Y box protein-1

Overview
NameY box protein-1
Smed IDSMED30030766
Length (bp)814
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Y box protein-1 (SMED30030766) t-SNE clustered cells

Violin plots show distribution of expression levels for Y box protein-1 (SMED30030766) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Y box protein-1 (SMED30030766) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Y box protein-1 (SMED30030766) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030766

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030766SMESG000058066.1 SmedASXL_006362SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30030766SMESG000058066.1 SmedASXL_006362SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30030766SMESG000058066.1 dd_Smed_v4_52_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30030766SMESG000058066.1 dd_Smed_v4_52_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030766SMESG000058066.1 dd_Smed_v4_52_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30030766SMESG000058066.1 dd_Smed_v4_52_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030766SMESG000058066.1 dd_Smed_v4_52_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030766SMESG000058066.1 dd_Smed_v4_52_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30030766SMESG000058066.1 dd_Smed_v4_52_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030766SMESG000058066.1 dd_Smed_v4_52_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030766SMESG000058066.1 dd_Smed_v4_52_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30030766SMESG000058066.1 dd_Smed_v4_52_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030766SMESG000058066.1 dd_Smed_v4_52_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30030766SMESG000058066.1 dd_Smed_v4_52_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30030766SMESG000058066.1 dd_Smed_v4_52_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030766SMESG000058066.1 Contig52395uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030766SMESG000058066.1 Contig52395newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30030766SMESG000046431.1 SMESG000027653.1 SMESG000058066.1 SMESG000024319.1 OX_Smed_1.0.16323ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30030766SMESG000058066.1 dd_Smed_v6_52_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30030766SMESG000058066.1 dd_Smed_v6_52_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX2 (Y-box binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17948])

HSP 1 Score: 87.0409 bits (214), Expect = 5.187e-19
Identity = 47/95 (49.47%), Postives = 61/95 (64.21%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNR 365
            A QV G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G + Y P+ R + R
Sbjct:   91 AIQVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSR-YAPNRRKSRR 182          
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX2 (Y-box binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17948])

HSP 1 Score: 87.0409 bits (214), Expect = 5.187e-19
Identity = 47/95 (49.47%), Postives = 61/95 (64.21%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNR 365
            A QV G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G + Y P+ R + R
Sbjct:   91 AIQVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSR-YAPNRRKSRR 182          
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX1 (Y-box binding protein 1 [Source:HGNC Symbol;Acc:HGNC:8014])

HSP 1 Score: 83.1889 bits (204), Expect = 7.128e-18
Identity = 43/84 (51.19%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G K
Sbjct:   56 ATKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSK 137          
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX3 (Y-box binding protein 3 [Source:HGNC Symbol;Acc:HGNC:2428])

HSP 1 Score: 82.0333 bits (201), Expect = 3.178e-17
Identity = 42/84 (50.00%), Postives = 57/84 (67.86%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP+G  V G +
Sbjct:   88 ATKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSR 169          
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX3 (Y-box binding protein 3 [Source:HGNC Symbol;Acc:HGNC:2428])

HSP 1 Score: 81.2629 bits (199), Expect = 3.209e-17
Identity = 42/84 (50.00%), Postives = 57/84 (67.86%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP+G  V G +
Sbjct:   88 ATKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSR 169          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-1 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:O62213])

HSP 1 Score: 92.4337 bits (228), Expect = 1.746e-22
Identity = 49/84 (58.33%), Postives = 61/84 (72.62%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ KNGYGFI+  D N  +DIFVH ++I  NN      SL D EEV+FDIV+G+KGLEA +VTGP+GG V G K
Sbjct:   18 ATKVKGTVKWFNVKNGYGFINRTDTN--EDIFVHQTAIINNNPNKYLRSLGDNEEVMFDIVEGSKGLEAASVTGPDGGPVQGSK 99          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-2 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91306])

HSP 1 Score: 80.1073 bits (196), Expect = 1.936e-17
Identity = 44/83 (53.01%), Postives = 55/83 (66.27%), Query Frame = 3
Query:  102 VTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT------SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            + G VKW+S    YGFIS +D    KDIFVH ++I A +AT      +L D EEVLFD+V+G  G EA NVTGPNG +VIG +
Sbjct:   66 LQGKVKWYSVLRRYGFISRND--GEKDIFVHQTAI-AKSATEKFYLRTLGDDEEVLFDLVEGKNGPEAANVTGPNGDNVIGSR 145          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-4 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5EDV3])

