFRSELDWEATPVSFSPVMDDVNPS----ARF----VTVSLYNHMASAIKCQYYFSDI--WMMFSEITFQSDTAMYN 378          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060323-2])

HSP 1 Score: 165.622 bits (418), Expect = 3.423e-41
Identity = 116/370 (31.35%), Postives = 180/370 (48.65%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEIT-----KPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDY-LSIPLSDYTSIH----LPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G+  + +  + +  T  P       LP L    +   E + +GQ+G+     +       ++L+        RK       V +  L   +S  AR+ F  E++I  RL +PNI  +L +   S        +  C  +TE +M           E G++      + L D + P Q+  T++Y +LI +ASQIASGMK +     +HRDLA R+C+V          GG +     D     ++   DY  I     LPIRWMA E +   KF++ SDVWAFGVTLWE+L+ C +QPY + ++ QV+DN       Q  Q  YL+RP +CP+ +Y+++  CW+     RP+F  IH FL
Sbjct:  577 ADIISLQGVSGNNTYAVPALSATPTDCP------PLPELPRERLVFKEKLGEGQFGEVHLCEIENP----QDLANLEFPFNVRK--GRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIRLLGVCVSS--------DPLC-MVTE-YM-----------ESGDLNQYLSHRVLLDKSGPSQNTPTISYPALISMASQIASGMKFLASLNFVHRDLATRNCLVGGERGESEERGGERHIKIADFGMSRNLYAGDYYRIQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSHMTDEQVIDNAGEFFRDQGRQV-YLSRPAVCPQGLYELMLSCWNRDCKLRPSFAYIHSFL 912          

HSP 2 Score: 98.2117 bits (243), Expect = 2.773e-20
Identity = 113/472 (23.94%), Postives = 203/472 (43.01%), Query Frame = 1
Query:  202 MEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIY-EYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDN-------------RAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVSENLSSSKLKPNIQKRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYMIGNEIGSI 1569
            ME   +PD   +ASS++ + +  +A   RL     SN   E   AWCP        +E+++VD + ++ ++ + T+GR  +G   EF  + ++ Y R  +GR +  ++    Q ++  N +          P IIA  ++ YP+   D  M +C++  L+GC + D   +Y+   G  M    S+ +  +D  +DG K       ++  GLG L D              R W G         ++GW        P + I F +EK R F  +Q+ S    +Q + +FS+V  KF+++  L    E ++S     ++       ++ L      +  L+ H    + W+L+SEI+F S      F    V   + SS  +  +   + + I           + +    G  +  D    T + +  + G+ILL+  +++I VI +     RQY K      ++G   GS+
Sbjct:   41 MEDGVIPDSDITASSAWSDST--EAKHGRL-----SNG--EGDGAWCPAGPVFPSASEFLQVDLRKLHFLSLVGTQGRHADGLGREFARSYRLRYSR--DGRHWMTWKDRWGQEVVSGNENTYDIVLKDLGPPIIARMVRFYPL--ADRVMSVCLRVELYGCVWKDGLKAYTAPLGHVMDLSGSL-VNFNDSVYDGSK----EGGVIFGGLGQLCDGVLGGNDFMESKELRVWPGY-------DYVGWNRETLGQ-PTVDIEFHFEKTRIFHTMQVHSNNRHTQGVRVFSEVVCKFKASL-LSPWAEPELSLQVSDLHDLSSRTISLPLGGRPAQI--LRCHFAFADNWLLISEISFYSM----PFEDGSVLPPIPSSSSR-PLNATSYSPITANATSSPTKMSGITLRVGIPVAKDDSSHTAILIGCLVGIILLL--LAVIVVILW-----RQYWKK-----LLGKAQGSL 466          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060323-2])

HSP 1 Score: 165.622 bits (418), Expect = 3.613e-41
Identity = 116/370 (31.35%), Postives = 180/370 (48.65%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEIT-----KPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDY-LSIPLSDYTSIH----LPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G+  + +  + +  T  P       LP L    +   E + +GQ+G+     +       ++L+        RK       V +  L   +S  AR+ F  E++I  RL +PNI  +L +   S        +  C  +TE +M           E G++      + L D + P Q+  T++Y +LI +ASQIASGMK +     +HRDLA R+C+V          GG +     D     ++   DY  I     LPIRWMA E +   KF++ SDVWAFGVTLWE+L+ C +QPY + ++ QV+DN       Q  Q  YL+RP +CP+ +Y+++  CW+     RP+F  IH FL
Sbjct:  631 ADIISLQGVSGNNTYAVPALSATPTDCP------PLPELPRERLVFKEKLGEGQFGEVHLCEIENP----QDLANLEFPFNVRK--GRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIRLLGVCVSS--------DPLC-MVTE-YM-----------ESGDLNQYLSHRVLLDKSGPSQNTPTISYPALISMASQIASGMKFLASLNFVHRDLATRNCLVGGERGESEERGGERHIKIADFGMSRNLYAGDYYRIQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSHMTDEQVIDNAGEFFRDQGRQV-YLSRPAVCPQGLYELMLSCWNRDCKLRPSFAYIHSFL 966          

HSP 2 Score: 98.5969 bits (244), Expect = 2.621e-20
Identity = 116/490 (23.67%), Postives = 210/490 (42.86%), Query Frame = 1
Query:  202 MEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIY-EYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDN-------------RAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVS------------------SLAAENFPQSEVSENLSSSKLKPNIQKRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYMIGNEIGSI 1569
            ME   +PD   +ASS++ + +  +A   RL     SN   E   AWCP        +E+++VD + ++ ++ + T+GR  +G   EF  + ++ Y R+  GR +  ++    Q ++  N +          P IIA  ++ YP+   D  M +C++  L+GC + D   +Y+   G  M    S+ +  +D  +DG K       ++  GLG L D              R W G         ++GW        P + I F +EK R F  +Q+ S    +Q + +FS+V  KF+++  L    E ++S     ++       ++ L      +  L+ H    + W+L+SEI+F S                   L A ++  S ++ N +SS    N+   N++ +   +    +       I    +  D    T + +  + G+ILL+  +++I VI +     RQY K      ++G   GS+
Sbjct:   41 MEDGVIPDSDITASSAWSDST--EAKHGRL-----SNG--EGDGAWCPAGPVFPSASEFLQVDLRKLHFLSLVGTQGRHADGLGREFARSYRLRYSRD--GRHWMTWKDRWGQEVVSGNENTYDIVLKDLGPPIIARMVRFYPL--ADRVMSVCLRVELYGCVWKDGLKAYTAPLGHVMDLSGSL-VNFNDSVYDGSK----EGGVIFGGLGQLCDGVLGGNDFMESKELRVWPGY-------DYVGWNRETLGQ-PTVDIEFHFEKTRIFHTMQVHSNNRHTQGVRVFSEVVCKFKASL-LSPWAEPELSLQVSDLHDLSSRTISLPLGGRPAQI--LRCHFAFADNWLLISEISFYSMPFEDGSVLPPIPSSSSRPLNATSY--SPITANATSSPT--NLLMTNSSLLPSSMPTEMSGITLRVGIP---VAKDDSSHTAILIGCLVGIILLL--LAVIVVILW-----RQYWKK-----LLGKAQGSL 482          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060323-2])

HSP 1 Score: 165.622 bits (418), Expect = 3.613e-41
Identity = 116/370 (31.35%), Postives = 180/370 (48.65%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEIT-----KPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDY-LSIPLSDYTSIH----LPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G+  + +  + +  T  P       LP L    +   E + +GQ+G+     +       ++L+        RK       V +  L   +S  AR+ F  E++I  RL +PNI  +L +   S        +  C  +TE +M           E G++      + L D + P Q+  T++Y +LI +ASQIASGMK +     +HRDLA R+C+V          GG +     D     ++   DY  I     LPIRWMA E +   KF++ SDVWAFGVTLWE+L+ C +QPY + ++ QV+DN       Q  Q  YL+RP +CP+ +Y+++  CW+     RP+F  IH FL
Sbjct:  631 ADIISLQGVSGNNTYAVPALSATPTDCP------PLPELPRERLVFKEKLGEGQFGEVHLCEIENP----QDLANLEFPFNVRK--GRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIRLLGVCVSS--------DPLC-MVTE-YM-----------ESGDLNQYLSHRVLLDKSGPSQNTPTISYPALISMASQIASGMKFLASLNFVHRDLATRNCLVGGERGESEERGGERHIKIADFGMSRNLYAGDYYRIQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSHMTDEQVIDNAGEFFRDQGRQV-YLSRPAVCPQGLYELMLSCWNRDCKLRPSFAYIHSFL 966          

HSP 2 Score: 98.5969 bits (244), Expect = 2.621e-20
Identity = 116/490 (23.67%), Postives = 210/490 (42.86%), Query Frame = 1
Query:  202 MEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIY-EYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDN-------------RAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVS------------------SLAAENFPQSEVSENLSSSKLKPNIQKRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYMIGNEIGSI 1569
            ME   +PD   +ASS++ + +  +A   RL     SN   E   AWCP        +E+++VD + ++ ++ + T+GR  +G   EF  + ++ Y R+  GR +  ++    Q ++  N +          P IIA  ++ YP+   D  M +C++  L+GC + D   +Y+   G  M    S+ +  +D  +DG K       ++  GLG L D              R W G         ++GW        P + I F +EK R F  +Q+ S    +Q + +FS+V  KF+++  L    E ++S     ++       ++ L      +  L+ H    + W+L+SEI+F S                   L A ++  S ++ N +SS    N+   N++ +   +    +       I    +  D    T + +  + G+ILL+  +++I VI +     RQY K      ++G   GS+
Sbjct:   41 MEDGVIPDSDITASSAWSDST--EAKHGRL-----SNG--EGDGAWCPAGPVFPSASEFLQVDLRKLHFLSLVGTQGRHADGLGREFARSYRLRYSRD--GRHWMTWKDRWGQEVVSGNENTYDIVLKDLGPPIIARMVRFYPL--ADRVMSVCLRVELYGCVWKDGLKAYTAPLGHVMDLSGSL-VNFNDSVYDGSK----EGGVIFGGLGQLCDGVLGGNDFMESKELRVWPGY-------DYVGWNRETLGQ-PTVDIEFHFEKTRIFHTMQVHSNNRHTQGVRVFSEVVCKFKASL-LSPWAEPELSLQVSDLHDLSSRTISLPLGGRPAQI--LRCHFAFADNWLLISEISFYSMPFEDGSVLPPIPSSSSRPLNATSY--SPITANATSSPT--NLLMTNSSLLPSSMPTEMSGITLRVGIP---VAKDDSSHTAILIGCLVGIILLL--LAVIVVILW-----RQYWKK-----LLGKAQGSL 482          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:100497889])

HSP 1 Score: 163.31 bits (412), Expect = 1.522e-40
Identity = 117/364 (32.14%), Postives = 176/364 (48.35%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVI-LTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMN--LHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQ 3399
            + ++ +Q V G   + +  I +MD      +   + PR     +T  E + +GQ+G+         L  +  +  + D+ L  + S    T++ +  L   ++  AR+ F  EI+I  RL +PNI  +LA+          I       ITE   N  L+ ++  Q  E G     L     P      ++Y  L  +A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAF VTLWE LT C +QPY   S+ QV++N       Q  Q  YL +P ICP+ +Y ++  CW      RP+F EI   LQ
Sbjct:  485 ADIVNLQGVTGGNTYSVPAI-TMDLLSGKEVAVEEFPR---KHLTFKEKLGEGQFGEVH-------LCEAEGVEEFLDKDLILETSPGQPTLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVC---------IAEDPLCMITEYMENGDLNQFLSRQQPEGG-----LPAATLP------ISYTDLRHMAAQIASGMKYLSSLNFVHRDLATRNCLVGRNYTIKIADFGMS-RNLYSGDYYRIQ----GRAVLPIRWMSWESILLGKFTTASDVWAFAVTLWETLTFCREQPYSEMSDEQVIENTGEFFRDQGKQV-YLPKPNICPERVYKLMLSCWRRETKDRPSFQEICQSLQ 811          

HSP 2 Score: 90.1225 bits (222), Expect = 1.227e-17
Identity = 90/356 (25.28%), Postives = 152/356 (42.70%), Query Frame = 1
Query:  217 LPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGN-AWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGR---GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPY------FLGWYVSNAS-PIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAEN 1248
            +PD+  +ASS +   +   A   RL          E G+ AWCP          E++++D + ++ I  + T+GR   G GN  EF    KI Y R+   R   ++    + ++  N +          P I+A  ++  PV  +    +C++  L+GC + D  VSY+   G      +   I  +D  +DG          +  GLG LTD  + L       + +      ++GW  SN S    Y+ I FE+++ RNFT +++    + S+ + IF  V   F+S+   E E     S   +          T+ L +++   +K   H    + W++ SEI F S  A  N
Sbjct:    6 IPDEDITASSQWSESTA--AKYGRL--------DSEGGDGAWCPEMPVDPEELTEFLQIDLRVLHFITLVGTQGRHAGGHGN--EFAQMFKINYSRD-GTRWISWRNRHGRQVLDGNVNPYDIVLKDLEPPIVARFLRFIPVTDHSMN-VCLRVELYGCVWLDGLVSYNAPSGQQFLLPEGYAIYLNDTIYDG-----AIGYSMTEGLGQLTDGVSGLDDFTLTHEYHMWPGYDYVGW--SNESFSNGYVEIVFEFDRIRNFTTMKVHCNNMFSKGVKIFKDVQCFFRSDAN-EWEANSISSTLVLDDANPSARYVTVQLHNHMARAIK--CHYYFADSWMMFSEITFQSDAAMYN 337          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:100497889])

HSP 1 Score: 162.54 bits (410), Expect = 2.954e-40
Identity = 117/364 (32.14%), Postives = 176/364 (48.35%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVI-LTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMN--LHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQ 3399
            + ++ +Q V G   + +  I +MD      +   + PR     +T  E + +GQ+G+         L  +  +  + D+ L  + S    T++ +  L   ++  AR+ F  EI+I  RL +PNI  +LA+          I       ITE   N  L+ ++  Q  E G     L     P      ++Y  L  +A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAF VTLWE LT C +QPY   S+ QV++N       Q  Q  YL +P ICP+ +Y ++  CW      RP+F EI   LQ
Sbjct:  474 ADIVNLQGVTGGNTYSVPAI-TMDLLSGKEVAVEEFPR---KHLTFKEKLGEGQFGEVH-------LCEAEGVEEFLDKDLILETSPGQPTLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVC---------IAEDPLCMITEYMENGDLNQFLSRQQPEGG-----LPAATLP------ISYTDLRHMAAQIASGMKYLSSLNFVHRDLATRNCLVGRNYTIKIADFGMS-RNLYSGDYYRIQ----GRAVLPIRWMSWESILLGKFTTASDVWAFAVTLWETLTFCREQPYSEMSDEQVIENTGEFFRDQGKQV-YLPKPNICPERVYKLMLSCWRRETKDRPSFQEICQSLQ 800          

HSP 2 Score: 87.0409 bits (214), Expect = 1.149e-16
Identity = 88/351 (25.07%), Postives = 149/351 (42.45%), Query Frame = 1
Query:  217 LPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGN-AWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGR---GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPY------FLGWYVSNAS-PIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSS 1233
            +PD+  +ASS +   +   A   RL          E G+ AWCP          E++++D + ++ I  + T+GR   G GN  EF    KI Y R+   R   ++    + ++  N +          P I+A  ++  PV  +    +C++  L+GC + D  VSY+   G      +   I  +D  +DG             GLG LTD  + L       + +      ++GW  SN S    Y+ I FE+++ RNFT +++    + S+ + IF  V   F+S+   E E     S   +          T+ L +++   +K   H    + W++ SEI F S 
Sbjct:    6 IPDEDITASSQWSESTA--AKYGRL--------DSEGGDGAWCPEMPVDPEELTEFLQIDLRVLHFITLVGTQGRHAGGHGN--EFAQMFKINYSRD-GTRWISWRNRHGRQVLDGNVNPYDIVLKDLEPPIVARFLRFIPVTDHSMN-VCLRVELYGCVWLDGLVSYNAPSGQQFLLPEGYAIYLNDTIYDG-----------AIGLGQLTDGVSGLDDFTLTHEYHMWPGYDYVGW--SNESFSNGYVEIVFEFDRIRNFTTMKVHCNNMFSKGVKIFKDVQCFFRSDAN-EWEANSISSTLVLDDANPSARYVTVQLHNHMARAIK--CHYYFADSWMMFSEITFQSG 326          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:100497889])

