asterix

Overview
Nameasterix (AHD24737.1)
Smed IDSMED30030764
Length (bp)1078
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of asterix (SMED30030764) t-SNE clustered cells

Violin plots show distribution of expression levels for asterix (SMED30030764) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of asterix (SMED30030764) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for asterix (SMED30030764) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030764

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30030764SMESG000020571.1 SMESG000020570.1 dd_Smed_v4_1529_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030764SMESG000020571.1 SMESG000020570.1 dd_Smed_v4_1529_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030764SMESG000004979.1 Contig2426GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030764SMESG000020570.1 Contig2426GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30030764SMESG000020570.1 dd_Smed_v6_1529_1_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of asterix vs. Ensembl Human
Match: COQ10B (coenzyme Q10B [Source:HGNC Symbol;Acc:HGNC:25819])

HSP 1 Score: 176.022 bits (445), Expect = 8.803e-53
Identity = 81/149 (54.36%), Postives = 106/149 (71.14%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
            KR +YSE+RI+GYSM +M++VVS VE Y  FVP+CKKSD+ +K     K  + +GFPP+ E Y S +T+ KP+LV +  + G LFN L TIW+F PGL   P++C LDFS+SFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP
Sbjct:   74 KRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGP 222          
BLAST of asterix vs. Ensembl Human
Match: COQ10B (coenzyme Q10B [Source:HGNC Symbol;Acc:HGNC:25819])

HSP 1 Score: 174.866 bits (442), Expect = 9.750e-53
Identity = 81/152 (53.29%), Postives = 107/152 (70.39%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGS 597
             KR +YSE+RI+GYSM +M++VVS VE Y  FVP+CKKSD+ +K     K  + +GFPP+ E Y S +T+ KP+LV +  + G LFN L TIW+F PGL   P++C LDFS+SFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP +
Sbjct:   45 NKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPET 196          
BLAST of asterix vs. Ensembl Human
Match: COQ10A (coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515])

HSP 1 Score: 169.088 bits (427), Expect = 3.697e-50
Identity = 76/150 (50.67%), Postives = 106/150 (70.67%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
             KR  YSE+RI+GYSM +M+EVVS+V++Y +FVP+CKKS + +      KA + VGFPP+ E Y S +++ KP++V +V + G LFN L TIW+F PG+   P++C +DFS+SFEFR  LHSQ A +FFD +V   V AF +RA   +GP
Sbjct:   65 NKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGP 214          
BLAST of asterix vs. Ensembl Human
Match: COQ10A (coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515])

HSP 1 Score: 168.703 bits (426), Expect = 3.712e-50
Identity = 76/150 (50.67%), Postives = 106/150 (70.67%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
             KR  YSE+RI+GYSM +M+EVVS+V++Y +FVP+CKKS + +      KA + VGFPP+ E Y S +++ KP++V +V + G LFN L TIW+F PG+   P++C +DFS+SFEFR  LHSQ A +FFD +V   V AF +RA   +GP
Sbjct:   50 NKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGP 199          
BLAST of asterix vs. Ensembl Human
Match: COQ10A (coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515])

HSP 1 Score: 169.474 bits (428), Expect = 4.042e-50
Identity = 76/150 (50.67%), Postives = 106/150 (70.67%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
             KR  YSE+RI+GYSM +M+EVVS+V++Y +FVP+CKKS + +      KA + VGFPP+ E Y S +++ KP++V +V + G LFN L TIW+F PG+   P++C +DFS+SFEFR  LHSQ A +FFD +V   V AF +RA   +GP
Sbjct:   82 NKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGP 231          
BLAST of asterix vs. Ensembl Celegans
Match: R144.13 (pep chromosome:WBcel235:III:5023264:5024064:1 gene:WBGene00044648.1 transcript:R144.13.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R144.13)

HSP 1 Score: 147.902 bits (372), Expect = 2.313e-43
Identity = 72/162 (44.44%), Postives = 102/162 (62.96%), Query Frame = 1
Query:  151 MKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVA-SGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKIISYE 633
            M YSEKR+IG+S D+MF+VVSDV  Y+ FVP+C+ S + ++   +  A + +GFPPL E Y S +   KP++VHSV      LF  L T ++F  G   + +SC L + + FEF  A HS+ A +FFD +V  MV AFL RAE +YGP      PP+++ Y+
Sbjct:    1 MAYSEKRLIGFSRDEMFKVVSDVSDYHNFVPWCRSSTVTHEHESSQIATLEIGFPPLSEKYSSRVIHIKPSVVHSVVIENDNLFRTLDTTFRFGKGKPSVERSCTLHYDLVFEFESAFHSRIAHLFFDKVVKTMVSAFLHRAEKLYGPPEFPHSPPQVLQYK 162          
BLAST of asterix vs. Ensembl Celegans
Match: K10B2.4 (pep chromosome:WBcel235:II:6360331:6360959:-1 gene:WBGene00019607.1 transcript:K10B2.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10B2.4)