HSP 1 Score: 75.485 bits (184), Expect = 1.218e-15
Identity = 39/83 (46.99%), Postives = 54/83 (65.06%), Query Frame = 3
Query:  102 VTGHVKWFSSKNGYGFISVDDDNNS-KDIFVHHSSITANNAT-----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            V GHVKWFS +  YGF++ D   +  +D FVH ++IT ++       +L D E V+FDIV+G KG EA NVTGP+G +V G +
Sbjct:   89 VKGHVKWFSVRGRYGFVARDKPTDENEDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRGSR 171          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-4 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5EDV3])

HSP 1 Score: 75.485 bits (184), Expect = 1.218e-15
Identity = 39/83 (46.99%), Postives = 54/83 (65.06%), Query Frame = 3
Query:  102 VTGHVKWFSSKNGYGFISVDDDNNS-KDIFVHHSSITANNAT-----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            V GHVKWFS +  YGF++ D   +  +D FVH ++IT ++       +L D E V+FDIV+G KG EA NVTGP+G +V G +
Sbjct:   89 VKGHVKWFSVRGRYGFVARDKPTDENEDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRGSR 171          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-3 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91398])

HSP 1 Score: 72.7886 bits (177), Expect = 6.350e-15
Identity = 40/82 (48.78%), Postives = 51/82 (62.20%), Query Frame = 3
Query:  102 VTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT-----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            + G VKW+S    YGFIS  D    KD+FVH ++I+ ++       +LAD EEVLFD+V G  G EA NVTGP G +V G K
Sbjct:   64 LQGKVKWYSVLRRYGFISRSD--GEKDVFVHQTAISKSDTEKFYLRTLADEEEVLFDLVDGKNGPEAANVTGPAGVNVSGSK 143          
BLAST of Y box protein-1 vs. Ensembl Fly
Match: yps (gene:FBgn0022959 transcript:FBtr0076027)

HSP 1 Score: 80.1073 bits (196), Expect = 5.352e-17
Identity = 44/82 (53.66%), Postives = 56/82 (68.29%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIG 326
            A++VTG VKWF+ K+GYGFI+ +D    +D+FVH S+I  NN      S+ DGE V FD+V G KG EA NVTGP+G  V G
Sbjct:   59 ATKVTGTVKWFNVKSGYGFINRND--TREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRG 138          
BLAST of Y box protein-1 vs. Ensembl Fly
Match: yps (gene:FBgn0022959 transcript:FBtr0305992)

HSP 1 Score: 80.1073 bits (196), Expect = 5.365e-17
Identity = 44/82 (53.66%), Postives = 56/82 (68.29%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIG 326
            A++VTG VKWF+ K+GYGFI+ +D    +D+FVH S+I  NN      S+ DGE V FD+V G KG EA NVTGP+G  V G
Sbjct:   59 ATKVTGTVKWFNVKSGYGFINRND--TREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRG 138          
BLAST of Y box protein-1 vs. Ensembl Fly
Match: lin-28 (gene:FBgn0035626 transcript:FBtr0077090)

HSP 1 Score: 56.225 bits (134), Expect = 2.398e-9
Identity = 27/73 (36.99%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  108 GHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIG 326
            G  KWF+   G+GF++ +D    +++FVH S I  +   SL + EEV F+  + ++GLEA  V+  +GG   G
Sbjct:   41 GKCKWFNVAKGWGFLTPND--GGQEVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQG 111          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 83.9593 bits (206), Expect = 2.185e-18
Identity = 43/84 (51.19%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G K
Sbjct:   36 ATKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSK 117          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 83.9593 bits (206), Expect = 2.185e-18
Identity = 43/84 (51.19%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G K
Sbjct:   36 ATKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSK 117          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 83.5741 bits (205), Expect = 2.911e-18
Identity = 43/84 (51.19%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G K
Sbjct:   36 ATKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSK 117          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: lin28a (lin-28 homolog A (C. elegans) [Source:NCBI gene;Acc:394066])

HSP 1 Score: 63.1586 bits (152), Expect = 1.084e-11
Identity = 33/96 (34.38%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  105 TGHVKWFSSKNGYGFISVDDD-----NNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGG-KPYEPSDRSNNRGDR 374
            +G  KWF+ + G+GF+S+        ++  D+FVH S +      SL +GE V F   + +KGLE+  VTGP G   +G  K  + + +  ++GDR
Sbjct:   29 SGVCKWFNVRMGFGFLSMTHREGICLDSPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKRSSKGLESLQVTGPGGAPCVGSEKKPKGTQKRRSKGDR 124          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: lin28a (lin-28 homolog A (C. elegans) [Source:NCBI gene;Acc:394066])