HSP 1 Score: 162.54 bits (410), Expect = 2.996e-40
Identity = 117/373 (31.37%), Postives = 177/373 (47.45%), Query Frame = 1
Query: 2290 ANYFSNFDFSKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVI-LTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMN--LHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQ 3399
            A+   ++  + ++ +Q V G   + +  I +MD      +   + PR     +T  E + +GQ+G+         L  +  +  + D+ L  + S    T++ +  L   ++  AR+ F  EI+I  RL +PNI  +LA+          I       ITE   N  L+ ++  Q  E G               P    Y  L  +A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAF VTLWE LT C +QPY   S+ QV++N       Q  Q  YL +P ICP+ +Y ++  CW      RP+F EI   LQ
Sbjct:  485 ADGVPHYAEADIVNLQGVTGGNTYSVPAI-TMDLLSGKEVAVEEFPR---KHLTFKEKLGEGQFGEVH-------LCEAEGVEEFLDKDLILETSPGQPTLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVC---------IAEDPLCMITEYMENGDLNQFLSRQQPEGG--------------LPAATLYTDLRHMAAQIASGMKYLSSLNFVHRDLATRNCLVGRNYTIKIADFGMS-RNLYSGDYYRIQ----GRAVLPIRWMSWESILLGKFTTASDVWAFAVTLWETLTFCREQPYSEMSDEQVIENTGEFFRDQGKQV-YLPKPNICPERVYKLMLSCWRRETKDRPSFQEICQSLQ 817          

HSP 2 Score: 89.7373 bits (221), Expect = 1.799e-17
Identity = 90/356 (25.28%), Postives = 152/356 (42.70%), Query Frame = 1
Query:  217 LPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGN-AWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGR---GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPY------FLGWYVSNAS-PIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAEN 1248
            +PD+  +ASS +   +   A   RL          E G+ AWCP          E++++D + ++ I  + T+GR   G GN  EF    KI Y R+   R   ++    + ++  N +          P I+A  ++  PV  +    +C++  L+GC + D  VSY+   G      +   I  +D  +DG          +  GLG LTD  + L       + +      ++GW  SN S    Y+ I FE+++ RNFT +++    + S+ + IF  V   F+S+   E E     S   +          T+ L +++   +K   H    + W++ SEI F S  A  N
Sbjct:    6 IPDEDITASSQWSESTA--AKYGRL--------DSEGGDGAWCPEMPVDPEELTEFLQIDLRVLHFITLVGTQGRHAGGHGN--EFAQMFKINYSRD-GTRWISWRNRHGRQVLDGNVNPYDIVLKDLEPPIVARFLRFIPVTDHSMN-VCLRVELYGCVWLDGLVSYNAPSGQQFLLPEGYAIYLNDTIYDG-----AIGYSMTEGLGQLTDGVSGLDDFTLTHEYHMWPGYDYVGW--SNESFSNGYVEIVFEFDRIRNFTTMKVHCNNMFSKGVKIFKDVQCFFRSDAN-EWEANSISSTLVLDDANPSARYVTVQLHNHMARAIK--CHYYFADSWMMFSEITFQSDAAMYN 337          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:100497889])

HSP 1 Score: 161.77 bits (408), Expect = 3.474e-40
Identity = 117/364 (32.14%), Postives = 176/364 (48.35%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVI-LTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMN--LHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQ 3399
            + ++ +Q V G   + +  I +MD      +   + PR     +T  E + +GQ+G+         L  +  +  + D+ L  + S    T++ +  L   ++  AR+ F  EI+I  RL +PNI  +LA+          I       ITE   N  L+ ++  Q  E G     L     P      ++Y  L  +A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAF VTLWE LT C +QPY   S+ QV++N       Q  Q  YL +P ICP+ +Y ++  CW      RP+F EI   LQ
Sbjct:  423 ADIVNLQGVTGGNTYSVPAI-TMDLLSGKEVAVEEFPR---KHLTFKEKLGEGQFGEVH-------LCEAEGVEEFLDKDLILETSPGQPTLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVC---------IAEDPLCMITEYMENGDLNQFLSRQQPEGG-----LPAATLP------ISYTDLRHMAAQIASGMKYLSSLNFVHRDLATRNCLVGRNYTIKIADFGMS-RNLYSGDYYRIQ----GRAVLPIRWMSWESILLGKFTTASDVWAFAVTLWETLTFCREQPYSEMSDEQVIENTGEFFRDQGKQV-YLPKPNICPERVYKLMLSCWRRETKDRPSFQEICQSLQ 749          

HSP 2 Score: 87.8113 bits (216), Expect = 6.948e-17
Identity = 90/352 (25.57%), Postives = 150/352 (42.61%), Query Frame = 1
Query:  217 LPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGN-AWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGR---GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPY-------FLGWYVSNAS-PIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSS 1233
            +PD+  +ASS +   +   A   RL          E G+ AWCP          E++++D + ++ I  + T+GR   G GN  EF    KI Y R+   R   ++    + ++  N +          P I+A  ++  PV  +    +C++  L+GC + D  VSY+   G      +   I  +D  +DG          +  GLG LTD  + L     L   Y       ++GW  SN S    Y+ I FE+++ RNFT +++    + S+ + IF  V   F+S+   E E     S   +          T+ L +++   +K   H    + W++ SEI F S 
Sbjct:    6 IPDEDITASSQWSESTA--AKYGRL--------DSEGGDGAWCPEMPVDPEELTEFLQIDLRVLHFITLVGTQGRHAGGHGN--EFAQMFKINYSRDGT-RWISWRNRHGRQVLDGNVNPYDIVLKDLEPPIVARFLRFIPVTDHSMN-VCLRVELYGCVWLDGLVSYNAPSGQQFLLPEGYAIYLNDTIYDG-----AIGYSMTEGLGQLTDGVSGLDDFT-LTHEYHMWPGYDYVGW--SNESFSNGYVEIVFEFDRIRNFTTMKVHCNNMFSKGVKIFKDVQCFFRSDAN-EWEANSISSTLVLDDANPSARYVTVQLHNHMARAIK--CHYYFADSWMMFSEITFQSG 332          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:100497889])

HSP 1 Score: 154.451 bits (389), Expect = 1.279e-37
Identity = 112/362 (30.94%), Postives = 172/362 (47.51%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTS-LNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQ 3399
            + ++ +Q V G   + +  I +MD      +   + PR     +T  E + +GQ+G+         L  +  +  + D+ L  + S    T++    L   ++  AR+ F  EI+I  RL +PNI  +LA+          I       ITE              E G++ + L+      ++    +   L  +A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAF VTLWE LT C +QPY   S+ QV++N       Q  Q  YL +P ICP+ +Y ++  CW      RP+F EI   LQ
Sbjct:  526 ADIVNLQGVTGGNTYSVPAI-TMDLLSGKEVAVEEFPR---KHLTFKEKLGEGQFGEVH-------LCEAEGVEEFLDKDLILETSPGQPTLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVC---------IAEDPLCMITEYM------------ENGDLNQFLSRHR---ENNVKFHKNDLRHMAAQIASGMKYLSSLNFVHRDLATRNCLVGRNYTIKIADFGMS-RNLYSGDYYRI----QGRAVLPIRWMSWESILLGKFTTASDVWAFAVTLWETLTFCREQPYSEMSDEQVIENTGEFFRDQGKQV-YLPKPNICPERVYKLMLSCWRRETKDRPSFQEICQSLQ 846          

HSP 2 Score: 89.3521 bits (220), Expect = 2.291e-17
Identity = 90/356 (25.28%), Postives = 152/356 (42.70%), Query Frame = 1
Query:  217 LPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGN-AWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGR---GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPY------FLGWYVSNAS-PIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAEN 1248
            +PD+  +ASS +   +   A   RL          E G+ AWCP          E++++D + ++ I  + T+GR   G GN  EF    KI Y R+   R   ++    + ++  N +          P I+A  ++  PV  +    +C++  L+GC + D  VSY+   G      +   I  +D  +DG          +  GLG LTD  + L       + +      ++GW  SN S    Y+ I FE+++ RNFT +++    + S+ + IF  V   F+S+   E E     S   +          T+ L +++   +K   H    + W++ SEI F S  A  N
Sbjct:   38 IPDEDITASSQWSESTA--AKYGRL--------DSEGGDGAWCPEMPVDPEELTEFLQIDLRVLHFITLVGTQGRHAGGHGN--EFAQMFKINYSRD-GTRWISWRNRHGRQVLDGNVNPYDIVLKDLEPPIVARFLRFIPVTDHSMN-VCLRVELYGCVWLDGLVSYNAPSGQQFLLPEGYAIYLNDTIYDG-----AIGYSMTEGLGQLTDGVSGLDDFTLTHEYHMWPGYDYVGW--SNESFSNGYVEIVFEFDRIRNFTTMKVHCNNMFSKGVKIFKDVQCFFRSDAN-EWEANSISSTLVLDDANPSARYVTVQLHNHMARAIK--CHYYFADSWMMFSEITFQSDAAMYN 369          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr2 (discoidin domain receptor family, member 2 [Source:MGI Symbol;Acc:MGI:1345277])

HSP 1 Score: 174.866 bits (442), Expect = 3.012e-44
Identity = 115/361 (31.86%), Postives = 176/361 (48.75%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTEN-CTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G   + +  + +MD      +   + PR     +   E + +GQ+G+         L     +  ++D+     +S      V +  L   ++  AR+ F  EI+I  RL +PNI  +LA+          I       ITE   N  +   L   E      PL+ C+    S  T++Y +L F+A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAFGVTLWE  T C +QPY   S+ QV++N       Q  Q  YL +P +CP  +Y ++  CW     +RP+F EIH+ L
Sbjct:  524 ADIVNLQGVTGGNTYCVPAV-TMDLLSGKDVAVEEFPR---KLLAFKEKLGEGQFGEVH-------LCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVC---------ITEDPLCMITEYMENGDLNQFLSRHE------PLSSCS----SDATVSYANLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMS-RNLYSGDYYRI----QGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQI-YLPQPALCPDSVYKLMLSCWRRETKHRPSFQEIHLLL 848          

HSP 2 Score: 100.523 bits (249), Expect = 6.869e-21
Identity = 87/354 (24.58%), Postives = 156/354 (44.07%), Query Frame = 1
Query:  217 LPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPY------FLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRF--GGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAEN 1248
            +PD+  +ASS +   +   A   RL          E   AWCP          E++++D ++++ I  + T+GR   G+ +EF P  KI Y R+   R   ++    + ++  N++          P I+A  +++ PV  +    +C++  L+GC + D  VSY+   G          I  +D  +DG          +  GLG LTD  + L       + +      ++GW   +A+   +I I FE+++ RNFT +++    + ++ + IF +V   F+S     SE E       + ++         T+ L H + + +K Q H    + W++ SEI F S  A  N
Sbjct:   41 IPDEDITASSQWSESTA--AKYGRL-------DSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD-GSRWISWRNRHGKQVLDGNSNPYDVFLKDLEPPIVARFVRLIPVTDHSMN-VCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDG-----AVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATN-GFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEA---SEWEPTAVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFA--DTWMMFSEITFQSDAAMYN 372          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr2 (discoidin domain receptor family, member 2 [Source:MGI Symbol;Acc:MGI:1345277])

HSP 1 Score: 174.866 bits (442), Expect = 3.012e-44
Identity = 115/361 (31.86%), Postives = 176/361 (48.75%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTEN-CTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G   + +  + +MD      +   + PR     +   E + +GQ+G+         L     +  ++D+     +S      V +  L   ++  AR+ F  EI+I  RL +PNI  +LA+          I       ITE   N  +   L   E      PL+ C+    S  T++Y +L F+A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAFGVTLWE  T C +QPY   S+ QV++N       Q  Q  YL +P +CP  +Y ++  CW     +RP+F EIH+ L
Sbjct:  524 ADIVNLQGVTGGNTYCVPAV-TMDLLSGKDVAVEEFPR---KLLAFKEKLGEGQFGEVH-------LCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVC---------ITEDPLCMITEYMENGDLNQFLSRHE------PLSSCS----SDATVSYANLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMS-RNLYSGDYYRI----QGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQI-YLPQPALCPDSVYKLMLSCWRRETKHRPSFQEIHLLL 848          

HSP 2 Score: 100.523 bits (249), Expect = 6.869e-21
Identity = 87/354 (24.58%), Postives = 156/354 (44.07%), Query Frame = 1
Query:  217 LPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPY------FLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRF--GGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAEN 1248
            +PD+  +ASS +   +   A   RL          E   AWCP          E++++D ++++ I  + T+GR   G+ +EF P  KI Y R+   R   ++    + ++  N++          P I+A  +++ PV  +    +C++  L+GC + D  VSY+   G          I  +D  +DG          +  GLG LTD  + L       + +      ++GW   +A+   +I I FE+++ RNFT +++    + ++ + IF +V   F+S     SE E       + ++         T+ L H + + +K Q H    + W++ SEI F S  A  N
Sbjct:   41 IPDEDITASSQWSESTA--AKYGRL-------DSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD-GSRWISWRNRHGKQVLDGNSNPYDVFLKDLEPPIVARFVRLIPVTDHSMN-VCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDG-----AVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATN-GFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEA---SEWEPTAVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFA--DTWMMFSEITFQSDAAMYN 372          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr2 (discoidin domain receptor family, member 2 [Source:MGI Symbol;Acc:MGI:1345277])

HSP 1 Score: 174.866 bits (442), Expect = 3.012e-44
Identity = 115/361 (31.86%), Postives = 176/361 (48.75%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTEN-CTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G   + +  + +MD      +   + PR     +   E + +GQ+G+         L     +  ++D+     +S      V +  L   ++  AR+ F  EI+I  RL +PNI  +LA+          I       ITE   N  +   L   E      PL+ C+    S  T++Y +L F+A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAFGVTLWE  T C +QPY   S+ QV++N       Q  Q  YL +P +CP  +Y ++  CW     +RP+F EIH+ L
Sbjct:  524 ADIVNLQGVTGGNTYCVPAV-TMDLLSGKDVAVEEFPR---KLLAFKEKLGEGQFGEVH-------LCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVC---------ITEDPLCMITEYMENGDLNQFLSRHE------PLSSCS----SDATVSYANLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMS-RNLYSGDYYRI----QGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQI-YLPQPALCPDSVYKLMLSCWRRETKHRPSFQEIHLLL 848          

HSP 2 Score: 100.523 bits (249), Expect = 6.869e-21
Identity = 87/354 (24.58%), Postives = 156/354 (44.07%), Query Frame = 1
Query:  217 LPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPY------FLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRF--GGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAEN 1248
            +PD+  +ASS +   +   A   RL          E   AWCP          E++++D ++++ I  + T+GR   G+ +EF P  KI Y R+   R   ++    + ++  N++          P I+A  +++ PV  +    +C++  L+GC + D  VSY+   G          I  +D  +DG          +  GLG LTD  + L       + +      ++GW   +A+   +I I FE+++ RNFT +++    + ++ + IF +V   F+S     SE E       + ++         T+ L H + + +K Q H    + W++ SEI F S  A  N
Sbjct:   41 IPDEDITASSQWSESTA--AKYGRL-------DSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD-GSRWISWRNRHGKQVLDGNSNPYDVFLKDLEPPIVARFVRLIPVTDHSMN-VCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDG-----AVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATN-GFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEA---SEWEPTAVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFA--DTWMMFSEITFQSDAAMYN 372          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 157.147 bits (396), Expect = 1.393e-38
Identity = 92/271 (33.95%), Postives = 144/271 (53.14%), Query Frame = 1
Query: 2590 VILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMN--LHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            V +  L   ++  AR+ F  E++I  RL +PNI  +L +          + +     IT+   N  L+ ++  +  E  + T+ L+      Q P T++Y  L+ + +QIASGM+++     +HRDLA R+C+V  N  +KI + G    + +  DY  +         LPIRWMA E +   KF++ SDVWAFGVTLWEVL  C  QP+   ++ QV++N       Q  Q  YL+RP  CP+ +Y+++  CW    + RP F ++H FL
Sbjct:  613 VAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVC---------VQDDPLCMITDYMENGDLNQFLSARQLEN-KATQGLSGDTESDQGP-TISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMS-RNLYAGDYYRV----QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQV-YLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFL 866          

HSP 2 Score: 81.6481 bits (200), Expect = 3.648e-15
Identity = 74/317 (23.34%), Postives = 134/317 (42.27%), Query Frame = 1
Query:  322 ENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFV-EFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDG---DKIRQNSKILLKNGLGLLTD------NRAWLGSLEGLRDPYFLGWYVSNAS-PIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSL 1236
            +   AWCP         E+++VD + ++++  + T+GR  G    EF  + ++ Y R+   R  +++    Q +I  N D          P ++A  ++ YP    D  M +C++  L+GC + D  +SY+   G  M     V +  +D  +DG     ++      L +G+  L D       R W G         ++GW  SN S P  Y+ + FE+++ R F  +Q+    + +    +   V  +F+    +  E E         +        ++ L  +VG    LQ        W+L SEI+F+S +
Sbjct:   69 DGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPR--ADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTM-QLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGY-------DYVGW--SNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRF--LQCRFLFAGPWLLFSEISFISDV 370          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 157.147 bits (396), Expect = 1.505e-38
Identity = 92/271 (33.95%), Postives = 144/271 (53.14%), Query Frame = 1
Query: 2590 VILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMN--LHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            V +  L   ++  AR+ F  E++I  RL +PNI  +L +          + +     IT+   N  L+ ++  +  E  + T+ L+      Q P T++Y  L+ + +QIASGM+++     +HRDLA R+C+V  N  +KI + G    + +  DY  +         LPIRWMA E +   KF++ SDVWAFGVTLWEVL  C  QP+   ++ QV++N       Q  Q  YL+RP  CP+ +Y+++  CW    + RP F ++H FL
Sbjct:  650 VAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVC---------VQDDPLCMITDYMENGDLNQFLSARQLEN-KATQGLSGDTESDQGP-TISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMS-RNLYAGDYYRV----QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQV-YLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFL 903          