HSP 1 Score: 119.783 bits (299), Expect = 2.988e-33
Identity = 53/107 (49.53%), Postives = 76/107 (71.03%), Query Frame = -1
Query:  767 MNSTNDPRRPNKIHRYK-----APVADGIPQDPTSDYINAIGMVLSMCGLMLKLKWAAWMAIYCAFITFANTKSSEDTKQTLSGFMLSISAVIMSYMQNIQPMTLPF 1072
            M    DPRR N+I RYK     A     I +DP  +Y+N +GM+ SMCGLM+++KW +W+A+ C+ I+FANT++S+D KQ +S FMLS+SAV+MSY+QN  P+  P+
Sbjct:    1 MQQNGDPRRTNRIVRYKPLDSTANQQQAISEDPLPEYMNVLGMIFSMCGLMIRMKWCSWLALVCSCISFANTRTSDDAKQIVSSFMLSVSAVVMSYLQNPSPIIPPW 107          
BLAST of asterix vs. Ensembl Fly
Match: CG9410 (gene:FBgn0033086 transcript:FBtr0086115)

HSP 1 Score: 164.466 bits (415), Expect = 5.935e-49
Identity = 77/157 (49.04%), Postives = 103/157 (65.61%), Query Frame = 1
Query:  139 KGKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQ 609
            + K   Y++K ++GYSM  M+ VVSDV  Y++FVPY K+SD+ ++    FKA+++VGFPPL EAY S +T+  P+LV S    G LFN LL  W F+PGL +IP SC+LDF VSFEF+  LHS  A IFFD I   M +AF++      GP S+   
Sbjct:   44 RKKHRWYTKKELVGYSMQDMYSVVSDVSNYHKFVPYVKRSDVHSRGSEGFKADLIVGFPPLNEAYTSQVTLVPPSLVKSECHDGRLFNYLLNEWSFKPGLKDIPNSCVLDFKVSFEFKSLLHSNVANIFFDLICDQMENAFIQEVRRRSGPPSIRSH 200          
BLAST of asterix vs. Ensembl Fly
Match: CG9410 (gene:FBgn0033086 transcript:FBtr0086116)

HSP 1 Score: 164.466 bits (415), Expect = 1.489e-48
Identity = 77/157 (49.04%), Postives = 103/157 (65.61%), Query Frame = 1
Query:  139 KGKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQ 609
            + K   Y++K ++GYSM  M+ VVSDV  Y++FVPY K+SD+ ++    FKA+++VGFPPL EAY S +T+  P+LV S    G LFN LL  W F+PGL +IP SC+LDF VSFEF+  LHS  A IFFD I   M +AF++      GP S+   
Sbjct:   79 RKKHRWYTKKELVGYSMQDMYSVVSDVSNYHKFVPYVKRSDVHSRGSEGFKADLIVGFPPLNEAYTSQVTLVPPSLVKSECHDGRLFNYLLNEWSFKPGLKDIPNSCVLDFKVSFEFKSLLHSNVANIFFDLICDQMENAFIQEVRRRSGPPSIRSH 235          
BLAST of asterix vs. Ensembl Fly
Match: CG10674 (gene:FBgn0035592 transcript:FBtr0077181)

HSP 1 Score: 127.102 bits (318), Expect = 5.507e-36
Identity = 60/106 (56.60%), Postives = 79/106 (74.53%), Query Frame = -1
Query:  767 MNSTNDPRRPNKIHRYKAPV----ADGIPQDPTSDYINAIGMVLSMCGLMLKLKWAAWMAIYCAFITFANTKSSEDTKQTLSGFMLSISAVIMSYMQNIQPMTLPF 1072
            MN T DPRR  KI+RYKAP     + G  +D   DY+N +GM+ SMCGLM+KLKW AW A+YC+ I+FA++++S+D KQ LS FMLS+SAV+MSY+QN   MT P+
Sbjct:    1 MNMTVDPRRKEKINRYKAPKNQGQSGGANEDMMPDYMNILGMIFSMCGLMMKLKWCAWFALYCSCISFASSRASDDAKQVLSSFMLSVSAVVMSYLQNPAAMTPPW 106          
BLAST of asterix vs. Ensembl Zebrafish
Match: coq10b (coenzyme Q10B [Source:NCBI gene;Acc:550442])