HSP 1 Score: 62.7734 bits (151), Expect = 1.818e-11
Identity = 33/96 (34.38%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  105 TGHVKWFSSKNGYGFISVDDD-----NNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGG-KPYEPSDRSNNRGDR 374
            +G  KWF+ + G+GF+S+        ++  D+FVH S +      SL +GE V F   + +KGLE+  VTGP G   +G  K  + + +  ++GDR
Sbjct:   27 SGVCKWFNVRMGFGFLSMTHREGICLDSPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKRSSKGLESLQVTGPGGAPCVGSEKKPKGTQKRRSKGDR 122          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: ybx3 (Y-box binding protein 3 [Source:NCBI gene;Acc:548572])

HSP 1 Score: 82.4185 bits (202), Expect = 4.317e-18
Identity = 42/84 (50.00%), Postives = 55/84 (65.48%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V G KG EA NVTGP G  V G +
Sbjct:   33 ATKVQGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGEVVEFDVVAGEKGAEAANVTGPKGAPVQGSR 114          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:Xenbase;Acc:XB-GENE-942074])

HSP 1 Score: 83.1889 bits (204), Expect = 5.618e-18
Identity = 43/84 (51.19%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G K
Sbjct:   34 ATKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSK 115          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:Xenbase;Acc:XB-GENE-942074])

HSP 1 Score: 80.8777 bits (198), Expect = 4.286e-17
Identity = 42/83 (50.60%), Postives = 55/83 (66.27%), Query Frame = 3
Query:   96 SQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            ++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G K
Sbjct:   43 TKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSK 123          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:100216028])

HSP 1 Score: 66.6254 bits (161), Expect = 2.599e-12
Identity = 31/79 (39.24%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  105 TGHVKWFSSKNGYGFISVDDDN-----NSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIG 326
            +GH KWF+ + G+GFIS+         N  D+FVH S +      SL +GE V F   + +KG E+  VTGP G   +G
Sbjct:   58 SGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLG 136          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:100216028])

HSP 1 Score: 66.6254 bits (161), Expect = 2.622e-12
Identity = 31/79 (39.24%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  105 TGHVKWFSSKNGYGFISVDDDN-----NSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIG 326
            +GH KWF+ + G+GFIS+         N  D+FVH S +      SL +GE V F   + +KG E+  VTGP G   +G
Sbjct:   34 SGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLG 112          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx1 (Y box protein 1 [Source:MGI Symbol;Acc:MGI:99146])

HSP 1 Score: 83.1889 bits (204), Expect = 4.561e-18
Identity = 43/84 (51.19%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G K
Sbjct:   54 ATKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSK 135          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx2 (Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372])

HSP 1 Score: 82.4185 bits (202), Expect = 5.279e-18
Identity = 45/88 (51.14%), Postives = 57/88 (64.77%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEP 344
            A QV G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G + Y P
Sbjct:   15 AIQVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSR-YAP 99          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx3 (Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670])

HSP 1 Score: 82.4185 bits (202), Expect = 7.499e-18
Identity = 42/84 (50.00%), Postives = 57/84 (67.86%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP+G  V G +
Sbjct:   80 ATKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSR 161          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx2 (Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372])

HSP 1 Score: 82.8037 bits (203), Expect = 8.429e-18
Identity = 45/88 (51.14%), Postives = 57/88 (64.77%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEP 344
            A QV G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G + Y P
Sbjct:   92 AIQVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSR-YAP 176          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx3 (Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670])