HSP 2 Score: 82.0333 bits (201), Expect = 3.619e-15
Identity = 74/317 (23.34%), Postives = 134/317 (42.27%), Query Frame = 1
Query:  322 ENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFV-EFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDG---DKIRQNSKILLKNGLGLLTD------NRAWLGSLEGLRDPYFLGWYVSNAS-PIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSL 1236
            +   AWCP         E+++VD + ++++  + T+GR  G    EF  + ++ Y R+   R  +++    Q +I  N D          P ++A  ++ YP    D  M +C++  L+GC + D  +SY+   G  M     V +  +D  +DG     ++      L +G+  L D       R W G         ++GW  SN S P  Y+ + FE+++ R F  +Q+    + +    +   V  +F+    +  E E         +        ++ L  +VG    LQ        W+L SEI+F+S +
Sbjct:   69 DGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPR--ADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTM-QLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGY-------DYVGW--SNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRF--LQCRFLFAGPWLLFSEISFISDV 370          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q62371|DDR2_MOUSE (Discoidin domain-containing receptor 2 OS=Mus musculus OX=10090 GN=Ddr2 PE=1 SV=2)

HSP 1 Score: 174.866 bits (442), Expect = 2.107e-43
Identity = 115/361 (31.86%), Postives = 176/361 (48.75%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTEN-CTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G   + +  + +MD      +   + PR     +   E + +GQ+G+         L     +  ++D+     +S      V +  L   ++  AR+ F  EI+I  RL +PNI  +LA+          I       ITE   N  +   L   E      PL+ C+    S  T++Y +L F+A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAFGVTLWE  T C +QPY   S+ QV++N       Q  Q  YL +P +CP  +Y ++  CW     +RP+F EIH+ L
Sbjct:  524 ADIVNLQGVTGGNTYCVPAV-TMDLLSGKDVAVEEFPR---KLLAFKEKLGEGQFGEVH-------LCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVC---------ITEDPLCMITEYMENGDLNQFLSRHE------PLSSCS----SDATVSYANLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMS-RNLYSGDYYRI----QGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQI-YLPQPALCPDSVYKLMLSCWRRETKHRPSFQEIHLLL 848          

HSP 2 Score: 100.523 bits (249), Expect = 4.805e-20
Identity = 87/354 (24.58%), Postives = 156/354 (44.07%), Query Frame = 1
Query:  217 LPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPY------FLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRF--GGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAEN 1248
            +PD+  +ASS +   +   A   RL          E   AWCP          E++++D ++++ I  + T+GR   G+ +EF P  KI Y R+   R   ++    + ++  N++          P I+A  +++ PV  +    +C++  L+GC + D  VSY+   G          I  +D  +DG          +  GLG LTD  + L       + +      ++GW   +A+   +I I FE+++ RNFT +++    + ++ + IF +V   F+S     SE E       + ++         T+ L H + + +K Q H    + W++ SEI F S  A  N
Sbjct:   41 IPDEDITASSQWSESTA--AKYGRL-------DSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD-GSRWISWRNRHGKQVLDGNSNPYDVFLKDLEPPIVARFVRLIPVTDHSMN-VCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDG-----AVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATN-GFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEA---SEWEPTAVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFA--DTWMMFSEITFQSDAAMYN 372          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q16832|DDR2_HUMAN (Discoidin domain-containing receptor 2 OS=Homo sapiens OX=9606 GN=DDR2 PE=1 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 1.254e-41
Identity = 112/364 (30.77%), Postives = 177/364 (48.63%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLST-ENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSP---ETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G   + +  + +MD      +   + PR     +T  E + +GQ+G+         L     +  ++D+     +S  +   V +  L   ++  AR+ F  EI+I  RL +PNI  +LA+                     C  +  + +  +  E G++ + L+    P  S     T++Y +L F+A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAFGVTLWE  T C +QPY   S+ QV++N       Q  Q  YL +P ICP  +Y ++  CW      RP+F EIH+ L
Sbjct:  524 ADIVNLQGVTGGNTYSVPAV-TMDLLSGKDVAVEEFPR---KLLTFKEKLGEGQFGEVH-------LCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAV---------------------CITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMS-RNLYSGDYYRI----QGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQ-TYLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLL 849          

HSP 2 Score: 102.834 bits (255), Expect = 8.904e-21
Identity = 94/376 (25.00%), Postives = 163/376 (43.35%), Query Frame = 1
Query:  202 MEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPY------FLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRF--GGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVSENLSSSKLKP 1299
            M    +PD+  +ASS +   +   A   RL          E   AWCP          E++++D  +++ I  + T+GR   G+ +EF P  KI Y R+   R   ++    + ++  N++          P I+A  ++  PV  +    +C++  L+GC + D  VSY+   G          I  +D  +DG          +  GLG LTD  + L       + +      ++GW   +A+   YI I FE+++ RNFT +++    + ++ + IF +V   F+S     SE E +     + ++         T+ L H + + +K Q H  +   W++ SEI F S  A  N      SE L +S + P
Sbjct:   36 MSGGQIPDEDITASSQWSESTA--AKYGRL-------DSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD-GTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMN-VCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDG-----AVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATN-GYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEA---SEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADT--WMMFSEITFQSDAAMYN-----NSEALPTSPMAP 384          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q08345|DDR1_HUMAN (Epithelial discoidin domain-containing receptor 1 OS=Homo sapiens OX=9606 GN=DDR1 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.131e-38
Identity = 115/386 (29.79%), Postives = 184/386 (47.67%), Query Frame = 1
Query: 2293 NYFSNFDFSKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQM--SSITTAELISQGQYGQNKKAILN--ESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAI---------VTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCI 3411
            N   ++  + ++ +Q V G   + +  +       P G +    PR+    S +   E + +GQ+G+     ++  + L+         D  LN +       V +  L   ++  AR+ F  E++I  RL +PNI  +L +         +TD +E   G LN         F++ H     Q  +K     P    A   Q P T++Y  L+ +A+QIASGM+++     +HRDLA R+C+V  N  +KI + G    + +  DY  +         LPIRWMA E +   KF++ SDVWAFGVTLWEVL  C  QP+   ++ QV++N       Q  Q  YL+RP  CP+ +Y+++  CW    + RP F ++H FL    +
Sbjct:  564 NSVPHYAEADIVTLQGVTGGNTYAVPAL-------PPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSL-------DFPLNVR-KGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMEN--GDLNQ--------FLSAH-----QLEDKAAEGAPGDGQAA--QGP-TISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMS-RNLYAGDYYRV----QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQV-YLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL 910          

HSP 2 Score: 76.6406 bits (187), Expect = 9.139e-13
Identity = 78/322 (24.22%), Postives = 137/322 (42.55%), Query Frame = 1
Query:  331 NAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFV-EFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKI---RQNSKILLKNGLGLLTD------NRAWLGSLEGLRDPYFLGWYVSNAS-PIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVK--LQLHATNLNRWILVSEINFVSSLAAENFP 1254
             AWCP         E+++VD + ++++  + T+GR  G    EF  + ++ Y R+   R   ++    Q +I  N D          P ++A  ++ YP    D  M +C++  L+GC + D  +SY+   G  M  + S  +  +D  +DG  +   +      L +G+  L D       R W G         ++GW  SN S    Y+ + FE+++ R F  +Q+    + +    +   V  +F+    +  E E    R N+  N   G      +S  +G  V   LQ        W+L SEI+F+S +   + P
Sbjct:   71 GAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPR--ADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTM--YLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGY-------DYVGW--SNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEP--MRHNLGGNL--GDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDVVNNSSP 374          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q7YR43|DDR1_PANTR (Epithelial discoidin domain-containing receptor 1 OS=Pan troglodytes OX=9598 GN=DDR1 PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.196e-38
Identity = 115/386 (29.79%), Postives = 184/386 (47.67%), Query Frame = 1
Query: 2293 NYFSNFDFSKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQM--SSITTAELISQGQYGQNKKAILN--ESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAI---------VTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCI 3411
            N   ++  + ++ +Q V G   + +  +       P G +    PR+    S +   E + +GQ+G+     ++  + L+         D  LN +       V +  L   ++  AR+ F  E++I  RL +PNI  +L +         +TD +E   G LN         F++ H     Q  +K     P    A   Q P T++Y  L+ +A+QIASGM+++     +HRDLA R+C+V  N  +KI + G    + +  DY  +         LPIRWMA E +   KF++ SDVWAFGVTLWEVL  C  QP+   ++ QV++N       Q  Q  YL+RP  CP+ +Y+++  CW    + RP F ++H FL    +
Sbjct:  560 NSVPHYAEADIVTLQGVTGGNTYAVPAL-------PPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSL-------DFPLNVR-KGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMEN--GDLNQ--------FLSAH-----QLEDKAAEGAPGDGQAA--QGP-TISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMS-RNLYAGDYYRV----QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQV-YLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL 906          

HSP 2 Score: 76.6406 bits (187), Expect = 9.040e-13
Identity = 78/322 (24.22%), Postives = 137/322 (42.55%), Query Frame = 1
Query:  331 NAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFV-EFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKI---RQNSKILLKNGLGLLTD------NRAWLGSLEGLRDPYFLGWYVSNAS-PIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVK--LQLHATNLNRWILVSEINFVSSLAAENFP 1254
             AWCP         E+++VD + ++++  + T+GR  G    EF  + ++ Y R+   R   ++    Q +I  N D          P ++A  ++ YP    D  M +C++  L+GC + D  +SY+   G  M  + S  +  +D  +DG  +   +      L +G+  L D       R W G         ++GW  SN S    Y+ + FE+++ R F  +Q+    + +    +   V  +F+    +  E E    R N+  N   G      +S  +G  V   LQ        W+L SEI+F+S +   + P
Sbjct:   67 GAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPR--ADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTM--YLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGY-------DYVGW--SNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEP--MRHNLGGNL--GDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDVVNNSSP 370          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q03146|DDR1_MOUSE (Epithelial discoidin domain-containing receptor 1 OS=Mus musculus OX=10090 GN=Ddr1 PE=2 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 1.053e-37
Identity = 92/271 (33.95%), Postives = 144/271 (53.14%), Query Frame = 1
Query: 2590 VILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMN--LHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            V +  L   ++  AR+ F  E++I  RL +PNI  +L +          + +     IT+   N  L+ ++  +  E  + T+ L+      Q P T++Y  L+ + +QIASGM+++     +HRDLA R+C+V  N  +KI + G    + +  DY  +         LPIRWMA E +   KF++ SDVWAFGVTLWEVL  C  QP+   ++ QV++N       Q  Q  YL+RP  CP+ +Y+++  CW    + RP F ++H FL
Sbjct:  650 VAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVC---------VQDDPLCMITDYMENGDLNQFLSARQLEN-KATQGLSGDTESDQGP-TISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMS-RNLYAGDYYRV----QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFGQLTDEQVIENAGEFFRDQGRQV-YLSRPPACPQTLYELMLRCWSREPEQRPPFAQLHRFL 903          

HSP 2 Score: 82.0333 bits (201), Expect = 2.532e-14
Identity = 74/317 (23.34%), Postives = 134/317 (42.27%), Query Frame = 1
Query:  322 ENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFV-EFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDG---DKIRQNSKILLKNGLGLLTD------NRAWLGSLEGLRDPYFLGWYVSNAS-PIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSL 1236
            +   AWCP         E+++VD + ++++  + T+GR  G    EF  + ++ Y R+   R  +++    Q +I  N D          P ++A  ++ YP    D  M +C++  L+GC + D  +SY+   G  M     V +  +D  +DG     ++      L +G+  L D       R W G         ++GW  SN S P  Y+ + FE+++ R F  +Q+    + +    +   V  +F+    +  E E         +        ++ L  +VG    LQ        W+L SEI+F+S +
Sbjct:   69 DGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGR-RWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPR--ADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTM-QLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGY-------DYVGW--SNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRF--LQCRFLFAGPWLLFSEISFISDV 370          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A087UMF9 (Discoidin domain-containing receptor 2 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_26952 PE=4 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 8.863e-57
Identity = 130/380 (34.21%), Postives = 195/380 (51.32%), Query Frame = 1
Query: 2284 PEANYFSNFDFSKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQ--SPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGY 3417
            P   Y++  D  K+  IQ V G+  + +  +D +         D+ +  +    +   E + +GQ+G+         L  +  +     E+++         V + +L   +S  AR+ FY E++I  RL +PNI  +L + T        +   + G + + F+  HV              P      PF+  S + L+YGSLIF+A+QIASGMK++E    +HRDLA R+C+V   L +KI + G      +  DY  I         LPIRWMA ES+   KF++KSDVWAF VT+WE+LT   QQPY    + +V++N+ +       Q  YL +P  CPKEIYD+++ECW   E  RPNF EIH+FLQRK +GY
Sbjct:  147 PSERYYAATDVVKMPNIQGVSGNTVYAVPNVDLLSRD------DSPVREIPRHRLHYMEKLGEGQFGE-------VHLCEAEGIP----ELVDVPCYGNKTLVAVKTLRKSASEHARADFYKEVKILSRLRDPNIVHVLGVCTRDEPFCMIVEYMENGDLNQ-FLQQHV--------------PENTLTSPFKPSSSKVLSYGSLIFMATQIASGMKYLESLNFVHRDLATRNCLVGRGLTIKIADFGMS-RDLYSGDYYRIE----GRAMLPIRWMAWESILLGKFTTKSDVWAFAVTMWEILTFARQQPYADQVDDKVIENVSHFYHNDGLQV-YLPQPPGCPKEIYDLMKECWQRNEHDRPNFREIHLFLQRKNLGY 488          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A444SJX0 (Discoidin domain-containing receptor 2 OS=Armadillidium vulgare OX=13347 GN=Avbf_11186 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 3.397e-54
Identity = 128/386 (33.16%), Postives = 193/386 (50.00%), Query Frame = 1
Query: 2287 EANYFSNFDFSKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFM---NLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPL--SDYTSIH----LPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGY 3417
            E  Y+      +   IQ V G + + + +   +  + P       +P +    I   E + +G +G  +       L     ++G          S     V L SL   +S  A+  F +E+++  RL +PNI  +L +VT           H+   +   +M   +L+ ++R   +E   +  P+         P  L YG+LI++ +QIASGMK++EE   +HRDLA R+C+V   L +KI++ G           +S PL  SDY  I     LPIRWMA ES+   +F++KSDVWAFGVTLWE+LT   +Q Y   S+  V++N+ +      S    L  P++CP+E+YDM+  CW P E  RP F EIHMFLQRK +GY
Sbjct:  133 EQQYYIAPRLCQPSNIQGVTGTVIYSVVDTSVIQKEVP-------VPEIPRHRIRVLENLGEGLFGTVQ-------LCEVDGVAGQHGGGSLSTSSGNTRLVALKSLKPNASEMAKEDFKSEVRVLSRLEDPNIVMLLGVVT----------RHEPMAMLLEYMEHGDLYQFLRRHVSEGIAVRHPMIQNPN-GAPPPILTYGALIYMGTQIASGMKYLEELNFVHRDLAARNCLVGRGLTIKISDFG-----------MSRPLYSSDYYRIEGRAVLPIRWMAWESVLQGRFTTKSDVWAFGVTLWEILTMARRQAYDELSDEGVLENVSHCYHGDGSGMILLPMPQLCPREMYDMLTACWRPNERQRPPFWEIHMFLQRKNLGY 482          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A4Y2CLV5 (Discoidin domain-containing receptor 2 (Fragment) OS=Araneus ventricosus OX=182803 GN=DDR2_0 PE=4 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 2.704e-53
Identity = 141/422 (33.41%), Postives = 211/422 (50.00%), Query Frame = 1
Query: 2164 TSNDIPTPVA-SHKSYSILSNDSNTPS-PYSMSKNSLMCWTSPEANYFSNFDFSKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSP--ETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGY 3417
            T +  PTPV  SH   + L    N PS P ++ K        P   Y++  D  K+  IQ V G+  + +  +D +         D+ +  +    +   E + +GQ+G+         L  +  +     E+++         V + +L   +S +ARS FY E++I  RL +PNI  +L I T        +   + G + + F+  HV              P      PF+ P  + L++GSLI++A+QIASGMK++E    +HRDLA R+C+V     +KI + G      +  DY  I         LPIRWMA ES+   KF++KSDVWAF VT+WE+LT    QPY    + +V++N+ +       Q  YL +P  CPKEIYD+++ECW   E  RPNF EIH+FLQRK +GY
Sbjct:  484 TKSTTPTPVVPSHPPPTSL----NKPSFPQTLPKP---LQKPPSERYYAATDVVKMPNIQGVSGNTVYAVPNVDLLSRD------DSSVREIPRHRLHYIEKLGEGQFGE-------VHLCEAEGIP----ELIDVPCLGSKKLVAVKTLRKTASEQARSDFYKEVKILSRLRDPNIVHVLGICTKDEPLCMIVEYMENGDLNQ-FLQQHV--------------PENTLTSPFKPPASKVLSHGSLIYMATQIASGMKYLESLNFVHRDLATRNCLVGKGYTIKIADFGMS-RDLYSEDYYRIE----GRAMLPIRWMAWESILLGKFTTKSDVWAFAVTMWEILTFARHQPYADMVDDKVIENVSHFYHNDGHQI-YLPQPPGCPKEIYDLMKECWQRNEHDRPNFREIHLFLQRKNLGY 860          