HSP 1 Score: 175.637 bits (444), Expect = 7.243e-53
Identity = 83/159 (52.20%), Postives = 109/159 (68.55%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPK 618
             KR +YSE+RIIGYSM +M+EVV+ VE Y  FVP+CKKSD+  +     KA + VGFPP+ E Y S ++  +P+LV +  S G LFN L T+W+F PGL   P++C LDF++SFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP   E Q P+
Sbjct:   73 NKRKEYSERRIIGYSMQEMYEVVAKVEDYLLFVPWCKKSDVIFRRSGFCKAKLTVGFPPVVENYTSLVSTVRPHLVKASCSDGKLFNHLETVWRFSPGLPGYPRTCTLDFAISFEFRSLLHSQLATVFFDEVVKQMVSAFERRASKLYGP---ETQIPR 228          
BLAST of asterix vs. Ensembl Zebrafish
Match: COQ10A (si:dkey-190g6.2 [Source:ZFIN;Acc:ZDB-GENE-090312-30])

HSP 1 Score: 172.17 bits (435), Expect = 2.231e-51
Identity = 81/150 (54.00%), Postives = 105/150 (70.00%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
             KR +YSE+RI+GYSM +M+EVV++V+ Y  FVP+CKKS    K     KA + VGFPP+ E Y S I+  +P+LV +V S G LFN L TIW+F PG+   P++C +DFSVSFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP
Sbjct:   84 NKRKEYSERRILGYSMQEMYEVVANVDDYKHFVPWCKKSQTIMKRAGHAKAQLEVGFPPVVERYTSMISHVRPHLVKAVCSDGKLFNHLETIWRFSPGIPGYPRTCTVDFSVSFEFRSLLHSQLATVFFDEVVKQMVAAFERRAGKLYGP 233          
BLAST of asterix vs. Ensembl Zebrafish
Match: wdr83os (WD repeat domain 83 opposite strand [Source:ZFIN;Acc:ZDB-GENE-040426-1674])

HSP 1 Score: 148.288 bits (373), Expect = 5.878e-44
Identity = 68/105 (64.76%), Postives = 86/105 (81.90%), Query Frame = -1
Query:  767 TMNSTNDPRRPNKIHRYKAPVADGIP--QDPTSDYINAIGMVLSMCGLMLKLKWAAWMAIYCAFITFANTKSSEDTKQTLSGFMLSISAVIMSYMQNIQPMTLPF 1075
            T+N+  DPRR NKI RYK P  +  P  +DPT DY+N +GM+ SMCGLMLKLKW AW+A+YC+FI+FAN++SSEDTKQ +S FMLSISAV+MSY+QN QPM+ P+
Sbjct:    2 TVNNMADPRRQNKIFRYKPPNTESNPTLEDPTPDYMNLLGMIFSMCGLMLKLKWCAWIAVYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMSPPW 106          
BLAST of asterix vs. Ensembl Zebrafish
Match: si:ch73-141c7.1 (si:ch73-141c7.1 [Source:NCBI gene;Acc:393762])

HSP 1 Score: 151.369 bits (381), Expect = 1.706e-43
Identity = 72/155 (46.45%), Postives = 103/155 (66.45%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQ 609
            +RM+YSE R I YS +QM++VV++VE+Y QFVP+CKKS +        +A + +GFPP+ E Y S +TV   + V +V + G LFN L T+W+F PG     +SC ++F V+FEF+  LHSQ A +FFD +V  MV+AF  RA+ +YG G   +Q
Sbjct:   74 RRMEYSESRSINYSPEQMYDVVANVEQYQQFVPWCKKSKVTRGRNGDMRAQLEIGFPPIVERYTSEVTVIPNHQVRAVCTDGSLFNHLETLWRFTPG--AAGQSCNVEFFVTFEFKSLLHSQLATMFFDEVVKQMVNAFETRAKKLYGTGVHRQQ 226          
BLAST of asterix vs. Ensembl Zebrafish
Match: coq10b (coenzyme Q10B [Source:NCBI gene;Acc:550442])