HSP 1 Score: 82.8037 bits (203), Expect = 1.061e-17
Identity = 42/84 (50.00%), Postives = 57/84 (67.86%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP+G  V G +
Sbjct:   80 ATKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSR 161          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|P41824|YBOXH_APLCA (Y-box factor homolog OS=Aplysia californica OX=6500 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 9.378e-20
Identity = 50/96 (52.08%), Postives = 63/96 (65.62%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNRG 368
            ASQV+G VKWF+ K+GYGFI+ DD    +D+FVH ++I  NN      S+ DGE+V FD+V+G KG EA NVTGP G +V G K Y    R   RG
Sbjct:   30 ASQVSGTVKWFNVKSGYGFINRDD--TKEDVFVHQTAIVKNNPRKYLRSVGDGEKVEFDVVEGEKGNEAANVTGPEGSNVQGSK-YAADRRRFRRG 122          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|Q9Y2T7|YBOX2_HUMAN (Y-box-binding protein 2 OS=Homo sapiens OX=9606 GN=YBX2 PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 2.491e-18
Identity = 47/95 (49.47%), Postives = 61/95 (64.21%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNR 365
            A QV G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G + Y P+ R + R
Sbjct:   91 AIQVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSR-YAPNRRKSRR 182          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|P21573|YBOX1_XENLA (Y-box-binding protein 1 OS=Xenopus laevis OX=8355 GN=ybx1 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.255e-17
Identity = 43/84 (51.19%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G K
Sbjct:   34 ATKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPEGVPVQGSK 115          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|P45441|YBX2B_XENLA (Y-box-binding protein 2-B OS=Xenopus laevis OX=8355 GN=ybx2-b PE=1 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 1.259e-17
Identity = 43/84 (51.19%), Postives = 57/84 (67.86%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A+QV G VKWF+ +NGYGFI+ +D  + +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G +
Sbjct:   39 ATQVQGTVKWFNVRNGYGFINRND--SKEDVFVHQTAIKKNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSR 120          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|B5DE31|YBOX1_DANRE (Y-box-binding protein 1 OS=Danio rerio OX=7955 GN=ybx1 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.650e-17
Identity = 43/84 (51.19%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G K
Sbjct:   36 ATKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSK 117          
BLAST of Y box protein-1 vs. TrEMBL
Match: I1ZIB0 (Y box protein-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 8.118e-59
Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNRGDRD 377
            ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNRGDRD
Sbjct:   20 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNRGDRD 114          
BLAST of Y box protein-1 vs. TrEMBL
Match: A0A565DLG5 (Cold shock protein (Fragment) OS=Echiniscoides sigismundi OX=500494 GN=CSP PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.231e-21
Identity = 49/87 (56.32%), Postives = 62/87 (71.26%), Query Frame = 3
Query:   96 SQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITA----NNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEP 344
            +QV G VKWF+++ G+GFI  D  +N  DIFVHHS+I A        +LADGE+V FD+VQG KGLEA NVTGPNG +V G + Y+P
Sbjct:   13 TQVNGSVKWFNAQKGFGFIVRDGSDNGDDIFVHHSAIKAVDPNTTYRTLADGEQVTFDVVQGNKGLEAANVTGPNGNNVQGSR-YQP 98          
BLAST of Y box protein-1 vs. TrEMBL
Match: A0A3M7PA90 (Y-box factor-like protein OS=Brachionus plicatilis OX=10195 GN=BpHYR1_037785 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.121e-20
Identity = 50/83 (60.24%), Postives = 59/83 (71.08%), Query Frame = 3
Query:   96 SQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
             +VTG VKWF+ KNGYGFIS+DD    +DIF+HHS I  NN      S+ +GE+V FDIVQG KGLEA N+TGPNG  V G K
Sbjct:   35 QKVTGTVKWFNVKNGYGFISLDD--REEDIFIHHSGIARNNPKKQQKSVGEGEKVEFDIVQGEKGLEAANLTGPNGDPVQGSK 115          
BLAST of Y box protein-1 vs. TrEMBL
Match: A7S475 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g104083 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.527e-20
Identity = 52/95 (54.74%), Postives = 63/95 (66.32%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNR 365
            A++VTG VKWF+ KNGYGFI+ DD  N +DIFVH ++I  NN      S+ DGE V F++V G KGLEA NVTGP+G  V G K      R NNR
Sbjct:    5 ATKVTGTVKWFNVKNGYGFINRDD--NKEDIFVHQTAIAKNNPKKYLRSVGDGEVVEFNVVSGTKGLEASNVTGPDGEPVQGSKYAPDRRRRNNR 97          
BLAST of Y box protein-1 vs. TrEMBL
Match: A0A261AUY1 (CSD_1 domain-containing protein (Fragment) OS=Caenorhabditis latens OX=1503980 GN=FL83_17696 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.561e-20
Identity = 51/84 (60.71%), Postives = 61/84 (72.62%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ KNGYGFI+  D N  +DIFVH ++I  NN      SL D EEVLFDIV+G+KGLEA NVTGP+GG V G K
Sbjct:   18 ATKVKGTVKWFNVKNGYGFINRTDTN--EDIFVHQTAIINNNPNKYLRSLGDNEEVLFDIVEGSKGLEASNVTGPDGGPVQGSK 99          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: ybx1 (Y-box binding protein 1 [Source:NCBI gene;Acc:103040011])