HSP 2 Score: 119.398 bits (298), Expect = 1.763e-23
Identity = 90/319 (28.21%), Postives = 153/319 (47.96%), Query Frame = 1
Query:  325 NGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRA----WLGSLEGLRDPY-FLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSE 1263
            NG AWCP  + S    E +E+   S++VI  + T+GR G G  +EF     + Y R    R   Y+    Q  +  NT+  T  + K  P +IA+ I+  P   +  + +C++  ++GC + D  +SYS   G+     + V +  SDR +DG  I+ +S   L  GLG LTD       +   + G+   Y ++GW  +++S    + I FE+++ RNFT    +   + ++ + +FS   + F    K  +    + S         G  + T+ L   VG  VK++L     ++W+L+SE+ F S  A  NF + +
Sbjct:   41 NGGAWCPKPQISKEVVEHLEISLPSLHVITAVATQGRFGNGQGLEFAEDYMLEYWRPGLPRFLRYKDAMGQETLKGNTNTYTVVKRKLNPVVIATKIRFIPFSVH-LRTVCMRVEVYGCPWKDGLLSYSMPQGE----RRGVEVDLSDRTYDG--IKDDS--YLHGGLGQLTDGVVGEDNFKQDVSGMGRGYEWVGWK-NDSSYSRSVEIIFEFDQVRNFTAAYFYCNNMHTKEVQVFSSAKIWFSIGGKHFNGPPVNFSYMPDPFFENGRNV-TIHLYQRVGKFVKVELAFA--SKWMLISEVAFNSVPAVGNFTEED 346          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A2L2YDJ9 (Discoidin domain-containing receptor 2 OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 6.455e-52
Identity = 137/395 (34.68%), Postives = 212/395 (53.67%), Query Frame = 1
Query: 2242 PYSMSKNSLMCWTSPEANYFSNFDFSKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMN--LHVYIRLQTTEKGEITKPLTDCAYPFQSP-ETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGY 3417
            P + +K S     +    +++    ++L  IQ V G+  +    +D  +   P+     ++PR ++  +   E + +GQ+G+         L R+  +    D   +   ST    V + S+   +S+  R+ F+ E++I  +L +PNI  +L + T   +GD  +       + E   N  L+ Y++    E    T  LT    P  +P +TL+YG LI++A+QIASGMK++E    +HRDLA R+C+V  +  +KI + G    S +  DY  I         LPIRWMA ES+   KF++KSDVWAF VT+WEVLT    QPY   ++ QV++N+   L   +S+  YL +P  CP+EIYD++RECW   E  RPNF EIH+FLQRK +GY
Sbjct:  346 PTTTTKTSPFSRVNGPERHYAATAVTELPNIQGVSGNTVYAAPNVDE-EMLPPV----REVPRHKLHYL---EKLGEGQFGE-------VHLCRAEGIPELVDVPCHGNSST---LVAVKSVRPGASANTRADFFKEVRILSQLRDPNIVYVLGVCT---QGDGPLC-----MVVEYMENGDLNQYLQQHVPET---TGTLT--FRPTGTPSKTLSYGCLIYMATQIASGMKYLESLNFVHRDLATRNCLVGRSHVIKIADFGMS-RSLYSTDYYKIQ----GRAVLPIRWMAWESILLGKFTTKSDVWAFAVTMWEVLTFARHQPYAELTDEQVIENI-GYLYHGDSRHRYLPQPPNCPREIYDLMRECWQRNESDRPNFREIHLFLQRKNLGY 703          

HSP 2 Score: 67.3958 bits (163), Expect = 1.787e-7
Identity = 60/227 (26.43%), Postives = 100/227 (44.05%), Query Frame = 1
Query:  655 IKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLE----GLRDPY-FLGW-------------YVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIF------TMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSE 1263
            ++  L+GC +++  VSY+   G+     + + I  SD+ +DG  I+ +S   L  GLG LTD      +      G    Y +LGW              ++     P I I F ++  RNF+ L  +   + S+ + +F+   + F    +         +   VQ +    + F      T+ L H +G  VK++LH     RWIL+SE++F S  A  NF + E
Sbjct:    1 MRVELYGCLWNEGLVSYAMPQGE----RRGIDINLSDKIYDG--IKDDS--YLHGGLGQLTDGLKGEDNFRVDNTGFGKGYEWLGWKNDSGGISTLSTDVLTGVESRP-IEIIFTFDVVRNFSALYFYCNNMHSRDVQVFASAKIWFSVGGRY-------FNNQAVQFSYMPDIFFERSRNVTIFLHHGIGRTVKVELHFAA--RWILISEVSFDSVPAVGNFTEEE 209          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A423TK81 (Putative discoidin domain-containing receptor 2-like OS=Penaeus vannamei OX=6689 GN=C7M84_004540 PE=3 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 1.543e-51
Identity = 128/364 (35.16%), Postives = 190/364 (52.20%), Query Frame = 1
Query: 2332 IQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITEC-FMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSP-FDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGY 3417
            IQ V G + +  A+  ++  +R        +P +  S I   E + +G +G     ++    ++     G R              V +  L   +S E +  F  E +I  R+ +PNI  +L IV+ S           C  +    + +L+ ++R    E   I  P T  A     P  L+YG+L++IASQ+ASGMKH+E    +HRDLA R+C+V   L VKI++ G  +S P +  DY    LSD  ++ LPIRWMA E++   +FS+KSDVWAFGVTLWE+LT   QQP+   S+  V++N+ +      S    L +P +CP+E+YDM+  CW P    RP F E+ MFLQRK +GY
Sbjct:  604 IQGVTGTVIYAAADATNLAKER-------SVPEVPRSHIRVLETLGEGVFG-----VVQLCEVKCPPGLGSR-------------KVAVKCLKPGASEETKEDFRQESRILSRIDDPNIVRLLGIVSSS--------EPLCMLLEYMDYGDLYQFLRRHVAEG--IAAP-TPTARSHMEPRVLSYGALVYIASQVASGMKHLESLNFVHRDLATRNCLVGGGLCVKISDFG--MSRPLYSSDYYR--LSDSRAL-LPIRWMAWEAILQGRFSTKSDVWAFGVTLWEILTMARQQPFDELSDDGVLENVSHCYHGDGSGMMLLPQPPLCPREMYDMMAACWRPNPRQRPPFWEVLMFLQRKNLGY 926          

HSP 2 Score: 105.916 bits (263), Expect = 3.335e-19
Identity = 91/364 (25.00%), Postives = 155/364 (42.58%), Query Frame = 1
Query:  181 NNCWTSL-MEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAW-----LGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTK-------LESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVS 1230
              C  +L ME   +PD+  SAS             A +  IY        G AWCP     +   E++EV+   ++V+  +  +GR G G   EF    K+ + R        Y       L+  NT+      ++  P I+A+ ++  P   +  + +C++  ++GC + D  +SYS  DGD      ++     D  +DG   R++    L  GLG LTD         + +L   R   ++GW        P + I+FE++  RNF+ + I++    ++   +FS+  + F +  +       +E E   D    N +         T+ L ++    VKLQL      RWI++SE+ F S
Sbjct:   26 GRCDAALGMESGAIPDEHISASPLLD---------AAVNAIYGRAHVEAGGGAWCPRDMVYNEGKEFLEVNLGGLHVVAKVEVQGRFGNGQGREFARQYKLQFWRPGLAHWVTYADGRGNELLEGNTNTYLAQSSQLTPPIVAARVRFVPYSDH-PRTVCMRVEVYGCPYTDGLLSYSMPDGDPRGGDGAL----RDLTYDG--ARKDG--WLSGGLGQLTDGETGHTNFRVDALGRGRGYEWIGWKNDTRQTRP-VEITFEFDSVRNFSAVHIYTNNFFTKDTQVFSRARVLFSAGGEHFPAARAVEYEYVVDRIFENARN-------VTIRLRNSAAKFVKLQLFFA--LRWIMISEVAFDS 361          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ENSAMXT00000019857.2 (discoidin domain-containing receptor 2-like [Source:NCBI gene;Acc:103025914])

HSP 1 Score: 169.474 bits (428), Expect = 1.490e-42
Identity = 113/333 (33.93%), Postives = 166/333 (49.85%), Query Frame = 1
Query: 2413 DTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTEN--CTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMN--LHVYI-RLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            D  L       +T  E + +GQ+G+      N          G +D +   +   EN    V + +L + ++   R+ F  EI+I  RL +PNI  +LA+  +S        +  C  ITE   N  L+ ++ R +  + GE  K          +  T++Y +LI +A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF+  SDVWAFGVTLWE LT C +QPY   S+ QV++N       QN Q  YL RP  CP  ++ +++ CW      RP+F  IH  L
Sbjct:  546 DGALEEFPREKLTFKEKLGEGQFGEVHLCEAN----------GMQDFMKEDEDGVENEPILVAVKTLREDATKNTRNDFLKEIRIMSRLRDPNIIRLLAVCVES--------DPLC-MITEYMENGDLNKFLSRHKLQDSGEEQK---------DTSSTISYSTLIRMATQIASGMKYLSSLNFVHRDLATRNCLVGTNYTIKIADFGMS-RNLYRGDYYRI----QGRAVLPIRWMSWESILLGKFTMASDVWAFGVTLWETLTLCKEQPYSQLSDDQVIENTGEFFRDQNKQV-YLPRPACCPDAVHSLMQSCWRRNAKERPSFQHIHSTL 844          

HSP 2 Score: 94.7449 bits (234), Expect = 2.692e-19
Identity = 91/359 (25.35%), Postives = 163/359 (45.40%), Query Frame = 1
Query:  217 LPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSH-FNEWIEVDFKSINVINGIFTKGR---GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPV-DPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLE-----GLRDPY-FLGWYVSNAS-PIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESE---IEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAEN 1248
            + D+  SASS +   +   A   RL +        +   AWCP   A +    E++++D ++++ +  + T+GR   G GN  EF  + +I Y R+   R   +       +I  N +          P IIA  ++  PV DP  +  +C++  L+GC++ D  VSYS   G  M+  +++ +  +D  +DG          +  GLG LTD    L +       G+   Y ++GW  +NAS P   + + FE+++ RNFT +++    + +  +  F +    F+S +  E+     + +    N    RF     T+ L H + + +K +   ++   W++ SEI F S  A  N
Sbjct:   37 IQDEDISASSQWSESTA--ARYGRLDF-------DDGDGAWCPDVVAEAKSLKEFLQIDLRTLHFVTLVGTQGRHADGMGN--EFAQSYRIKYSRD-GVRWVSWHDRNGGQVIDGNKNPYEVVLKDLEPPIIARFVRFMPVSDP--SMTVCMRVELYGCEWLDGLVSYSAPVGQEMT-FQNLHVYLNDTVYDGTVDHS-----MTEGLGQLTDGSWGLDNFTQSQVYGVWPGYDYVGW--TNASFPSGSVEMVFEFDRVRNFTSMKVHCNNMYTSGVRAFQQAVCYFRSESDWEARPVSFKPEADNTNTSA-RF----VTVALGHRMASAIKCRFAFSDA--WMMFSEIAFQSGTAVYN 366          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr2a (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:103037878])

HSP 1 Score: 168.703 bits (426), Expect = 2.691e-42
Identity = 118/362 (32.60%), Postives = 181/362 (50.00%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILT--SLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G   + +  + +MD      +   + PR     +T  E + +GQ+G+         L  + ++  Y DE  +  +S +N TV++    L   ++  AR+ F  EI+I  RL +PNI  +LA+   S        +  C  ITE   N  +   L   E   +   L++         T++Y +L  +A+QIASGMK++     +HRDLA R+C+V  N  +KI + G    + +  DY  I         LPIRWM+ ES+   KF++ SDVWAFGVTLWE LT C +QPY   S+ QV++N       Q  Q  YL +P +CP   Y ++  CW+     RP+F EIH  L
Sbjct:  536 ADIVNLQGVTGGNTYAVPAL-TMDLLSGKDIAVEEFPR---KLLTFKEKLGEGQFGEVH-------LCEAEDMEDYMDEDFSFDVS-DNQTVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCMSS--------DPLC-MITEYMENGDLNQFLSRHEPEGMIALLSNAP-------TVSYNNLHHMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMS-RNLYSGDYYRI----QGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETLTFCKEQPYSQLSDEQVIENTGEFFRDQRRQI-YLPQPPLCPDPAYKLMLSCWNRNAKERPSFQEIHQVL 863          

HSP 2 Score: 107.457 bits (267), Expect = 3.245e-23
Identity = 102/363 (28.10%), Postives = 164/363 (45.18%), Query Frame = 1
Query:  223 DDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKAS-SHFNEWIEVDFKSINVINGIFTKGRGEGNFV-EFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPYF------------LGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLE------SEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAEN 1248
            D+  SASS + + +   A   RL          E   AWCP       +  E++++D +S++ I  + T+GR  G    EF  T KI Y R+   R   ++    + +I  N +A         P IIA  ++  PV   D  M +C++  L+GC++ D  VSY+   G  M  H S  I  +D  +DG          +  GLG LTD         GL D  F            +GW  + + P  Y+ I FE+++ RNFT +++    + SQ +  F KV   F+S +  E      S +  DV+ +     RF     T+ L++++ + +K Q + +++  W++ SEI F S  A  N
Sbjct:   51 DEDISASSQWSDSTA--AKYGRL-------DCEEGDGAWCPEIPGEPENMKEFLQIDLRSLHFITLVGTQGRHAGGIGNEFAQTYKIKYSRD-GSRWISWRNRHGKQVIEGNRNAYDVVLQDLQPPIIARFVRFMPV--IDHSMNVCMRVELYGCEWLDGLVSYNAPLGQKMILH-SQPIYLNDSVYDG-----AMSYSMTEGLGQLTDGMC------GLDDFTFSHVYNVWPGYDYVGW-TNESFPNGYVEIMFEFDRTRNFTTMKVHCNNMFSQRVKTFQKVVCYFRSESDWEPTPVSFSPVVDDVNPS----ARF----VTVSLNNHMASAIKCQYYFSDM--WMMFSEITFQSDTAMYN 378          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 158.688 bits (400), Expect = 5.669e-39
Identity = 111/370 (30.00%), Postives = 173/370 (46.76%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDY-LSIPLSDYTSIH----LPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCI 3411
            + ++ +Q V G+  + +  + +  T  P       LP L    +   E + +GQ+G+     +       ++L         RK       V +  L   +S  AR+ F  E++I  RL +PNI  +L +   S        +  C  +TE       Y+      +    + L D   P  +  T++Y +LI +ASQIASGMK +     +HRDLA R+C+V           G +     D     ++   DY  I     LPIRWMA E +   KF++ SDVWAFGVTLWE+L+ C +QPY + ++ QV+DN          Q  YLTRP +CP+ +Y+++  CW+     RP+F  +H FL    +
Sbjct:  630 ADIISLQGVSGNNTYAVPALSATPTDCP------PLPELPRERLIFKEKLGEGQFGEVHLCEIENP----QDLPNLEFPFNVRK--GRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIRLLGVCVSS--------DPLC-MVTE-------YMESGDLNQYLSQRVLLDKTGPLHNTPTISYPALISMASQIASGMKFLASLNFVHRDLATRNCLVGGERGDGEDRMGERHIKIADFGMSRNLYAGDYYRIQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSHMTDEQVIDNAGEFFRDHGRQI-YLTRPAVCPQGLYELMLSCWNRDCKLRPSFTHMHSFLAEDAM 970          