HSP 1 Score: 127.487 bits (319), Expect = 9.336e-35
Identity = 68/165 (41.21%), Postives = 91/165 (55.15%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKIISYEK 636
             KR +YSE+RIIGYSM +M+EVV+ VE Y  FVP+ +                                   P+LV +  S G LFN L T+W+F PGL   P++C LDF++SFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP   E Q P+ + + +
Sbjct:   73 NKRKEYSERRIIGYSMQEMYEVVAKVEDYLLFVPWFR-----------------------------------PHLVKASCSDGKLFNHLETVWRFSPGLPGYPRTCTLDFAISFEFRSLLHSQLATVFFDEVVKQMVSAFERRASKLYGP---ETQIPRELMFHE 199          
BLAST of asterix vs. Ensembl Xenopus
Match: coq10a (coenzyme Q10A [Source:NCBI gene;Acc:780028])

HSP 1 Score: 175.252 bits (443), Expect = 2.425e-52
Identity = 80/149 (53.69%), Postives = 109/149 (73.15%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
            KR +YSE+RI+GYSM +M+EVVS+VE+Y  FVP+CKKS + +K     KA + VGFPP+ E Y S +T+ +P+LV +V + G LFN L +IW+F PG+   P++C +DFS+SFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP
Sbjct:   83 KRKEYSERRIMGYSMQEMYEVVSNVEEYKLFVPWCKKSTVISKRTGYAKAQLEVGFPPILERYTSILTLVRPHLVKAVCTDGRLFNHLESIWRFSPGIPGYPRTCTVDFSISFEFRSLLHSQLATVFFDEVVKQMVAAFERRAGKMYGP 231          
BLAST of asterix vs. Ensembl Xenopus
Match: wdr83os (WD repeat domain 83 opposite strand [Source:NCBI gene;Acc:100144944])

HSP 1 Score: 156.762 bits (395), Expect = 4.828e-47
Identity = 70/105 (66.67%), Postives = 86/105 (81.90%), Query Frame = -1
Query:  767 TMNSTNDPRRPNKIHRYKAPVADGIP--QDPTSDYINAIGMVLSMCGLMLKLKWAAWMAIYCAFITFANTKSSEDTKQTLSGFMLSISAVIMSYMQNIQPMTLPF 1075
            T N  NDPRRP K+HRYKAP  +  P   DPT DY+N +GM+ SMCGLMLKLKW AW+A+YC+FI+FAN++SSEDTKQ +S FMLSISAV+MSY+QN QPM+ P+
Sbjct:    2 TGNGANDPRRPGKVHRYKAPTTESSPTLDDPTPDYMNLLGMIFSMCGLMLKLKWCAWIAVYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMSPPW 106          
BLAST of asterix vs. Ensembl Xenopus
Match: mkx (mohawk homeobox [Source:Xenbase;Acc:XB-GENE-853539])

HSP 1 Score: 151.369 bits (381), Expect = 1.751e-43
Identity = 72/148 (48.65%), Postives = 100/148 (67.57%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYG 588
            KR++YSE +++GYS++QM+++V+DV  Y  FVP+C  S + +      +A + VGFPP+ E YVS I+V   + V +V S G LF+ L T+W+F PGL   P +C LDF VSFEF+  LHSQ A +FFD +V  MV AF K+A  IYG
Sbjct:   64 KRIEYSESKVLGYSIEQMYDIVADVANYKIFVPWCNCSKVLSCKKGVTRAELEVGFPPVVERYVSEISVIPRHQVRAVCSDGRLFSHLETVWRFSPGLSGRPDTCTLDFYVSFEFKSLLHSQLANVFFDEVVKQMVCAFEKQAARIYG 211          
BLAST of asterix vs. Ensembl Xenopus
Match: mkx (mohawk homeobox [Source:Xenbase;Acc:XB-GENE-853539])

HSP 1 Score: 151.369 bits (381), Expect = 2.309e-43
Identity = 72/148 (48.65%), Postives = 100/148 (67.57%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYG 588
            KR++YSE +++GYS++QM+++V+DV  Y  FVP+C  S + +      +A + VGFPP+ E YVS I+V   + V +V S G LF+ L T+W+F PGL   P +C LDF VSFEF+  LHSQ A +FFD +V  MV AF K+A  IYG
Sbjct:   78 KRIEYSESKVLGYSIEQMYDIVADVANYKIFVPWCNCSKVLSCKKGVTRAELEVGFPPVVERYVSEISVIPRHQVRAVCSDGRLFSHLETVWRFSPGLSGRPDTCTLDFYVSFEFKSLLHSQLANVFFDEVVKQMVCAFEKQAARIYG 225          
BLAST of asterix vs. Ensembl Mouse
Match: Coq10b (coenzyme Q10B [Source:MGI Symbol;Acc:MGI:1915126])