HSP 1 Score: 82.4185 bits (202), Expect = 5.766e-18
Identity = 43/84 (51.19%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G K
Sbjct:   37 ATKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSK 118          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: YBX2 (Y-box-binding protein 2-A-like [Source:NCBI gene;Acc:103036193])

HSP 1 Score: 77.411 bits (189), Expect = 3.424e-16
Identity = 43/88 (48.86%), Postives = 56/88 (63.64%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEP 344
            A+ V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+  KG EA NVTGP G  V G + Y P
Sbjct:   28 ATLVQGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKFLRSVGDGEIVEFDVVEATKGSEAANVTGPGGVPVKGSR-YAP 112          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: YBX2 (Y-box-binding protein 2-A-like [Source:NCBI gene;Acc:103036193])

HSP 1 Score: 77.0258 bits (188), Expect = 5.931e-16
Identity = 43/88 (48.86%), Postives = 56/88 (63.64%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEP 344
            A+ V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+  KG EA NVTGP G  V G + Y P
Sbjct:   21 ATLVQGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKFLRSVGDGEIVEFDVVEATKGSEAANVTGPGGVPVKGSR-YAP 105          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: LIN28B (protein lin-28 homolog A [Source:NCBI gene;Acc:103022253])

HSP 1 Score: 65.4698 bits (158), Expect = 2.603e-12
Identity = 31/79 (39.24%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  105 TGHVKWFSSKNGYGFISVDDDNNSK-----DIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIG 326
            +GH KWF+ + G+GFIS+     +      D+FVH S +      SL +GE V F   + +KGLE   VTGP G   +G
Sbjct:   30 SGHCKWFNVRMGFGFISMTSRGGNPIDPPLDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSSKGLECVRVTGPGGAHCVG 108          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: LIN28B (protein lin-28 homolog A [Source:NCBI gene;Acc:103022253])

HSP 1 Score: 65.4698 bits (158), Expect = 2.652e-12
Identity = 31/79 (39.24%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  105 TGHVKWFSSKNGYGFISVDDDNNSK-----DIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIG 326
            +GH KWF+ + G+GFIS+     +      D+FVH S +      SL +GE V F   + +KGLE   VTGP G   +G
Sbjct:   38 SGHCKWFNVRMGFGFISMTSRGGNPIDPPLDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSSKGLECVRVTGPGGAHCVG 116          
BLAST of Y box protein-1 vs. Ensembl Nematostella
Match: EDO41469 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S475])

HSP 1 Score: 92.4337 bits (228), Expect = 4.877e-24
Identity = 52/95 (54.74%), Postives = 63/95 (66.32%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNR 365
            A++VTG VKWF+ KNGYGFI+ DD  N +DIFVH ++I  NN      S+ DGE V F++V G KGLEA NVTGP+G  V G K      R NNR
Sbjct:    5 ATKVTGTVKWFNVKNGYGFINRDD--NKEDIFVHQTAIAKNNPKKYLRSVGDGEVVEFNVVSGTKGLEASNVTGPDGEPVQGSKYAPDRRRRNNR 97          
BLAST of Y box protein-1 vs. Ensembl Nematostella
Match: EDO44703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV03])

HSP 1 Score: 62.3882 bits (150), Expect = 4.548e-11
Identity = 35/76 (46.05%), Postives = 44/76 (57.89%), Query Frame = 3
Query:  102 VTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGG 329
             TG VKWF+   G+GFI+ DD    +D+FVH S+I A+   SL +GE V   I    KG  A  VT P GG+V G 
Sbjct:  483 CTGSVKWFNLIKGFGFITRDD--GGEDVFVHQSAIKASGYRSLEEGEHVQLTISNSDKGKVAICVTSPGGGNVKGA 556          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: ybx1 (Y-box binding protein 1 [Source:NCBI gene;Acc:100049221])

HSP 1 Score: 81.6481 bits (200), Expect = 9.811e-18
Identity = 43/84 (51.19%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGK 332
            A++V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+V+G KG EA NVTGP G  V G K
Sbjct:   38 ATKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVAVQGSK 119          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: ENSORLT00000007880.2 (Y-box binding protein 2 [Source:NCBI gene;Acc:100049372])