HSP 2 Score: 87.0409 bits (214), Expect = 7.157e-17
Identity = 87/330 (26.36%), Postives = 146/330 (44.24%), Query Frame = 1
Query:  322 ENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIY-EYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDN-------------RAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSN---------TKLESEIE--KDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVS 1230
            E   AWCP        +E+++V+   ++ ++ + T+GR  +G+  EF  + ++ Y R+  GR +  ++    Q +I  N +          P IIA  ++ YP+   D  M +C++  L+GC ++D   +Y+   G  M H     I  +D  +DG  I   +   L  GLG L D              R W G         ++GW    A   P + I F +EK R F  +Q+ S    +Q + +FS+V  +F+++          KL   +E  KD S  +V +   GG    +           L+ H    +RW+L+SEI+F S
Sbjct:   72 EGDGAWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSRD--GRQWITWKDRWGQEVISGNENTYDVVLKDLGPPIIARMVRFYPL--ADRVMSVCLRVELYGCVWNDGLKAYAAPMGHVM-HLSGSPIYLNDSIYDG-SIEAGT---LFGGLGQLCDGVLGGDDFMESKELRVWPGY-------DYVGWS-REALGQPTVDIEFHFEKTRIFHVMQVHSNNRHTQGVRVFSEVVCEFKASLLDHWTEPALKLRVPLEDLKDPSSRSVDLP-LGGRPAQI-----------LRCHFAFADRWLLISEISFNS 372          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 158.303 bits (399), Expect = 5.770e-39
Identity = 111/370 (30.00%), Postives = 173/370 (46.76%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDY-LSIPLSDYTSIH----LPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCI 3411
            + ++ +Q V G+  + +  + +  T  P       LP L    +   E + +GQ+G+     +       ++L         RK       V +  L   +S  AR+ F  E++I  RL +PNI  +L +   S        +  C  +TE       Y+      +    + L D   P  +  T++Y +LI +ASQIASGMK +     +HRDLA R+C+V           G +     D     ++   DY  I     LPIRWMA E +   KF++ SDVWAFGVTLWE+L+ C +QPY + ++ QV+DN          Q  YLTRP +CP+ +Y+++  CW+     RP+F  +H FL    +
Sbjct:  592 ADIISLQGVSGNNTYAVPALSATPTDCP------PLPELPRERLIFKEKLGEGQFGEVHLCEIENP----QDLPNLEFPFNVRK--GRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIRLLGVCVSS--------DPLC-MVTE-------YMESGDLNQYLSQRVLLDKTGPLHNTPTISYPALISMASQIASGMKFLASLNFVHRDLATRNCLVGGERGDGEDRMGERHIKIADFGMSRNLYAGDYYRIQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSHMTDEQVIDNAGEFFRDHGRQI-YLTRPAVCPQGLYELMLSCWNRDCKLRPSFTHMHSFLAEDAM 932          

HSP 2 Score: 86.6557 bits (213), Expect = 8.936e-17
Identity = 86/328 (26.22%), Postives = 145/328 (44.21%), Query Frame = 1
Query:  322 ENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIY-EYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDN-------------RAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSN---------TKLESEIE--KDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINF 1224
            E   AWCP        +E+++V+   ++ ++ + T+GR  +G+  EF  + ++ Y R  +GR +  ++    Q +I  N +          P IIA  ++ YP+   D  M +C++  L+GC ++D   +Y+   G  M H     I  +D  +DG  I   +   L  GLG L D              R W G         ++GW    A   P + I F +EK R F  +Q+ S    +Q + +FS+V  +F+++          KL   +E  KD S  +V +   GG    +           L+ H    +RW+L+SEI+F
Sbjct:   72 EGDGAWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSR--DGRQWITWKDRWGQEVISGNENTYDVVLKDLGPPIIARMVRFYPL--ADRVMSVCLRVELYGCVWNDGLKAYAAPMGHVM-HLSGSPIYLNDSIYDG-SIEAGT---LFGGLGQLCDGVLGGDDFMESKELRVWPGY-------DYVGWS-REALGQPTVDIEFHFEKTRIFHVMQVHSNNRHTQGVRVFSEVVCEFKASLLDHWTEPALKLRVPLEDLKDPSSRSVDLP-LGGRPAQI-----------LRCHFAFADRWLLISEISF 370          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 158.303 bits (399), Expect = 6.528e-39
Identity = 111/365 (30.41%), Postives = 172/365 (47.12%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDY-LSIPLSDYTSIH----LPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G+  + +  + +  T  P       LP L    +   E + +GQ+G+     +       ++L         RK       V +  L   +S  AR+ F  E++I  RL +PNI  +L +   S        +  C  +TE       Y+      +    + L D   P  +  T++Y +LI +ASQIASGMK +     +HRDLA R+C+V           G +     D     ++   DY  I     LPIRWMA E +   KF++ SDVWAFGVTLWE+L+ C +QPY + ++ QV+DN          Q  YLTRP +CP+ +Y+++  CW+     RP+F  +H FL
Sbjct:  649 ADIISLQGVSGNNTYAVPALSATPTDCP------PLPELPRERLIFKEKLGEGQFGEVHLCEIENP----QDLPNLEFPFNVRK--GRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIRLLGVCVSS--------DPLC-MVTE-------YMESGDLNQYLSQRVLLDKTGPLHNTPTISYPALISMASQIASGMKFLASLNFVHRDLATRNCLVGGERGDGEDRMGERHIKIADFGMSRNLYAGDYYRIQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSHMTDEQVIDNAGEFFRDHGRQI-YLTRPAVCPQGLYELMLSCWNRDCKLRPSFTHMHSFL 984          

HSP 2 Score: 87.4261 bits (215), Expect = 6.483e-17
Identity = 86/328 (26.22%), Postives = 145/328 (44.21%), Query Frame = 1
Query:  322 ENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIY-EYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDN-------------RAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSN---------TKLESEIE--KDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINF 1224
            E   AWCP        +E+++V+   ++ ++ + T+GR  +G+  EF  + ++ Y R  +GR +  ++    Q +I  N +          P IIA  ++ YP+   D  M +C++  L+GC ++D   +Y+   G  M H     I  +D  +DG  I   +   L  GLG L D              R W G         ++GW    A   P + I F +EK R F  +Q+ S    +Q + +FS+V  +F+++          KL   +E  KD S  +V +   GG    +           L+ H    +RW+L+SEI+F
Sbjct:   91 EGDGAWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSR--DGRQWITWKDRWGQEVISGNENTYDVVLKDLGPPIIARMVRFYPL--ADRVMSVCLRVELYGCVWNDGLKAYAAPMGHVM-HLSGSPIYLNDSIYDG-SIEAGT---LFGGLGQLCDGVLGGDDFMESKELRVWPGY-------DYVGWS-REALGQPTVDIEFHFEKTRIFHVMQVHSNNRHTQGVRVFSEVVCEFKASLLDHWTEPALKLRVPLEDLKDPSSRSVDLP-LGGRPAQI-----------LRCHFAFADRWLLISEISF 389          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001705.1 (pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 gene:ENSPMAG00000001543.1 transcript:ENSPMAT00000001705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.65 bits (335), Expect = 3.695e-35
Identity = 85/266 (31.95%), Postives = 138/266 (51.88%), Query Frame = 1
Query: 2620 SSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFM---NLHVYIRLQTTEKG--EITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQR 3402
            S + ++ F+ E  +    ++PNI  +L +   +V   F +L          FM   +L+ Y+R  ++E G    + P          P +L     +F+A+Q+A+GM ++ E+  +HRDLA R+C+V   L VKI++ G    S +  DY     +D     +PIRWM PES+F  +++S+SDVWAFGV LWE+ +H   QPY+  S+ +V      I   ++     L  P  CP ++Y+++R CW      RP+F  +   L R
Sbjct:    1 SPDMQANFHREAALMAEFTHPNIVKLLGVC--AVGKPFCLLFE--------FMPHGDLNEYLRRCSSEAGLAASSPPARAPTSSGSEPVSLCCADKLFVATQVAAGMAYLAERKFVHRDLATRNCLVGNRLVVKISDFGLS-QSIYAADYYKANEND----AIPIRWMPPESIFYNRYTSESDVWAFGVVLWEIFSH-GLQPYFGMSHEEV------IYFVRDGNV--LACPDGCPLDLYNLMRLCWAHAPADRPSFASVQHVLAR 242          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: NTRK2 (neurotrophic receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:8032])

HSP 1 Score: 135.961 bits (341), Expect = 7.450e-35
Identity = 91/283 (32.16%), Postives = 139/283 (49.12%), Query Frame = 1
Query: 2542 YRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMN--LHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEI 3384
            Y  E  +  +  E   V   +L D S   AR  FY E ++   L + +I     +    VEG+  I+      + E   N  L+ ++RL    +G     + D   P   P  L+   ++ + SQIA+GM ++  Q  +HRDLA R+C+V   L VKI + G      +  DY  +         LPIRWM PES+   KF++ SDVW+ GV LWE+ T+  +QP+Y  SN++V+D +         Q   L RP+ CP E+Y+++  CWH    +R    +I
Sbjct:   91 YLAECSSLDVGQEPMLVAAKTLKDLSDG-ARKDFYREAELLTNLQHEHIVRFYGV---CVEGEPLIM------VFEYMKNGDLNKFLRL----RGPDAVFMGDA--PQAEPRLLSQAQMLNMGSQIAAGMAYLASQHFVHRDLATRNCLVGAGLVVKIGDFGMS-RDVYSTDYYRVG----GHTMLPIRWMPPESIMYRKFTADSDVWSLGVVLWEIFTY-GKQPWYQLSNTEVIDCI--------CQGRVLERPRSCPMEVYELMLGCWHREPQHRLGIKDI 343          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009485.1 (pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 2.534e-31
Identity = 79/271 (29.15%), Postives = 132/271 (48.71%), Query Frame = 1
Query: 2578 ENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFM--NLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEI 3384
            +   V + ++N+ ++   R +F NE  +    +  ++  +L +V+ +              I E     +L  Y+R    +  + T+ +     P + P +L    ++ +A +IA GM ++  +  +HRDLA R+CMV  +  VKI + G      ++ DY            LP+RWM+PESL +  F++ SDVW+FGV LWE+ T   +QPY   SN QV+  + +  L        L  P  CP+ + ++IR+CW      RP F EI
Sbjct:   40 DETRVAIKTVNETATMRERYEFLNEASVMKSFNCHHVVRLLGVVSQA---------QPILVIMELMTRGDLKSYLRSLRPDAEDFTETIVLEKKPTRPPSSLP--EMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFG-MTRDIYETDYYRKGGKGL----LPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQA-EQPYQGLSNEQVLKFVMDGGL--------LVLPPACPERLQELIRKCWQYNPRMRPTFLEI 285          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009339.1 (pep scaffold:Pmarinus_7.0:GL479558:1022:6538:1 gene:ENSPMAG00000008449.1 transcript:ENSPMAT00000009339.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 1.480e-30
Identity = 76/222 (34.23%), Postives = 113/222 (50.90%), Query Frame = 1
Query: 2620 SSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMN--LHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQ 3279
            +  +R+ F  EI+I  RL +PNI  +L +          + +     ITE  +N  L+ ++    +  G+I             P  L+   L+++ASQI SGM ++     +HRDLA R+C+V  +  +KI + G    + +  DY  I         LPIRWMA ES+   KF+  SDVWAFGVTLWE+LT C +QPY   ++ QV++N       Q  Q
Sbjct:    4 ARSSRNDFLKEIKIMSRLKDPNIVRLLGVC---------MRDDPLSMITEYMVNGDLNQFLSRLPSAIGDIFIFFAPHQKLISVPPKLD--KLVYMASQIVSGMAYLSSLNFVHRDLATRNCLVGEHHTIKIADFGMS-RNLYSGDYYRIQ----GRAVLPIRWMAWESILLGKFTPASDVWAFGVTLWEMLTLCREQPYGALTDEQVIENTGEFFRDQGRQ 209          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009481.1 (pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009481.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 2.827e-29
Identity = 89/306 (29.08%), Postives = 142/306 (46.41%), Query Frame = 1
Query: 2476 QYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFM--NLHVYIR-LQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEI 3384
            + GQ    ++ E L  +R +    DE            V + ++N+ ++   R +F NE  +    +  ++  +L +V+ +              I E     +L  Y+R L+   + + T+P      P   PE L       +A +IA GM ++  +  +HRDLA R+CMV  +  VKI + G      ++ DY            LP+RWM+PESL +  F++ SDVW+FGV LWE+ T   +QPY   SN QV+  + +  L        L  P  CP+ + ++IR+CW      RP F EI
Sbjct:   66 ELGQGTFGMVYEGL--ARGIVKGEDET----------RVAIKTVNETATMRERYEFLNEASVMKSFNCHHVVRLLGVVSQA---------QPILVIMELMTRGDLKSYLRSLRPDAEKKPTRP------PSSLPEMLQ------MAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFG-MTRDIYETDYYR----KGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQA-EQPYQGLSNEQVLKFVMDGGL--------LVLPPACPERLQELIRKCWQYNPRMRPTFLEI 324          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 60.077 bits (144), Expect = 1.652e-9
Identity = 39/161 (24.22%), Postives = 81/161 (50.31%), Query Frame = 1
Query: 2755 GFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQV 3237
            GFI + +    +YI L+    G + + ++  +      E+  Y       +Q   G+K++  +G++HRD+   + +++ +  VK+ + G  +S+  +   L++  +        + WMAPE L N   S+ SD+W+ G T+ E+LT     PY+  +++ +
Sbjct:   87 GFIRKSY---ELYILLEYCANGSLRRLISRSSTGLSENESKTY------VTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFG--VSTIVNSSALTLAGT--------LNWMAPEILGNRGASTLSDIWSLGATVVEMLT--KNPPYHNLTDANI 226          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 58.5362 bits (140), Expect = 4.836e-9
Identity = 34/146 (23.29%), Postives = 69/146 (47.26%), Query Frame = 1
Query: 2752 CGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVL 3189
              FI    +   +++ ++  E G +T  +T C         L  G +  +  +  SG++ +  +G+LHRD+   + +++M   +K+T+ G      F      + L   T +  P  WMAPE +   ++  K D+W+ G+ + E++
Sbjct:  678 VNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHC--------ILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFG------FCAQINELNLKRTTMVGTPY-WMAPEVVSRKEYGPKVDIWSLGIMIIEMI 808          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 56.6102 bits (135), Expect = 1.927e-8
Identity = 45/173 (26.01%), Postives = 75/173 (43.35%), Query Frame = 1
Query: 2875 LNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMF 3393
            LN   + +I  +   G+K +  + I+HRD+   + ++N    VKIT+ G      F V+         T +  P  WMAPE +    +  K DVW+ G+ L E++    + PY    N   +  LY  L+A N     L  P+   K+    +  C     + R +  ++  F
Sbjct:  479 LNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFG------FCVELTEKRSKRATMVGTPY-WMAPEIVNQKGYDEKVDVWSLGIMLIEMIE--GEPPYL---NEDPLKALY--LIANNGS-PKLRHPESVSKQTKQFLDACLQVNVESRASVRKLLTF 636          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: PSK1 (PAS domain-containing serine/threonine protein kinase; coordinately regulates protein synthesis and carbohydrate metabolism and storage in response to a unknown metabolite that reflects nutritional status; PSK1 has a paralog, PSK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000015])

HSP 1 Score: 55.0694 bits (131), Expect = 6.802e-8
Identity = 39/115 (33.91%), Postives = 58/115 (50.43%), Query Frame = 1
Query: 2884 GSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQI---SSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSK-SDVWAFGVTLWEVLTHCNQQPYY 3216
              LIF   Q+ +G+KH+ +QGI+HRD+   + +V+    VKI + G      S PFDV   +I   DY          APE L    +  +  D+WA G+ L+ V+   N  P+Y
Sbjct: 1207 AKLIF--KQVVAGIKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPFDVFVGTI---DYA---------APEVLGGNPYEGQPQDIWAIGILLYTVVFKEN--PFY 1305          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: PSK2 (PAS-domain containing serine/threonine protein kinase; regulates sugar flux and translation in response to an unknown metabolite by phosphorylating Ugp1p and Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p (translation); PSK2 has a paralog, PSK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005405])

HSP 1 Score: 55.0694 bits (131), Expect = 6.841e-8
Identity = 37/115 (32.17%), Postives = 58/115 (50.43%), Query Frame = 1
Query: 2884 GSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQI---SSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSK-SDVWAFGVTLWEVLTHCNQQPYY 3216
              L+F   Q+ + +KH+ +QGI+HRD+   + +V+ +  VK+ + G      S PFDV    +   DY          APE L  + +  K  D+WA GV L+ ++   N  PYY
Sbjct:  952 AKLVF--KQVVASIKHLHDQGIVHRDIKDENVIVDSHGFVKLIDFGSAAYIKSGPFDV---FVGTMDYA---------APEVLGGSSYKGKPQDIWALGVLLYTIIYKEN--PYY 1050          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO44269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW90])

HSP 1 Score: 149.443 bits (376), Expect = 2.349e-40
Identity = 84/261 (32.18%), Postives = 136/261 (52.11%), Query Frame = 1
Query: 2632 RSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMN--LHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQ-FHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRK 3405
            +  F+ E++I   + + N+  +L +  D         +  C  I E   N  L+ +++ +    G               P  + Y +L+++A Q+A+GMK++     +HRDLA R+C+V  +  VKI + G      +   Y  I       + LPIRWMAPE +   KF+S SDVWAFGVTLWE+LT   + PY   ++ +V++N+  +     S    +L+RP+ICP ++Y  +R CW      RP+FH+IH FL+ +
Sbjct:   11 KQDFFKEVKIMAGVRHENVVRLLGVCKD---------DPMC-MIVEYMENGDLNQFLKQRELASGNSA-----------DPNKVTYQALLYMALQLAAGMKYIASHQFVHRDLATRNCLVGHSFTVKIADFGMS-RHLYSKHYYRIQ----GRVILPIRWMAPECILQGKFTSASDVWAFGVTLWEILTLAAEYPYGDLTDEKVIENVQLMFFRPKSDAITFLSRPEICPPDVYAKMRSCWAIEPSARPDFHDIHSFLENR 245          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO45490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSX1])