HSP 1 Score: 175.252 bits (443), Expect = 1.620e-52
Identity = 81/150 (54.00%), Postives = 106/150 (70.67%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
             KR +YSE+RI+GYSM +M++VVS +E Y  FVP+CKKSDI ++     K  + VGFPP+ E Y S +T+ KP+LV +  + G LFN L TIW+F PGL   P++C LDFS+SFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP
Sbjct:   77 NKRKEYSERRILGYSMQEMYDVVSGMEDYQHFVPWCKKSDIISRRSGYCKTRLEVGFPPVLERYTSIVTLVKPHLVKASCTDGKLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGP 226          
BLAST of asterix vs. Ensembl Mouse
Match: Coq10a (coenzyme Q10A [Source:MGI Symbol;Acc:MGI:2684847])

HSP 1 Score: 169.859 bits (429), Expect = 2.451e-50
Identity = 77/150 (51.33%), Postives = 106/150 (70.67%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
             KR  YSE+RI+GYSM +MFEVVS+V++Y +FVP+CKKS + +      KA + VGFPP+ E Y S +++ KP++V +V + G LFN L TIW+F PG+   P++C +DFS+SFEFR  LHSQ A +FFD +V   V AF +RA   +GP
Sbjct:   84 NKRKAYSERRIMGYSMQEMFEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVLERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPSYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGP 233          
BLAST of asterix vs. Ensembl Mouse
Match: Coq10a (coenzyme Q10A [Source:MGI Symbol;Acc:MGI:2684847])

HSP 1 Score: 168.703 bits (426), Expect = 2.648e-50
Identity = 77/150 (51.33%), Postives = 106/150 (70.67%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
             KR  YSE+RI+GYSM +MFEVVS+V++Y +FVP+CKKS + +      KA + VGFPP+ E Y S +++ KP++V +V + G LFN L TIW+F PG+   P++C +DFS+SFEFR  LHSQ A +FFD +V   V AF +RA   +GP
Sbjct:   52 NKRKAYSERRIMGYSMQEMFEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVLERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPSYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGP 201          
BLAST of asterix vs. Ensembl Mouse
Match: Coq10a (coenzyme Q10A [Source:MGI Symbol;Acc:MGI:2684847])

HSP 1 Score: 161.77 bits (408), Expect = 3.237e-47
Identity = 77/160 (48.12%), Postives = 106/160 (66.25%), Query Frame = 1
Query:  142 GKRMKYSEKRIIG----------YSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
             KR  YSE+RI+G          YSM +MFEVVS+V++Y +FVP+CKKS + +      KA + VGFPP+ E Y S +++ KP++V +V + G LFN L TIW+F PG+   P++C +DFS+SFEFR  LHSQ A +FFD +V   V AF +RA   +GP
Sbjct:   84 NKRKAYSERRIMGSSASDSSCCRYSMQEMFEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVLERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPSYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGP 243          
BLAST of asterix vs. Ensembl Mouse
Match: Coq10b (coenzyme Q10B [Source:MGI Symbol;Acc:MGI:1915126])