HSP 1 Score: 80.4925 bits (197), Expect = 6.466e-17
Identity = 43/88 (48.86%), Postives = 57/88 (64.77%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEP 344
            A+ V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+++ AKG EA NVTGP G  V G + Y P
Sbjct:  109 ATAVQGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVIEAAKGSEAANVTGPGGIPVKGSR-YAP 193          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: ENSORLT00000007875.2 (Y-box binding protein 2 [Source:NCBI gene;Acc:100049372])

HSP 1 Score: 80.1073 bits (196), Expect = 7.514e-17
Identity = 43/88 (48.86%), Postives = 57/88 (64.77%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNAT----SLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEP 344
            A+ V G VKWF+ +NGYGFI+ +D    +D+FVH ++I  NN      S+ DGE V FD+++ AKG EA NVTGP G  V G + Y P
Sbjct:  109 ATAVQGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVIEAAKGSEAANVTGPGGIPVKGSR-YAP 193          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:101160951])

HSP 1 Score: 69.707 bits (169), Expect = 7.540e-14
Identity = 37/99 (37.37%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  105 TGHVKWFSSKNGYGFISVDDDNNSK-----DIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGG----KPYEPSDRSNNRGDR 374
            +G  KWF+ + G+GFIS+ +   S      D+FVH S +      SL +GE+V F   + +KGLE+  VTGP GG  +G     K   P  +   +GDR
Sbjct:   34 SGFCKWFNVRMGFGFISMTNSEGSPVEPPLDVFVHQSKLVMEGFRSLKEGEQVEFTYKKSSKGLESLRVTGPGGGPCVGSERRPKGKVPLQKRKPKGDR 132          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:101160951])

HSP 1 Score: 69.707 bits (169), Expect = 9.980e-14
Identity = 37/99 (37.37%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  105 TGHVKWFSSKNGYGFISVDDDNNSK-----DIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGG----KPYEPSDRSNNRGDR 374
            +G  KWF+ + G+GFIS+ +   S      D+FVH S +      SL +GE+V F   + +KGLE+  VTGP GG  +G     K   P  +   +GDR
Sbjct:   69 SGFCKWFNVRMGFGFISMTNSEGSPVEPPLDVFVHQSKLVMEGFRSLKEGEQVEFTYKKSSKGLESLRVTGPGGGPCVGSERRPKGKVPLQKRKPKGDR 167          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000058066.1 (SMESG000058066.1)

HSP 1 Score: 195.667 bits (496), Expect = 7.195e-63
Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 3
Query:   93 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNRGDRD 377
            ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNRGDRD
Sbjct:    3 ASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNRGDRD 97          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000058043.1 (SMESG000058043.1)

HSP 1 Score: 153.68 bits (387), Expect = 4.232e-47
Identity = 79/96 (82.29%), Postives = 85/96 (88.54%), Query Frame = 3
Query:   96 SQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEP-SDRSNNR-GDRD 377
            SQV GHVKWF+SKNGYGFISVD+DN+ KDIFVH  SI A NATSLADGEEVLFDIV+GAKGLEARNVTGPNGGDV+GG PYE  +DR NNR GDRD
Sbjct:    4 SQVVGHVKWFNSKNGYGFISVDNDNSDKDIFVHFKSIAAGNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAPYEQNNDRFNNRGGDRD 99          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000058039.1 (SMESG000058039.1)

HSP 1 Score: 148.288 bits (373), Expect = 5.444e-45
Identity = 76/96 (79.17%), Postives = 83/96 (86.46%), Query Frame = 3
Query:   96 SQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEP-SDRSNNR-GDRD 377
            SQVTGHVKWF+SKNGYGFISVD++   KD+FVH  SI A NATSLADGEEVLFDIV+GAKGLEARNVTGPNGGDV+GG  YE  +DR NNR GDRD
Sbjct:    4 SQVTGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQYEQNNDRFNNRGGDRD 99          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000073546.1 (SMESG000073546.1)

HSP 1 Score: 132.109 bits (331), Expect = 1.338e-37
Identity = 64/91 (70.33%), Postives = 78/91 (85.71%), Query Frame = 3
Query:   96 SQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSD-RSNNR 365
            S+VTGHVKWF++K+GYGFI  D D    D+FVHHSSITA N+ SLADGEEVLFD+++G KGLEARNV GP+GG+V+GGKPY+P+D RSN R
Sbjct:    9 SKVTGHVKWFNTKSGYGFIKKDVD--GADVFVHHSSITATNSNSLADGEEVLFDVIEGPKGLEARNVCGPDGGNVVGGKPYQPNDNRSNIR 97          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000078868.1 (SMESG000078868.1)