HSP 1 Score: 125.176 bits (313), Expect = 2.941e-32
Identity = 79/256 (30.86%), Postives = 135/256 (52.73%), Query Frame = 1
Query: 2590 VILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIH----LPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECW 3345
            V + +L    S+E ++ F  E+ +   L +PNI  +LA+ T+  E  +G++     F+++   +L+ Y+R    ++G          Y  +  ++L    L+ I+ Q++SGM+H++    +HRDLA R+C+V   L VKI + G             +  SDY  +     +PIRWM PE+L   +F+ +SDV++FGV LWEV      QPYY ++N +V   +   +        +L +P+ CP  IYD+++ CW
Sbjct:    4 VAVKTLKQGCSNEMKTSFLQEVTLMAVLHHPNIVELLAVSTE--EEPYGMIFE---FMSQG--DLNQYMR----KRG---------PYSLEEEKSLTQEDLLSISLQVSSGMEHLQSMRFVHRDLATRNCLVGDGLVVKIADFGMS---------RDVYASDYYKVEGQAVMPIRWMPPEALLYGRFTVESDVYSFGVLLWEVYAFA-LQPYYGYTNEEVCGFIKKGV--------HLGKPEDCPDHIYDVMKSCW 221          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO39761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S933])

HSP 1 Score: 119.398 bits (298), Expect = 3.326e-30
Identity = 77/243 (31.69%), Postives = 128/243 (52.67%), Query Frame = 1
Query: 2671 LSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQ 3399
            L +PN+  +LA+ T+  E  +G++     F+ E   +L+ Y+R          KP    AY  + P+      L+ IA Q+A+GM+++     +HRDLA R+C+V  ++ VKI + G      +  DY  +         LPIRW+APE+    KF+ KSDV+++GV LWE+ T    QPYY ++N +V + +   +        +L RP  CP+ +Y ++++CW    + R +F  I   L+
Sbjct:   18 LDHPNVVKLLAVSTE--EEPYGMIFE---FMGEG--DLNHYLR--------SAKPAESSAY--KGPDDAK--DLVGIAEQVAAGMEYVASLRFVHRDLATRNCLVGTDMVVKIADFGMS-RDVYGSDYYKMS----RETMLPIRWLAPEAFLYGKFTVKSDVYSYGVLLWEIFTF-GLQPYYGYTNKEVTEFIKKGI--------HLGRPDDCPQFVYLIMKDCWSREPEERVDFGLIQKRLR 227          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO48215 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKA9])

HSP 1 Score: 125.176 bits (313), Expect = 2.329e-29
Identity = 82/274 (29.93%), Postives = 132/274 (48.18%), Query Frame = 1
Query: 2587 TVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEI-TKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIH---LPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            +V++ SL +    + R +F+ + +   +L +PNI  I+ +   SV                C   L+ Y+   T  +  +   P+ D     +  + L    LI IA Q+A+GM ++    I+H DLA R+CMV     VKIT+          +  L      Y  +H   LP+RWMAPE++ + +F+ ++D+W+FGV LWE+ ++   QP++ +SN  VM  L   +L        L  P  CP  +Y +++ECW      RP F  IH  L
Sbjct:  433 SVLVVSLRESHEVDVRDEFFEKAEAWSKLQHPNIITIVGMCNKSV--------------PTCV--LYEYLEYGTLHEYLVRNAPIDDPEAEEEIADPLWCDGLISIAYQVAAGMNYLSSNNIVHGDLATRNCMVGPGRTVKITD--------VALTRLGYSHDYYRQLHRRPLPVRWMAPEAILSYRFTPETDIWSFGVLLWELFSY-GAQPHFGFSNEDVMFRLRECIL--------LPCPVDCPASVYRLMKECWDILPPSRPRFSTIHTHL 673          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO33736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD7])

HSP 1 Score: 120.939 bits (302), Expect = 2.800e-29
Identity = 85/283 (30.04%), Postives = 138/283 (48.76%), Query Frame = 1
Query: 2542 YRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSI--HLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEI 3384
            YR  + N   + E   V +  L   SS + R  F  E  I  +  +PN+ A+  ++T +              ITE   N  +   L++ + G +T              TL    L+ I   +A+GM ++ E   +HRDLA R+ +V+ NL  K+++ G  +S   D D      S+Y +    +P+RW APE++   KFSS SDVW++G+ LWE+++   ++PY+ W N QVMD +           + L  P  CPK I++++ +CW   +  RP F +I
Sbjct:   42 YRGVLTNEDKTQEKVAVKI--LKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRT---------RPMMIITEFLENGSLDNFLKSND-GRLT--------------TL---QLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFG--LSRELD-DSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSF-GERPYWTWDNFQVMDRV--------EGGYRLPAPMKCPKVIHNLMLDCWDKEKTSRPKFADI 283          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr2b (discoidin domain-containing receptor 2 [Source:NCBI gene;Acc:101156357])

HSP 1 Score: 166.777 bits (421), Expect = 9.921e-42
Identity = 108/336 (32.14%), Postives = 166/336 (49.40%), Query Frame = 1
Query: 2398 PMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILN-RKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIY-DMIRECWHPTEDYRPNFHEIHMFLQ 3399
            P    D+ L       ++  E + +GQ+G+         L  +  +  + DE L+  ++S     V + +L + ++  AR+ F  EI+I  RL +PNI  +LA+  D+                       +++  +  E G++ + L+     F     L+Y  LI +A QIASGMK++     +HRDLA R+C+V  N  ++I + G    + +  DY  I         LPIRWM+ ES+   KF+  SDVWAFGVTLWE+LT C +QPY   S+ QV++N       +  Q  YL +P  CP  +Y D++  CW      RP+F EIH  LQ
Sbjct:  537 PFTGTDSSLREFPREKLSFKEKLGEGQFGEVH-------LCEAEGMQDFLDEDLSVGEISESLLLVAVKTLREDANKNARNDFLKEIRIMSRLRDPNIVRLLAVCVDTDP---------------------LWMITEYMENGDLNQFLSRSKIFFLFG-ALSYTKLINMAVQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIRIADFGMS-RNLYKGDYYRIQ----GRAVLPIRWMSWESILLGKFTMASDVWAFGVTLWEILTLCKEQPYSQLSDEQVIENTGEFFRDKGKQV-YLPKPPCCPDSVYNDLMLSCWRRNAKQRPSFQEIHAQLQ 837          

HSP 2 Score: 111.694 bits (278), Expect = 1.829e-24
Identity = 90/320 (28.12%), Postives = 156/320 (48.75%), Query Frame = 1
Query:  331 NAWCPHKKASSH-FNEWIEVDFKSINVINGIFTKGR---GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWL-----GSLEGLRDPY-FLGWYVSNAS-PIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLES---EIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAEN 1248
             AWCP   +  H   E+++VD +S++ I  + T+GR   G GN  EF    +I Y R+ +  +  +Q  + Q +I  N +A         P IIA  ++  PV  + + ++C++  L+GC++ D  VSYS  DG  M  ++ + ++ +D  +DG          L  GLG LTD    L       + G+   Y ++GW  SN + P  Y+ + F+++  RNFT +++ +  + S+ + +F +V   F S+++ E           R + Q  RF     T+ L       +K + H +++  W+L SE+ F S  A  N
Sbjct:   73 GAWCPDIMSEPHGLKEYLQVDLRSLHFITLVGTQGRHADGMGN--EFAQRYRIKYSRDGSNWV-SWQDRKGQQVIEGNRNAYDVVLKDLEPPIIARYVRFMPVTDH-SMIVCMRVELYGCEWLDGLVSYSIPDGHQMI-YRDLEVSFNDSVYDGAS--------LTKGLGQLTDGTWGLDDFLHSQIYGVWPGYDYVGW--SNRTFPKGYVEMIFDFDHVRNFTSMKVHTSNMFSRGVRVFRQVTCFFWSDSEWEPGPITFRPTPDRVS-QRARF----VTVTLGDRTAKTIKCRFHFSDV--WMLFSEVAFQSGSAVYN 370          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 159.458 bits (402), Expect = 3.278e-39
Identity = 114/371 (30.73%), Postives = 174/371 (46.90%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNL-----------QVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G+  + +  + S       G     LP L    +   E + +GQ+G+     +       ++L         RK       V +  L   +S  AR+ F  E++I  RL +PNI  +L +   S          +CG       +L+ Y+  +          L D   P  +  T++Y +LI IASQIASGMK +     +HRDLA R+C+V  +            Q+KI + G    + +  DY  I         LPIRWMA E +   KF++ SDVWAFGVTLWE+L+ C +QPY   ++ QV+DN       Q  Q  YL +P +CP+ +Y+++  CW+     RP+F  IH FL
Sbjct:  654 ADIVSLQGVSGNNTYAVPALASSSP----GADAASLPELPRQCLIFKEKLGEGQFGEVHLCEIENP----QDLPSLEFPFNVRK--GRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIQLLGVCVSSDPLCMVTEYMECG-------DLNQYLSHRV---------LLDKTGPSHNAPTISYPALISIASQIASGMKFLSSLNFVHRDLATRNCLVGGDRGENGEDRGGERQIKIADFGMS-RNLYAGDYYRI----QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSNLTDEQVIDNAGEFFRDQGRQV-YLGKPAVCPQGLYELMLSCWNRDCKLRPSFAHIHSFL 992          

HSP 2 Score: 87.4261 bits (215), Expect = 5.746e-17
Identity = 110/500 (22.00%), Postives = 202/500 (40.40%), Query Frame = 1
Query:  202 MEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDN-------------RAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLE-SEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVSENLSSSKLKPNIQKRN-TTEINRQVVQR------------KNNENFVPNISGR---------------DIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYMIGNEIGSI 1569
            ME   +PD   SASS++ + +  +A   RL          E   AWCP        +E++++D   ++ +  + T+GR  +G+  EF  + ++ Y R+   +   ++    Q ++  NT+          P I+A  ++ YP+   D  M +C++  L+GC ++D   +Y++  G  M +   + +  +D  +DG       + +   GLG L D              R W G         ++GW    A     + I F +EK R F  +Q+ S    +Q + +FSKV   F+    L  S     +      +        ++ L      ++  + +    +RW+L+SEI+F+S    E+      S +L       +    N TT +                     N +F+ + SG                 +  D   +T + +  + G+ILL+  +++IAVI +     RQY K      ++G   GS+
Sbjct:   41 MEAGTIPDSDISASSAWSDST--EAKHGRL-------STGEGDGAWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSRD-GVKWITWKDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPL--ADRVMSVCLRVELYGCVWNDGLKAYTSPVGHVM-NLPGLPVYLNDSIYDG----STEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGY-------DYVGWS-REALGQGSVDIEFHFEKPRLFINMQVHSNNRHTQGVRVFSKVECLFKLGILLPWSSPPLTLPVPLEDLKDPSSRPISIPLGRRPAQILLCKFYFA--DRWLLISEISFLSEPYEEDTDAESFSYHLPKDPGTTSSAPVNVTTPVFTSSFSSPSTNTRPSEPLSSTNTSFMRDTSGNWTVSESAAVTPRAGLPVAKDDSSNTAILIGCLVGIILLL--LAVIAVILW-----RQYWKK-----ILGKAQGSL 501          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 159.458 bits (402), Expect = 3.278e-39
Identity = 114/371 (30.73%), Postives = 174/371 (46.90%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNL-----------QVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G+  + +  + S       G     LP L    +   E + +GQ+G+     +       ++L         RK       V +  L   +S  AR+ F  E++I  RL +PNI  +L +   S          +CG       +L+ Y+  +          L D   P  +  T++Y +LI IASQIASGMK +     +HRDLA R+C+V  +            Q+KI + G    + +  DY  I         LPIRWMA E +   KF++ SDVWAFGVTLWE+L+ C +QPY   ++ QV+DN       Q  Q  YL +P +CP+ +Y+++  CW+     RP+F  IH FL
Sbjct:  654 ADIVSLQGVSGNNTYAVPALASSSP----GADAASLPELPRQCLIFKEKLGEGQFGEVHLCEIENP----QDLPSLEFPFNVRK--GRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIQLLGVCVSSDPLCMVTEYMECG-------DLNQYLSHRV---------LLDKTGPSHNAPTISYPALISIASQIASGMKFLSSLNFVHRDLATRNCLVGGDRGENGEDRGGERQIKIADFGMS-RNLYAGDYYRI----QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSNLTDEQVIDNAGEFFRDQGRQV-YLGKPAVCPQGLYELMLSCWNRDCKLRPSFAHIHSFL 992          

HSP 2 Score: 87.4261 bits (215), Expect = 5.746e-17
Identity = 110/500 (22.00%), Postives = 202/500 (40.40%), Query Frame = 1
Query:  202 MEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDN-------------RAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLE-SEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVSENLSSSKLKPNIQKRN-TTEINRQVVQR------------KNNENFVPNISGR---------------DIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYMIGNEIGSI 1569
            ME   +PD   SASS++ + +  +A   RL          E   AWCP        +E++++D   ++ +  + T+GR  +G+  EF  + ++ Y R+   +   ++    Q ++  NT+          P I+A  ++ YP+   D  M +C++  L+GC ++D   +Y++  G  M +   + +  +D  +DG       + +   GLG L D              R W G         ++GW    A     + I F +EK R F  +Q+ S    +Q + +FSKV   F+    L  S     +      +        ++ L      ++  + +    +RW+L+SEI+F+S    E+      S +L       +    N TT +                     N +F+ + SG                 +  D   +T + +  + G+ILL+  +++IAVI +     RQY K      ++G   GS+
Sbjct:   41 MEAGTIPDSDISASSAWSDST--EAKHGRL-------STGEGDGAWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSRD-GVKWITWKDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPL--ADRVMSVCLRVELYGCVWNDGLKAYTSPVGHVM-NLPGLPVYLNDSIYDG----STEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGY-------DYVGWS-REALGQGSVDIEFHFEKPRLFINMQVHSNNRHTQGVRVFSKVECLFKLGILLPWSSPPLTLPVPLEDLKDPSSRPISIPLGRRPAQILLCKFYFA--DRWLLISEISFLSEPYEEDTDAESFSYHLPKDPGTTSSAPVNVTTPVFTSSFSSPSTNTRPSEPLSSTNTSFMRDTSGNWTVSESAAVTPRAGLPVAKDDSSNTAILIGCLVGIILLL--LAVIAVILW-----RQYWKK-----ILGKAQGSL 501          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 159.073 bits (401), Expect = 3.470e-39
Identity = 114/371 (30.73%), Postives = 174/371 (46.90%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNL-----------QVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G+  + +  + S       G     LP L    +   E + +GQ+G+     +       ++L         RK       V +  L   +S  AR+ F  E++I  RL +PNI  +L +   S          +CG       +L+ Y+  +          L D   P  +  T++Y +LI IASQIASGMK +     +HRDLA R+C+V  +            Q+KI + G    + +  DY  I         LPIRWMA E +   KF++ SDVWAFGVTLWE+L+ C +QPY   ++ QV+DN       Q  Q  YL +P +CP+ +Y+++  CW+     RP+F  IH FL
Sbjct:  614 ADIVSLQGVSGNNTYAVPALASSSP----GADAASLPELPRQCLIFKEKLGEGQFGEVHLCEIENP----QDLPSLEFPFNVRK--GRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIQLLGVCVSSDPLCMVTEYMECG-------DLNQYLSHRV---------LLDKTGPSHNAPTISYPALISIASQIASGMKFLSSLNFVHRDLATRNCLVGGDRGENGEDRGGERQIKIADFGMS-RNLYAGDYYRI----QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSNLTDEQVIDNAGEFFRDQGRQV-YLGKPAVCPQGLYELMLSCWNRDCKLRPSFAHIHSFL 952          