HSP 1 Score: 158.688 bits (400), Expect = 8.451e-47
Identity = 74/141 (52.48%), Postives = 97/141 (68.79%), Query Frame = 1
Query:  169 RIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
            R + YSM +M++VVS +E Y  FVP+CKKSDI ++     K  + VGFPP+ E Y S +T+ KP+LV +  + G LFN L TIW+F PGL   P++C LDFS+SFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP
Sbjct:   36 RDVRYSMQEMYDVVSGMEDYQHFVPWCKKSDIISRRSGYCKTRLEVGFPPVLERYTSIVTLVKPHLVKASCTDGKLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGP 176          
BLAST of asterix vs. UniProt/SwissProt
Match: sp|Q5RD79|CQ10B_PONAB (Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Pongo abelii OX=9601 GN=COQ10B PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 4.050e-52
Identity = 81/149 (54.36%), Postives = 106/149 (71.14%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
            KR +YSE+RI+GYSM +M++VVS VE Y  FVP+CKKSD+ +K     K  + +GFPP+ E Y S +T+ KP+LV +  + G LFN L TIW+F PGL   P++C LDFS+SFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP
Sbjct:   74 KRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGP 222          
BLAST of asterix vs. UniProt/SwissProt
Match: sp|Q9H8M1|CQ10B_HUMAN (Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Homo sapiens OX=9606 GN=COQ10B PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 4.228e-52
Identity = 81/149 (54.36%), Postives = 106/149 (71.14%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
            KR +YSE+RI+GYSM +M++VVS VE Y  FVP+CKKSD+ +K     K  + +GFPP+ E Y S +T+ KP+LV +  + G LFN L TIW+F PGL   P++C LDFS+SFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP
Sbjct:   74 KRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGP 222          
BLAST of asterix vs. UniProt/SwissProt
Match: sp|Q567E6|CQ10B_DANRE (Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Danio rerio OX=7955 GN=coq10b PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 4.706e-52
Identity = 83/159 (52.20%), Postives = 109/159 (68.55%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPK 618
             KR +YSE+RIIGYSM +M+EVV+ VE Y  FVP+CKKSD+  +     KA + VGFPP+ E Y S ++  +P+LV +  S G LFN L T+W+F PGL   P++C LDF++SFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP   E Q P+
Sbjct:   73 NKRKEYSERRIIGYSMQEMYEVVAKVEDYLLFVPWCKKSDVIFRRSGFCKAKLTVGFPPVVENYTSLVSTVRPHLVKASCSDGKLFNHLETVWRFSPGLPGYPRTCTLDFAISFEFRSLLHSQLATVFFDEVVKQMVSAFERRASKLYGP---ETQIPR 228          
BLAST of asterix vs. UniProt/SwissProt
Match: sp|Q6DFA6|CQ10A_XENLA (Coenzyme Q-binding protein COQ10 homolog A, mitochondrial OS=Xenopus laevis OX=8355 GN=coq10b-a PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 4.952e-52
Identity = 81/149 (54.36%), Postives = 109/149 (73.15%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
            KR +YSE+RI+GYSM +M+EVVS+VE+Y  FVP+CKKS + +K     KA + VGFPP+ E Y S +T+ +P+LV +V + G LFN L +IW+F PG+   P++C +DFS+SFEFR  LHSQ A +FFD +V  MV AF +RA  IYGP
Sbjct:   83 KRKEYSERRIMGYSMQEMYEVVSNVEEYKLFVPWCKKSTVISKRTGYAKAQLEVGFPPILERYTSILTLVRPHLVKAVCTDGRLFNHLESIWRFSPGIPGYPRTCTVDFSISFEFRSLLHSQLATVFFDEVVKQMVAAFERRAGKIYGP 231          
BLAST of asterix vs. UniProt/SwissProt
Match: sp|Q3THF9|CQ10B_MOUSE (Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Mus musculus OX=10090 GN=Coq10b PE=1 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 8.624e-52
Identity = 81/150 (54.00%), Postives = 106/150 (70.67%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
             KR +YSE+RI+GYSM +M++VVS +E Y  FVP+CKKSDI ++     K  + VGFPP+ E Y S +T+ KP+LV +  + G LFN L TIW+F PGL   P++C LDFS+SFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP
Sbjct:   75 NKRKEYSERRILGYSMQEMYDVVSGMEDYQHFVPWCKKSDIISRRSGYCKTRLEVGFPPVLERYTSIVTLVKPHLVKASCTDGKLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGP 224          
BLAST of asterix vs. TrEMBL
Match: V9XQP7 (Asterix OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 1.872e-66
Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = -1
Query:  767 MNSTNDPRRPNKIHRYKAPVADGIPQDPTSDYINAIGMVLSMCGLMLKLKWAAWMAIYCAFITFANTKSSEDTKQTLSGFMLSISAVIMSYMQNIQPMTLPF 1072
            MNSTNDPRRPNKIHRYKAPVADGIPQDPTSDYINAIGMVLSMCGLMLKLKWAAWMAIYCAFITFANTKSSEDTKQTLSGFMLSISAVIMSYMQNIQPMTLPF
Sbjct:    1 MNSTNDPRRPNKIHRYKAPVADGIPQDPTSDYINAIGMVLSMCGLMLKLKWAAWMAIYCAFITFANTKSSEDTKQTLSGFMLSISAVIMSYMQNIQPMTLPF 102          
BLAST of asterix vs. TrEMBL
Match: A0A0P4WJT9 (Polyketide_cyc domain-containing protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 6.882e-57
Identity = 89/161 (55.28%), Postives = 123/161 (76.40%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKII 624
            GK+ +YSE+R++GYSM+QMF+VVS VE Y++FVPYCKKS +  +     KA++VVGFPP+ E+Y S++T++KP+LV +V + G LFN LLTIWKF PG+   P +C LDFSVSFEFR A+HSQ A +FFD +V   V++FL+ AE  YG  S+  +PP+I+
Sbjct:   66 GKKKEYSERRVLGYSMNQMFDVVSQVEDYHKFVPYCKKSLVTVRRPGFLKADLVVGFPPVVESYTSSVTLAKPHLVRAVCTEGKLFNHLLTIWKFSPGIRGQPNTCTLDFSVSFEFRSAIHSQLAHVFFDEMVRKNVNSFLREAEKRYGKASIVARPPRIL 226          
BLAST of asterix vs. TrEMBL
Match: A0A0L8GK14 (Polyketide_cyc domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22032191mg PE=4 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 9.925e-57
Identity = 92/176 (52.27%), Postives = 125/176 (71.02%), Query Frame = 1
Query:  103 SKRCLFKDGIFGKGKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKIISY 630
             KR LF    F   +R +YSE+R++GYSM+Q+F VV+DVE+Y +FVP+C K+ IF++    FKA + +GFPPL E Y S +T++KP+LV S  + G LFN L T W+FRPGL     +C+LDF+V+FEFR ALHSQ + +FFD +V  MV +FLKR + IYGP  ++ Q PKII Y
Sbjct:   35 EKRELFTLPNFN-NRRKEYSERRLLGYSMEQIFTVVADVERYPEFVPWCTKAVIFHRLPNHFKAKLQIGFPPLIEQYTSVVTLAKPHLVKSECTNGKLFNLLETTWRFRPGLPNNENTCVLDFAVAFEFRSALHSQLSTLFFDEVVKQMVKSFLKRTKSIYGPECIKSQNPKIIKY 209          
BLAST of asterix vs. TrEMBL
Match: K1R646 (Coenzyme Q-binding protein COQ10-like protein B, mitochondrial OS=Crassostrea gigas OX=29159 GN=CGI_10020149 PE=4 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 3.068e-56
Identity = 91/177 (51.41%), Postives = 127/177 (71.75%), Query Frame = 1
Query:  103 SKRCLFK----DGIFGKGKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKI 621
            S RCLF+        GKGK+ +YSE+R++GYSM+QM+ VVS+VE Y +FVP+CK+S  F +     +  + VGFPPL E Y S +T++KPNLV S  + G LFN +LTIW+FRPGL + P +CILDFSV+FEFR+A+HS   ++FFD +   MV+AFLKRA  +YGP +++ +  K+
Sbjct:  169 SYRCLFQLPKFKSPLGKGKKQEYSERRLLGYSMEQMYTVVSEVEHYKEFVPWCKESTKFGERPGHCQCILEVGFPPLSERYTSLVTLAKPNLVRSECTDGKLFNHMLTIWRFRPGLPDNPNTCILDFSVAFEFRYAIHSHMTQMFFDEVTKTMVNAFLKRARQLYGPETIKSRQLKV 345          
BLAST of asterix vs. TrEMBL
Match: A0A423SD29 (Polyketide_cyc domain-containing protein OS=Penaeus vannamei OX=6689 GN=C7M84_020089 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 7.224e-56
Identity = 89/166 (53.61%), Postives = 121/166 (72.89%), Query Frame = 1
Query:  127 GIFGKGKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKII 624
            G  G  K+ +YSE+RI+GYSM+QM++VVS+VE YY+FVPYCKKSD+  +     KA++ VGFPP+ E+Y S++T+++P+LV +V + G LFN LLTIWKF PGL   P +C LDFSVSFEFR  LHSQ A +FF+ +V   V++FL  A+  YG  S+  Q P+I 
Sbjct:   79 GALG-SKKKEYSERRILGYSMNQMYDVVSEVENYYKFVPYCKKSDVKLRRPGFLKADLTVGFPPVVESYTSSVTLARPHLVRAVCTEGKLFNHLLTIWKFSPGLQGQPNTCTLDFSVSFEFRSMLHSQLAHVFFNEVVRKNVNSFLAEAQKRYGKQSIRAQQPRIT 243          
BLAST of asterix vs. Ensembl Cavefish
Match: coq10b (coenzyme Q10B [Source:NCBI gene;Acc:550442])