HSP 1 Score: 129.413 bits (324), Expect = 2.371e-37
Identity = 63/93 (67.74%), Postives = 77/93 (82.80%), Query Frame = 3
Query:   96 SQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNRGDR 374
            ++V GHVKWF+SK+GYGFI  +D  +S D+FVHHSSI A NA SLADGEEV FD+VQG+KGLEARNVTGPNGGDV+GGKPY   + + + G+R
Sbjct:    7 TKVNGHVKWFNSKSGYGFIRREDRKDS-DVFVHHSSIVATNANSLADGEEVQFDVVQGSKGLEARNVTGPNGGDVVGGKPYFQQNDNRSYGNR 98          
The following BLAST results are available for this feature:
BLAST of Y box protein-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YBX25.187e-1949.47Y-box binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
YBX25.187e-1949.47Y-box binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
YBX17.128e-1851.19Y-box binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
YBX33.178e-1750.00Y-box binding protein 3 [Source:HGNC Symbol;Acc:HG... [more]
YBX33.209e-1750.00Y-box binding protein 3 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cey-11.746e-2258.33C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:O62... [more]
cey-21.936e-1753.01C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91... [more]
cey-41.218e-1546.99C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
cey-41.218e-1546.99C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
cey-36.350e-1548.78C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
yps5.352e-1753.66gene:FBgn0022959 transcript:FBtr0076027[more]
yps5.365e-1753.66gene:FBgn0022959 transcript:FBtr0305992[more]
lin-282.398e-936.99gene:FBgn0035626 transcript:FBtr0077090[more]
back to top
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx12.185e-1851.19Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ybx12.185e-1851.19Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ybx12.911e-1851.19Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
lin28a1.084e-1134.38lin-28 homolog A (C. elegans) [Source:NCBI gene;Ac... [more]
lin28a1.818e-1134.38lin-28 homolog A (C. elegans) [Source:NCBI gene;Ac... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx34.317e-1850.00Y-box binding protein 3 [Source:NCBI gene;Acc:5485... [more]
hmgcs15.618e-1851.193-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
hmgcs14.286e-1750.603-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
lin28b2.599e-1239.24lin-28 homolog B [Source:NCBI gene;Acc:100216028][more]
lin28b2.622e-1239.24lin-28 homolog B [Source:NCBI gene;Acc:100216028][more]
back to top
BLAST of Y box protein-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ybx14.561e-1851.19Y box protein 1 [Source:MGI Symbol;Acc:MGI:99146][more]
Ybx25.279e-1851.14Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372... [more]
Ybx37.499e-1850.00Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670... [more]
Ybx28.429e-1851.14Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372... [more]
Ybx31.061e-1750.00Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670... [more]
back to top
BLAST of Y box protein-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41824|YBOXH_APLCA9.378e-2052.08Y-box factor homolog OS=Aplysia californica OX=650... [more]
sp|Q9Y2T7|YBOX2_HUMAN2.491e-1849.47Y-box-binding protein 2 OS=Homo sapiens OX=9606 GN... [more]
sp|P21573|YBOX1_XENLA1.255e-1751.19Y-box-binding protein 1 OS=Xenopus laevis OX=8355 ... [more]
sp|P45441|YBX2B_XENLA1.259e-1751.19Y-box-binding protein 2-B OS=Xenopus laevis OX=835... [more]
sp|B5DE31|YBOX1_DANRE1.650e-1751.19Y-box-binding protein 1 OS=Danio rerio OX=7955 GN=... [more]
back to top
BLAST of Y box protein-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIB08.118e-59100.00Y box protein-1 (Fragment) OS=Schmidtea mediterran... [more]
A0A565DLG53.231e-2156.32Cold shock protein (Fragment) OS=Echiniscoides sig... [more]
A0A3M7PA901.121e-2060.24Y-box factor-like protein OS=Brachionus plicatilis... [more]
A7S4753.527e-2054.74Predicted protein (Fragment) OS=Nematostella vecte... [more]
A0A261AUY15.561e-2060.71CSD_1 domain-containing protein (Fragment) OS=Caen... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx15.766e-1851.19Y-box binding protein 1 [Source:NCBI gene;Acc:1030... [more]
YBX23.424e-1648.86Y-box-binding protein 2-A-like [Source:NCBI gene;A... [more]
YBX25.931e-1648.86Y-box-binding protein 2-A-like [Source:NCBI gene;A... [more]
LIN28B2.603e-1239.24protein lin-28 homolog A [Source:NCBI gene;Acc:103... [more]
LIN28B2.652e-1239.24protein lin-28 homolog A [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Y box protein-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Y box protein-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO414694.877e-2454.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447034.548e-1146.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx19.811e-1851.19Y-box binding protein 1 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000007880.26.466e-1748.86Y-box binding protein 2 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000007875.27.514e-1748.86Y-box binding protein 2 [Source:NCBI gene;Acc:1000... [more]
lin28b7.540e-1437.37lin-28 homolog B [Source:NCBI gene;Acc:101160951][more]
lin28b9.980e-1437.37lin-28 homolog B [Source:NCBI gene;Acc:101160951][more]
back to top
BLAST of Y box protein-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058066.17.195e-63100.00SMESG000058066.1[more]
SMESG000058043.14.232e-4782.29SMESG000058043.1[more]
SMESG000058039.15.444e-4579.17SMESG000058039.1[more]
SMESG000073546.11.338e-3770.33SMESG000073546.1[more]
SMESG000078868.12.371e-3767.74SMESG000078868.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030766 ID=SMED30030766|Name=Y box protein-1|organism=Schmidtea mediterranea sexual|type=transcript|length=814bp
CTTAAATAAAACTTGATTTAACTAACTTAACATTTTGTTTATATACTTAT
ATAATTACAATAACAATAAATTCAATTTAATTTATAATGACTGCCTCACA
AGTTACTGGTCACGTCAAGTGGTTTAGTTCGAAAAATGGATATGGTTTCA
TCAGTGTTGACGATGATAACAATTCTAAGGACATCTTTGTTCACCATTCG
TCAATTACTGCAAACAATGCCACTTCCCTAGCTGATGGCGAAGAAGTCCT
TTTTGATATAGTTCAAGGAGCTAAAGGTCTAGAAGCAAGGAATGTGACAG
GGCCTAATGGTGGTGATGTCATTGGTGGTAAACCATACGAGCCAAGTGAT
AGATCAAATAATAGAGGTGATAGAGATAATTACAGAAATCAATCTTCAGG
ATACTCTGGTAATGGTGGCCAAAGATATGGAGGCGGTGGACACGGAGGTT
ATGGCGGTGATGATCGTAGAAGTGGACGAGGAGGTTATGGTGGTGATGAT
AGACGAAGTGGACGTGGAGGTTACGGAGGTGGAGATGACAGGAGAGGTGG
TCGCGGAGGATATGGTGGATATGGAGGAGATAGAAGACGTGATCAAGACG
ATAGTTATTAATGTAATATGAATTATATATGTCGATTTGTACAATACTTA
TGAAAACACGACTTTACGTTTTTGCGTTGTTTTATAAATCAAATCATGAT
TCAATTAACGGAATTTCGATTCATAAGTATTTGAAAGTGTTCTATGTACT
GTAGGTTAATATTTAATAAATTTGTGTATTTCATTTCAATATAAATTTTG
ACCACCAAAAAAAA
back to top