HSP 2 Score: 87.8113 bits (216), Expect = 4.808e-17
Identity = 113/510 (22.16%), Postives = 204/510 (40.00%), Query Frame = 1
Query:  202 MEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDN-------------RAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLES-----------EIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVSENLSSSKLKPNIQKRN-TTEINRQVVQR------------KNNENFVPNISGR---------------DIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYMIGNEIGSI 1569
            ME   +PD   SASS++ + +  +A   RL          E   AWCP        +E++++D   ++ +  + T+GR  +G+  EF  + ++ Y R+   +   ++    Q ++  NT+          P I+A  ++ YP+   D  M +C++  L+GC ++D   +Y++  G  M +   + +  +D  +DG       + +   GLG L D              R W G         ++GW    A     + I F +EK R F  +Q+ S    +Q + +FSKV   F+    L             E  KD S   +          ++ L      ++  + +    +RW+L+SEI+F+S    E+      S +L       +    N TT +                     N +F+ + SG                 +  D   +T + +  + G+ILL+  +++IAVI +     RQY K      ++G   GS+
Sbjct:   41 MEAGTIPDSDISASSAWSDST--EAKHGRL-------STGEGDGAWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSRD-GVKWITWKDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPL--ADRVMSVCLRVELYGCVWNDGLKAYTSPVGHVM-NLPGLPVYLNDSIYDG----STEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGY-------DYVGWS-REALGQGSVDIEFHFEKPRLFINMQVHSNNRHTQGVRVFSKVECLFKLGILLPWSSPPLTLPVPLEDLKDPSSRPI----------SIPLGRRPAQILLCKFYFA--DRWLLISEISFLSEPYEEDTDAESFSYHLPKDPGTTSSAPVNVTTPVFTSSFSSPSTNTRPSEPLSSTNTSFMRDTSGNWTVSESAAVTPRAGLPVAKDDSSNTAILIGCLVGIILLL--LAVIAVILW-----RQYWKK-----ILGKAQGSL 501          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 159.073 bits (401), Expect = 3.806e-39
Identity = 114/371 (30.73%), Postives = 174/371 (46.90%), Query Frame = 1
Query: 2317 SKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNL-----------QVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFL 3396
            + ++ +Q V G+  + +  + S       G     LP L    +   E + +GQ+G+     +       ++L         RK       V +  L   +S  AR+ F  E++I  RL +PNI  +L +   S          +CG       +L+ Y+  +          L D   P  +  T++Y +LI IASQIASGMK +     +HRDLA R+C+V  +            Q+KI + G    + +  DY  I         LPIRWMA E +   KF++ SDVWAFGVTLWE+L+ C +QPY   ++ QV+DN       Q  Q  YL +P +CP+ +Y+++  CW+     RP+F  IH FL
Sbjct:  633 ADIVSLQGVSGNNTYAVPALASSSP----GADAASLPELPRQCLIFKEKLGEGQFGEVHLCEIENP----QDLPSLEFPFNVRK--GRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIQLLGVCVSSDPLCMVTEYMECG-------DLNQYLSHRV---------LLDKTGPSHNAPTISYPALISIASQIASGMKFLSSLNFVHRDLATRNCLVGGDRGENGEDRGGERQIKIADFGMS-RNLYAGDYYRI----QGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSNLTDEQVIDNAGEFFRDQGRQV-YLGKPAVCPQGLYELMLSCWNRDCKLRPSFAHIHSFL 971          

HSP 2 Score: 95.9005 bits (237), Expect = 1.362e-19
Identity = 109/479 (22.76%), Postives = 199/479 (41.54%), Query Frame = 1
Query:  202 MEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGR-GEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDN-------------RAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLE-SEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVSENLSSSKLKPNIQKRNTTEINRQVVQRKNNENFVPNIS-------GRDIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYMIGNEIGSI 1569
            ME   +PD   SASS++ + +  +A   RL          E   AWCP        +E++++D   ++ +  + T+GR  +G+  EF  + ++ Y R+   +   ++    Q ++  NT+          P I+A  ++ YP+   D  M +C++  L+GC ++D   +Y++  G  M +   + +  +D  +DG       + +   GLG L D              R W G         ++GW    A     + I F +EK R F  +Q+ S    +Q + +FSKV   F+    L  S     +      +        ++ L      ++  + +    +RW+L+SEI+F+S    E+      S +L       +    N T           + N  P+ S       G  +  D   +T + +  + G+ILL+  +++IAVI +     RQY K      ++G   GS+
Sbjct:   41 MEAGTIPDSDISASSAWSDST--EAKHGRL-------STGEGDGAWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSRD-GVKWITWKDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPL--ADRVMSVCLRVELYGCVWNDGLKAYTSPVGHVM-NLPGLPVYLNDSIYDG----STEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGY-------DYVGWS-REALGQGSVDIEFHFEKPRLFINMQVHSNNRHTQGVRVFSKVECLFKLGILLPWSSPPLTLPVPLEDLKDPSSRPISIPLGRRPAQILLCKFYFA--DRWLLISEISFLSEPYEEDTDAESFSYHLPKDPGTTSSAPVNVTTPVFTSSFSSPSTNTRPSESAAVTPRAGLPVAKDDSSNTAILIGCLVGIILLL--LAVIAVILW-----RQYWKK-----ILGKAQGSL 480          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000051409.1 (SMESG000051409.1)

HSP 1 Score: 2275.74 bits (5896), Expect = 0.000e+0
Identity = 1109/1130 (98.14%), Postives = 1110/1130 (98.23%), Query Frame = 1
Query:   70 MKNSMEIFLKTLFVSLLIKIHNGNNDLQSVYIVRSSKNNCWTSLMEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVSENLSSSKLKPNIQKRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYMIGNEIGSIYQQYSQTEKIKSFLSPNLQQSHSLTSDNSSFDCPVGRILDTSIYSSLPHKTTKDAKTIRDDERYLLKEYXXXXXX--TIMNPSSAFNISPFSNKENTIKNPSLTTYSWTTNEQLYKTNGHEYASATLFPSSYPGIQYKRPSGSSIMLKNDCLSSPAPSPYHLIKNSPLFPNSPLGMSQLPATIQIIANPYFDHIDKTSVPTSNDIPTPVASHKSYSILSNDSNTPSPYSMSKNSLMCWTSPEANYFSNFDFSKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGYFNTENGFSRPMI 3453
            MKNSMEIFLKTLFVSLLIKIHNGNNDLQSVYIVRSSKNNCWTSLMEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSE               KRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYMIGNEIGSIYQQYSQTEKIKSFLSPNLQQSHSLTSDNSSFDCPVGRILDTSIYSSLPHKTTKDAKTIRDDE YLLKEYNNNNNN  TIMNPSSAFNISPFSNKENTIKNPSLTTYSWTTNEQLYKTNGHEYASATLFPSSYPGIQYKRPSGSSIMLKNDC SSPAPSPYHLIKNSPLFPNSPLGMSQLPATIQIIANPYFDHIDK+SVP SNDIPTPVASHKSYSILSNDSNTPSPYSMSKNSLMCWTSPEANYFSNFDFSKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGYFNTENGFSRPMI
Sbjct:    1 MKNSMEIFLKTLFVSLLIKIHNGNNDLQSVYIVRSSKNNCWTSLMEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSE---------------KRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYMIGNEIGSIYQQYSQTEKIKSFLSPNLQQSHSLTSDNSSFDCPVGRILDTSIYSSLPHKTTKDAKTIRDDETYLLKEYNNNNNNNNTIMNPSSAFNISPFSNKENTIKNPSLTTYSWTTNEQLYKTNGHEYASATLFPSSYPGIQYKRPSGSSIMLKNDCQSSPAPSPYHLIKNSPLFPNSPLGMSQLPATIQIIANPYFDHIDKSSVPISNDIPTPVASHKSYSILSNDSNTPSPYSMSKNSLMCWTSPEANYFSNFDFSKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGYFNTENGFSRPMI 1115          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000051409.1 (SMESG000051409.1)

HSP 1 Score: 2268.43 bits (5877), Expect = 0.000e+0
Identity = 1105/1126 (98.13%), Postives = 1106/1126 (98.22%), Query Frame = 1
Query:   82 MEIFLKTLFVSLLIKIHNGNNDLQSVYIVRSSKNNCWTSLMEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVSENLSSSKLKPNIQKRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYMIGNEIGSIYQQYSQTEKIKSFLSPNLQQSHSLTSDNSSFDCPVGRILDTSIYSSLPHKTTKDAKTIRDDERYLLKEYXXXXXX--TIMNPSSAFNISPFSNKENTIKNPSLTTYSWTTNEQLYKTNGHEYASATLFPSSYPGIQYKRPSGSSIMLKNDCLSSPAPSPYHLIKNSPLFPNSPLGMSQLPATIQIIANPYFDHIDKTSVPTSNDIPTPVASHKSYSILSNDSNTPSPYSMSKNSLMCWTSPEANYFSNFDFSKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGYFNTENGFSRPMI 3453
            MEIFLKTLFVSLLIKIHNGNNDLQSVYIVRSSKNNCWTSLMEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSE               KRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYMIGNEIGSIYQQYSQTEKIKSFLSPNLQQSHSLTSDNSSFDCPVGRILDTSIYSSLPHKTTKDAKTIRDDE YLLKEYNNNNNN  TIMNPSSAFNISPFSNKENTIKNPSLTTYSWTTNEQLYKTNGHEYASATLFPSSYPGIQYKRPSGSSIMLKNDC SSPAPSPYHLIKNSPLFPNSPLGMSQLPATIQIIANPYFDHIDK+SVP SNDIPTPVASHKSYSILSNDSNTPSPYSMSKNSLMCWTSPEANYFSNFDFSKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGYFNTENGFSRPMI
Sbjct:    1 MEIFLKTLFVSLLIKIHNGNNDLQSVYIVRSSKNNCWTSLMEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSE---------------KRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYMIGNEIGSIYQQYSQTEKIKSFLSPNLQQSHSLTSDNSSFDCPVGRILDTSIYSSLPHKTTKDAKTIRDDETYLLKEYNNNNNNNNTIMNPSSAFNISPFSNKENTIKNPSLTTYSWTTNEQLYKTNGHEYASATLFPSSYPGIQYKRPSGSSIMLKNDCQSSPAPSPYHLIKNSPLFPNSPLGMSQLPATIQIIANPYFDHIDKSSVPISNDIPTPVASHKSYSILSNDSNTPSPYSMSKNSLMCWTSPEANYFSNFDFSKLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELISQGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCSSSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITECFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGYFNTENGFSRPMI 1111          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000069322.1 (SMESG000069322.1)

HSP 1 Score: 193.356 bits (490), Expect = 4.533e-50
Identity = 149/473 (31.50%), Postives = 242/473 (51.16%), Query Frame = 1
Query:  166 VRSSKN--NCWTSLMEITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQM-ICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKNGLGLLTDNRAW------LGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKF----QSNTKLESEIEKDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVSENLSSSKLKPNIQKRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYM 1545
            VR S N  NC + LM    L DD+FSASS F+ +  FQ   ARL+ ++ S   P++GNAWCP+K   S   EWIEVDF+ + +I  I+T GR +GNF ++ P I I Y+R  N +   Y  + N+S++ +NTDART+ R+  +  IIA  I+IYP++   + M  C+KFA  GC   D  VSY    GD ++   ++     D  +DG  +       L+NGLGLL DN AW        ++   ++  F GW  ++    P+I I F +E+ R+F  + ++S +     I +   + +       +   L + I  D S AN        ++ T+ L+H+ G +  + +    LN +IL+SEI   S+       +S  +   +S   +P I   NTT+     +    +E+ + N   +DI           +  +  +ILL+IF+  +A + YK+++ R+ K   K++ +
Sbjct:   29 VRFSDNETNCISYLMSPKYLTDDQFSASS-FEYK--FQPSAARLIEVH-SQSGPDDGNAWCPNKNIHSKPEEWIEVDFRRMVIIKRIYTMGRADGNFQKYTPQILIKYKRSNNDQWRNYVNLNNESVLTMNTDARTKLRSN-LRTIIAKRIRIYPINSIASSMKACLKFAFLGCFIEDDAVSYDAPQGDLIT-IANISFDLRDYIYDGAVLGT-----LQNGLGLLMDNIAWRNKFDLFNNVNDEKEKIFTGWSCTSRHKYPFIIIRFHFEQERDFKSITLYSVKDFKHNIYLSGLITVTISDRDNNQVSLNATIAGDDSDAN-------ELLVTVQLNHSKGYICSINI-TCGLNNFILLSEIEIKSA-------KSIRTNAANSPPKRPAIHYFNTTDKYTTSLLSDKSESKISNWKQQDI---------TAMILVILIILLLIFVIAMAALCYKLQRSRRSKLTKKLELV 466          

HSP 2 Score: 164.851 bits (416), Expect = 5.373e-41
Identity = 78/193 (40.41%), Postives = 121/193 (62.69%), Query Frame = 1
Query: 2875 LNYGSLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYYWSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGYFNTENGFSRPMI 3453
            ++  SL+ I +Q+A+GMKH+EE G+ HRDLACR+C++++ + VKI  GG   + P + DY S+ + ++  +  P+RWMAPES+    F++KSD+W+F VTLWE+ T C+  PY   +N  ++D     L++  +    L  P+ CPK+IYD++  CW+  E  RP F ++H FLQ      F T N  S+  I
Sbjct:  810 ISLSSLMIIITQLANGMKHLEELGLTHRDLACRNCVIDLRMHVKIYPGGLVTTKP-NEDYCSMEILNHL-VTFPLRWMAPESIIAGVFTTKSDIWSFAVTLWEIFTLCSLVPYGSLTNEALLD-----LMSHRNNTPRLPCPQNCPKDIYDLMNRCWNWDESARPKFADVHKFLQ------FKTSNSTSQAQI 989          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000067438.1 (SMESG000067438.1)

HSP 1 Score: 146.362 bits (368), Expect = 3.356e-35
Identity = 129/474 (27.22%), Postives = 214/474 (45.15%), Query Frame = 1
Query:  208 ITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRY------FDG----DKIRQNSKILLKNGLGLLTDNRAWLGSLE-----GLRDPYFLGW----YVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIE-----KDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSE--------VSENLSSSKLKPNIQKRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSK 1533
            + +L ++ F ASS ++    F+ HQAR+  +   N     G+AWCP +   S   EWIE+D   + +I  + T GRG+GNF E+ P   + YQR  +G+   Y+    + L+  NTDAR  + T F   IIA  I+IYP+        C++  ++GCDF D  V YS   G     H       +++Y      +DG    DK   N K LL+ GLG L DN  + G +       +R  +F+GW      SN      + I  ++++ R+  +++ ++  +  + I +FS   + F         I      K V    V   R+      + L + +   +K+ L       WI++SEI  +S    E  P+          ++ N++S K  P       T+    V+  +N +N   +I        +   +   +ATIS   L  +F  +IA+I + +   R++KK +K
Sbjct:   49 VANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLL---GHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRV-SGKWIRYRNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQG-----HYYTARNGNEKYDLRDLTYDGVISIDK--SNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNK-----VEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRW----INITLQNVLARFLKIDLFFE--VDWIILSEIVIISEKYNEIIPKESESIQTNYPITHNITSVKYIP-------TDSTATVLIPQNGKN--NHIDTNRSSSFTASSSLGLIATISSCFLGFVF--LIALIVFGVFTLRRHKKRTK 489          

HSP 2 Score: 116.316 bits (290), Expect = 6.363e-26
Identity = 68/219 (31.05%), Postives = 109/219 (49.77%), Query Frame = 1
Query: 2887 SLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDY---------TSIHL-----PIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPY--YYWSNSQVMDNLYNILLAQNSQF------------------HYLTRPKI--------CPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGY 3417
            SL+FI +QIA GM ++E + I+HRDLA R+C++  NL++KIT+    I   F   Y+   +            +SI +     P++WMA ES+  A +S K+D+W+FGVT+WE+L  C Q PY  +  S  ++ DN YN+ +  +S                     ++  P            ++  D+I+ECW+     RP F  I   L++K   +
Sbjct:  942 SLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQK-FKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHEDLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNF 1159          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000067438.1 (SMESG000067438.1)

HSP 1 Score: 146.362 bits (368), Expect = 3.392e-35
Identity = 129/474 (27.22%), Postives = 214/474 (45.15%), Query Frame = 1
Query:  208 ITDLPDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHFNEWIEVDFKSINVINGIFTKGRGEGNFVEFVPTIKIAYQRERNGRIYEYQTIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFALFGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRY------FDG----DKIRQNSKILLKNGLGLLTDNRAWLGSLE-----GLRDPYFLGW----YVSNASPIPYIPISFEYEKRRNFTKLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIE-----KDVSRANVQMNRFGGVIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSE--------VSENLSSSKLKPNIQKRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDTTLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSK 1533
            + +L ++ F ASS ++    F+ HQAR+  +   N     G+AWCP +   S   EWIE+D   + +I  + T GRG+GNF E+ P   + YQR  +G+   Y+    + L+  NTDAR  + T F   IIA  I+IYP+        C++  ++GCDF D  V YS   G     H       +++Y      +DG    DK   N K LL+ GLG L DN  + G +       +R  +F+GW      SN      + I  ++++ R+  +++ ++  +  + I +FS   + F         I      K V    V   R+      + L + +   +K+ L       WI++SEI  +S    E  P+          ++ N++S K  P       T+    V+  +N +N   +I        +   +   +ATIS   L  +F  +IA+I + +   R++KK +K
Sbjct:   51 VANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLL---GHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRV-SGKWIRYRNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQG-----HYYTARNGNEKYDLRDLTYDGVISIDK--SNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNK-----VEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRW----INITLQNVLARFLKIDLFFE--VDWIILSEIVIISEKYNEIIPKESESIQTNYPITHNITSVKYIP-------TDSTATVLIPQNGKN--NHIDTNRSSSFTASSSLGLIATISSCFLGFVF--LIALIVFGVFTLRRHKKRTK 491          