protein sequence of SMED30030766-orf-1

>SMED30030766-orf-1 ID=SMED30030766-orf-1|Name=SMED30030766-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=175bp
MTASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLAD
GEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNRGDRDNYR
NQSSGYSGNGGQRYGGGGHGGYGGDDRRSGRGGYGGDDRRSGRGGYGGGD
DRRGGRGGYGGYGGDRRRDQDDSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR002059CSP_DNA-bd
IPR011129CSD
IPR012340NA-bd_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002059Cold-shock protein, DNA-bindingPRINTSPR00050COLDSHOCKcoord: 46..64
score: 48.31
coord: 8..23
score: 61.24
IPR002059Cold-shock protein, DNA-bindingPFAMPF00313CSDcoord: 7..72
e-value: 2.3E-23
score: 81.8
IPR002059Cold-shock protein, DNA-bindingCDDcd04458CSP_CDScoord: 6..72
e-value: 6.10936E-22
score: 81.8562
IPR011129Cold shock domainSMARTSM00357csp_8coord: 7..73
e-value: 5.1E-23
score: 92.5
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 1..82
e-value: 3.9E-27
score: 96.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 69..174
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 124..150
NoneNo IPR availablePANTHERPTHR11544COLD SHOCK DOMAIN CONTAINING PROTEINScoord: 3..167
NoneNo IPR availablePANTHERPTHR11544:SF60LD37574Pcoord: 3..167
NoneNo IPR availablePROSITEPS51857CSD_2coord: 5..72
score: 27.33
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 4..72