HSP 2 Score: 116.316 bits (290), Expect = 6.211e-26
Identity = 68/219 (31.05%), Postives = 109/219 (49.77%), Query Frame = 1
Query: 2887 SLIFIASQIASGMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPLSDY---------TSIHL-----PIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPY--YYWSNSQVMDNLYNILLAQNSQF------------------HYLTRPKI--------CPKEIYDMIRECWHPTEDYRPNFHEIHMFLQRKCIGY 3417
            SL+FI +QIA GM ++E + I+HRDLA R+C++  NL++KIT+    I   F   Y+   +            +SI +     P++WMA ES+  A +S K+D+W+FGVT+WE+L  C Q PY  +  S  ++ DN YN+ +  +S                     ++  P            ++  D+I+ECW+     RP F  I   L++K   +
Sbjct:  944 SLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQK-FKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHEDLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNF 1161          
The following BLAST results are available for this feature:
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDR22.612e-4230.77discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR22.612e-4230.77discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR22.612e-4230.77discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR11.319e-4131.56discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
DDR11.319e-4131.56discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr-24.240e-3327.05Discoidin domain-containing receptor tyrosine kina... [more]
ddr-24.240e-3327.05Discoidin domain-containing receptor tyrosine kina... [more]
ddr-24.946e-3327.05Discoidin domain-containing receptor tyrosine kina... [more]
cam-11.033e-2927.69Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-11.143e-2927.69Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddr8.360e-4534.98gene:FBgn0053531 transcript:FBtr0344771[more]
Ddr8.360e-4534.98gene:FBgn0053531 transcript:FBtr0344770[more]
Ror6.767e-3030.59gene:FBgn0010407 transcript:FBtr0079978[more]
Abl3.709e-2938.42gene:FBgn0000017 transcript:FBtr0330136[more]
Abl3.719e-2938.42gene:FBgn0000017 transcript:FBtr0345369[more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr2b3.829e-4335.26discoidin domain receptor tyrosine kinase 2b [Sour... [more]
ddr2a6.864e-4334.24discoidin domain receptor tyrosine kinase 2a [Sour... [more]
ddr13.423e-4131.35discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr13.613e-4131.35discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr13.613e-4131.35discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDR21.522e-4032.14discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR22.954e-4032.14discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR22.996e-4031.37discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR23.474e-4032.14discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR21.279e-3730.94discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddr23.012e-4431.86discoidin domain receptor family, member 2 [Source... [more]
Ddr23.012e-4431.86discoidin domain receptor family, member 2 [Source... [more]
Ddr23.012e-4431.86discoidin domain receptor family, member 2 [Source... [more]
Ddr11.393e-3833.95discoidin domain receptor family, member 1 [Source... [more]
Ddr11.505e-3833.95discoidin domain receptor family, member 1 [Source... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q62371|DDR2_MOUSE2.107e-4331.86Discoidin domain-containing receptor 2 OS=Mus musc... [more]
sp|Q16832|DDR2_HUMAN1.254e-4130.77Discoidin domain-containing receptor 2 OS=Homo sap... [more]
sp|Q08345|DDR1_HUMAN1.131e-3829.79Epithelial discoidin domain-containing receptor 1 ... [more]
sp|Q7YR43|DDR1_PANTR1.196e-3829.79Epithelial discoidin domain-containing receptor 1 ... [more]
sp|Q03146|DDR1_MOUSE1.053e-3733.95Epithelial discoidin domain-containing receptor 1 ... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087UMF98.863e-5734.21Discoidin domain-containing receptor 2 (Fragment) ... [more]
A0A444SJX03.397e-5433.16Discoidin domain-containing receptor 2 OS=Armadill... [more]
A0A4Y2CLV52.704e-5333.41Discoidin domain-containing receptor 2 (Fragment) ... [more]
A0A2L2YDJ96.455e-5234.68Discoidin domain-containing receptor 2 OS=Parastea... [more]
A0A423TK811.543e-5135.16Putative discoidin domain-containing receptor 2-li... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000019857.21.490e-4233.93discoidin domain-containing receptor 2-like [Sourc... [more]
ddr2a2.691e-4232.60discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
ddr15.669e-3930.00discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr15.770e-3930.00discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr16.528e-3930.41discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001705.13.695e-3531.95pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 ge... [more]
NTRK27.450e-3532.16neurotrophic receptor tyrosine kinase 2 [Source:HG... [more]
ENSPMAT00000009485.12.534e-3129.15pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gen... [more]
ENSPMAT00000009339.11.480e-3034.23pep scaffold:Pmarinus_7.0:GL479558:1022:6538:1 gen... [more]
ENSPMAT00000009481.12.827e-2929.08pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC151.652e-924.22Protein kinase of the Mitotic Exit Network; locali... [more]
STE204.836e-923.29Cdc42p-activated signal transducing kinase; involv... [more]
SKM11.927e-826.01Member of the PAK family of serine/threonine prote... [more]
PSK16.802e-833.91PAS domain-containing serine/threonine protein kin... [more]
PSK26.841e-832.17PAS-domain containing serine/threonine protein kin... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO442692.349e-4032.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454902.941e-3230.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397613.326e-3031.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482152.329e-2929.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337362.800e-2930.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr2b9.921e-4232.14discoidin domain-containing receptor 2 [Source:NCB... [more]
ddr13.278e-3930.73epithelial discoidin domain-containing receptor 1 ... [more]
ddr13.278e-3930.73epithelial discoidin domain-containing receptor 1 ... [more]
ddr13.470e-3930.73epithelial discoidin domain-containing receptor 1 ... [more]
ddr13.806e-3930.73epithelial discoidin domain-containing receptor 1 ... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051409.10.000e+098.14SMESG000051409.1[more]
SMESG000051409.10.000e+098.13SMESG000051409.1[more]
SMESG000069322.14.533e-5031.50SMESG000069322.1[more]
SMESG000067438.13.356e-3527.22SMESG000067438.1[more]
SMESG000067438.13.392e-3527.22SMESG000067438.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030781 ID=SMED30030781|Name=Discoidin domain-containing receptor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3457bp
TGTCGATGAATTTTTGGTGATTTGATTTTCGTCGGCAAAAAAACAATCAA
ACTCAAATCTGTTTCCAGAATGAAAAATAGCATGGAAATATTTTTGAAAA
CTTTATTCGTGAGTCTGTTGATTAAAATTCACAACGGAAATAACGATTTG
CAATCAGTTTACATCGTCCGATCATCTAAGAATAATTGCTGGACCTCTCT
AATGGAAATCACTGACCTACCAGATGACAGATTTTCGGCGAGCAGCTCTT
TTCAAAACAGGTCGACCTTTCAGGCTCATCAGGCAAGATTACTCTATATT
TACCGATCAAACCCTCAACCAGAAAATGGCAACGCGTGGTGTCCTCATAA
AAAGGCAAGTTCCCATTTTAACGAATGGATAGAAGTGGATTTCAAGTCAA
TTAATGTAATAAATGGGATCTTCACCAAAGGAAGAGGAGAAGGCAATTTC
GTTGAATTCGTGCCAACAATTAAAATTGCTTACCAACGTGAAAGAAATGG
CAGAATATATGAATATCAAACCATAGAAAATCAATCGTTGATTCCAATAA
ACACTGATGCAAGAACGCAAAGTAGAACGAAATTTATCCCTGCTATTATT
GCGTCATCTATTAAAATTTACCCAGTGGATCCGTATGACGCTCAGATGAT
ATGCATCAAATTTGCCTTATTCGGATGTGATTTTCATGATTCTCCAGTGT
CTTATTCCACATTTGATGGTGACAATATGTCACACCATAAATCTGTGGGG
ATCACTACTTCAGATAGATATTTTGATGGAGATAAAATCAGGCAAAATAG
TAAAATATTATTAAAAAACGGTCTCGGTCTTTTGACAGACAATCGAGCTT
GGCTAGGAAGTCTTGAAGGATTGAGAGACCCTTATTTTCTTGGATGGTAT
GTTTCCAACGCAAGTCCAATTCCTTATATTCCAATCAGTTTTGAATACGA
AAAAAGGAGAAATTTTACGAAACTTCAGATTTTCTCCTATCAGCTTCCCA
GCCAAACAATTGATATCTTTTCCAAGGTAAACTTAAAGTTTCAATCAAAT
ACTAAACTCGAATCCGAAATTGAGAAAGACGTATCAAGGGCAAATGTACA
AATGAATAGATTCGGAGGTGTAATCTTCACGATGCTCCTGTCTCACAATG
TTGGCAACATGGTCAAGTTACAGCTCCACGCCACCAACCTCAACAGATGG
ATATTGGTTTCAGAAATTAATTTTGTTTCTAGTCTTGCTGCTGAAAATTT
TCCACAGTCTGAAGTTAGCGAGAATTTATCCTCTTCAAAACTTAAACCAA
ATATTCAGAAAAGAAATACCACCGAAATTAATCGTCAAGTAGTACAGAGA
AAAAATAACGAAAATTTCGTTCCAAACATATCCGGTCGTGACATTTTTCT
CGATTCCGAGAAAGATACCACACTGACAGTAGCTACCATTTCCGGTTTGA
TCCTACTCGTCATTTTCATATCAATAATCGCGGTGATTTTCTACAAAATG
AAGCAAAAACGGCAATACAAGAAAAACAGTAAGATTCAGTATATGATTGG
CAATGAGATCGGATCAATTTACCAGCAGTATAGTCAAACTGAGAAAATCA
AAAGCTTTCTTTCCCCTAATTTGCAACAGTCTCATTCACTGACTAGTGAT
AATAGTAGCTTTGACTGTCCTGTTGGCAGAATTCTAGATACAAGTATTTA
CTCTTCACTTCCTCACAAAACAACCAAAGATGCAAAAACTATTAGAGATG
ATGAAAGATATTTACTAAAAGAATATAATAACAATAATAATAATACAATA
ATGAATCCATCATCCGCATTTAATATCTCACCTTTTTCAAACAAAGAAAA
CACCATAAAAAATCCGTCTTTGACAACCTATTCATGGACAACCAACGAAC
AACTTTACAAAACCAATGGTCACGAATATGCAAGTGCCACATTGTTTCCC
TCGTCTTATCCAGGTATACAATACAAAAGACCAAGTGGAAGTTCTATAAT
GTTAAAGAATGATTGTCTATCATCACCTGCGCCTTCTCCGTATCACTTGA
TAAAGAATTCACCTTTATTTCCAAACTCACCTCTTGGAATGAGCCAGCTG
CCTGCAACGATACAAATAATAGCAAACCCATATTTTGATCATATTGATAA
GACTTCGGTCCCCACATCAAATGATATCCCAACGCCCGTTGCATCTCACA
AAAGCTATAGTATATTATCAAATGATTCCAATACTCCCAGTCCATATTCG
ATGTCAAAGAATTCCTTGATGTGTTGGACTTCCCCTGAAGCAAATTATTT
TTCAAATTTTGATTTTTCAAAGCTAATGCAAATTCAAAGTGTATGTGGTC
ACATATATTTTGGACTTGCCGAAATAGACTCAATGGATACCAAGCGACCG
ATGGGACTAATAGATACAAAATTACCCCGGCTGCAAATGTCCAGCATCAC
AACGGCGGAACTTATCAGTCAAGGTCAGTATGGTCAAAATAAAAAAGCCA
TATTAAATGAAAGCCTGATTCGCTCGAGAAATTTATCCGGATATCGAGAC
GAGATTTTAAATCGGAAGCTGTCGACAGAAAATTGCACTGTCATTTTGAC
GAGTCTAAATGATTGTAGCTCATCGGAAGCCAGGTCCAAATTTTATAATG
AAATCCAAATCCGATTGAGGCTTTCAAATCCAAACATTGCCGCCATTCTA
GCTATTGTCACCGACTCCGTCGAAGGTGACTTTGGGATATTAAACCATCA
ATGTGGATTCATTACAGAGTGTTTTATGAATTTACACGTGTATATACGAT
TGCAAACGACAGAAAAGGGAGAGATTACAAAACCGTTGACTGATTGCGCG
TATCCGTTTCAAAGTCCTGAAACCCTAAACTATGGATCGCTAATTTTTAT
TGCAAGTCAAATAGCAAGTGGCATGAAACACATGGAGGAACAGGGTATTT
TACACAGAGATTTAGCTTGCAGAAGTTGCATGGTAAATATGAATTTGCAA
GTCAAAATCACAAATGGTGGTCATCAAATCAGTTCTCCGTTTGATGTAGA
TTATCTTTCAATTCCTTTATCAGATTATACAAGTATCCATCTACCAATTA
GATGGATGGCTCCAGAATCTTTATTTAATGCGAAATTTTCTTCTAAATCA
GATGTTTGGGCTTTTGGTGTGACATTATGGGAAGTGCTAACTCACTGCAA
TCAACAGCCATATTATTATTGGTCTAATAGTCAGGTTATGGACAACCTTT
ACAACATTTTATTAGCTCAAAATTCACAGTTTCATTATTTGACTCGACCT
AAAATCTGTCCGAAAGAAATTTATGATATGATACGAGAATGCTGGCATCC
CACAGAAGATTATAGACCAAACTTTCATGAGATTCATATGTTTTTACAGA
GAAAATGTATCGGATATTTCAACACAGAAAACGGTTTTAGTCGACCTATG
ATTTAAT
back to top

protein sequence of SMED30030781-orf-1

>SMED30030781-orf-1 ID=SMED30030781-orf-1|Name=SMED30030781-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1129bp
MKNSMEIFLKTLFVSLLIKIHNGNNDLQSVYIVRSSKNNCWTSLMEITDL
PDDRFSASSSFQNRSTFQAHQARLLYIYRSNPQPENGNAWCPHKKASSHF
NEWIEVDFKSINVINGIFTKGRGEGNFVEFVPTIKIAYQRERNGRIYEYQ
TIENQSLIPINTDARTQSRTKFIPAIIASSIKIYPVDPYDAQMICIKFAL
FGCDFHDSPVSYSTFDGDNMSHHKSVGITTSDRYFDGDKIRQNSKILLKN
GLGLLTDNRAWLGSLEGLRDPYFLGWYVSNASPIPYIPISFEYEKRRNFT
KLQIFSYQLPSQTIDIFSKVNLKFQSNTKLESEIEKDVSRANVQMNRFGG
VIFTMLLSHNVGNMVKLQLHATNLNRWILVSEINFVSSLAAENFPQSEVS
ENLSSSKLKPNIQKRNTTEINRQVVQRKNNENFVPNISGRDIFLDSEKDT
TLTVATISGLILLVIFISIIAVIFYKMKQKRQYKKNSKIQYMIGNEIGSI
YQQYSQTEKIKSFLSPNLQQSHSLTSDNSSFDCPVGRILDTSIYSSLPHK
TTKDAKTIRDDERYLLKEYNNNNNNTIMNPSSAFNISPFSNKENTIKNPS
LTTYSWTTNEQLYKTNGHEYASATLFPSSYPGIQYKRPSGSSIMLKNDCL
SSPAPSPYHLIKNSPLFPNSPLGMSQLPATIQIIANPYFDHIDKTSVPTS
NDIPTPVASHKSYSILSNDSNTPSPYSMSKNSLMCWTSPEANYFSNFDFS
KLMQIQSVCGHIYFGLAEIDSMDTKRPMGLIDTKLPRLQMSSITTAELIS
QGQYGQNKKAILNESLIRSRNLSGYRDEILNRKLSTENCTVILTSLNDCS
SSEARSKFYNEIQIRLRLSNPNIAAILAIVTDSVEGDFGILNHQCGFITE
CFMNLHVYIRLQTTEKGEITKPLTDCAYPFQSPETLNYGSLIFIASQIAS
GMKHMEEQGILHRDLACRSCMVNMNLQVKITNGGHQISSPFDVDYLSIPL
SDYTSIHLPIRWMAPESLFNAKFSSKSDVWAFGVTLWEVLTHCNQQPYYY
WSNSQVMDNLYNILLAQNSQFHYLTRPKICPKEIYDMIRECWHPTEDYRP
NFHEIHMFLQRKCIGYFNTENGFSRPMI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0038062protein tyrosine kinase collagen receptor activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0004713protein tyrosine kinase activity
GO:0004714transmembrane receptor protein tyrosine kinase activity
Vocabulary: biological process
TermDefinition
GO:0038063collagen-activated tyrosine kinase receptor signaling pathway
GO:0006468protein phosphorylation
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR008979Galactose-bd-like_sf
IPR000421FA58C
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 956..974
score: 40.55
coord: 1029..1051
score: 42.93
coord: 1010..1020
score: 63.67
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 801..1111
e-value: 1.4E-47
score: 162.2
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 28..207
e-value: 2.4E-29
score: 104.2
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 50..206
IPR000421Coagulation factor 5/8 C-terminal domainPFAMPF00754F5_F8_type_Ccoord: 86..191
e-value: 2.7E-10
score: 40.4
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS01285FA58C_1coord: 89..121
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS50022FA58C_3coord: 40..203
score: 18.715
NoneNo IPR availableGENE3DG3DSA:2.60.120.1190coord: 208..396
e-value: 6.7E-25
score: 89.7
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 906..1113
e-value: 1.4E-40
score: 140.7
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 786..887
e-value: 1.5E-5
score: 27.1
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 3..1120
NoneNo IPR availablePANTHERPTHR24416:SF515coord: 3..1120
NoneNo IPR availableTMHMMTMhelixcoord: 453..475
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 795..1111
score: 26.888
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 783..1109