HSP 1 Score: 175.637 bits (444), Expect = 5.218e-53
Identity = 83/165 (50.30%), Postives = 112/165 (67.88%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKIISYEK 636
             KR +YSE+RIIGYSM +M+EVV+ VE Y  FVP+CK+SD+  +     KA + VGFPP+ E Y S IT  +P++V +  S G LFN L T+W+F PGL   P++C LDF++SFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP   E Q P+ + + +
Sbjct:   60 NKRKEYSERRIIGYSMQEMYEVVAKVEDYLHFVPWCKRSDVVFRRSGFCKAKLTVGFPPVVENYTSLITTVRPHMVKASCSDGKLFNHLETVWRFSPGLPGYPRTCTLDFAISFEFRSLLHSQLATVFFDEVVKQMVSAFERRACKLYGP---ETQIPRELMFHE 221          
BLAST of asterix vs. Ensembl Cavefish
Match: coq10b (coenzyme Q10B [Source:NCBI gene;Acc:550442])

HSP 1 Score: 175.637 bits (444), Expect = 1.258e-52
Identity = 83/157 (52.87%), Postives = 108/157 (68.79%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPP 615
            KR +YSE+RIIGYSM +M+EVV+ VE Y  FVP+CK+SD+  +     KA + VGFPP+ E Y S IT  +P++V +  S G LFN L T+W+F PGL   P++C LDF++SFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP   E Q P
Sbjct:   74 KRKEYSERRIIGYSMQEMYEVVAKVEDYLHFVPWCKRSDVVFRRSGFCKAKLTVGFPPVVENYTSLITTVRPHMVKASCSDGKLFNHLETVWRFSPGLPGYPRTCTLDFAISFEFRSLLHSQLATVFFDEVVKQMVSAFERRACKLYGP---ETQIP 227          
BLAST of asterix vs. Ensembl Cavefish
Match: coq10b (coenzyme Q10B [Source:NCBI gene;Acc:550442])

HSP 1 Score: 175.637 bits (444), Expect = 1.509e-52
Identity = 83/157 (52.87%), Postives = 108/157 (68.79%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPP 615
            KR +YSE+RIIGYSM +M+EVV+ VE Y  FVP+CK+SD+  +     KA + VGFPP+ E Y S IT  +P++V +  S G LFN L T+W+F PGL   P++C LDF++SFEFR  LHSQ A +FFD +V  MV AF +RA  +YGP   E Q P
Sbjct:   74 KRKEYSERRIIGYSMQEMYEVVAKVEDYLHFVPWCKRSDVVFRRSGFCKAKLTVGFPPVVENYTSLITTVRPHMVKASCSDGKLFNHLETVWRFSPGLPGYPRTCTLDFAISFEFRSLLHSQLATVFFDEVVKQMVSAFERRACKLYGP---ETQIP 227          
BLAST of asterix vs. Ensembl Cavefish
Match: COQ10A (coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515])

HSP 1 Score: 169.474 bits (428), Expect = 7.545e-51
Identity = 79/149 (53.02%), Postives = 105/149 (70.47%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
            KR +YSE+RI+GYSM +M++VV++V+ Y  FVP+CKKS+   K     KA + +GFPP+ E Y S IT  +P+LV +V S G LFN L TIW+F PG+   P++C +DFS+SFEFR  LHSQ A +FFD +V  MV AF  RA  +YGP
Sbjct:   46 KRKQYSERRIMGYSMQEMYDVVANVDDYKLFVPWCKKSETIMKRAGHAKAQLEIGFPPVVERYTSMITNVRPHLVKAVCSDGKLFNHLETIWRFSPGIPGYPRTCTVDFSISFEFRSILHSQLATVFFDEVVKQMVAAFENRAGKLYGP 194          
BLAST of asterix vs. Ensembl Cavefish
Match: COQ10A (coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515])

HSP 1 Score: 170.244 bits (430), Expect = 7.833e-51
Identity = 79/149 (53.02%), Postives = 105/149 (70.47%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
            KR +YSE+RI+GYSM +M++VV++V+ Y  FVP+CKKS+   K     KA + +GFPP+ E Y S IT  +P+LV +V S G LFN L TIW+F PG+   P++C +DFS+SFEFR  LHSQ A +FFD +V  MV AF  RA  +YGP
Sbjct:   67 KRKQYSERRIMGYSMQEMYDVVANVDDYKLFVPWCKKSETIMKRAGHAKAQLEIGFPPVVERYTSMITNVRPHLVKAVCSDGKLFNHLETIWRFSPGIPGYPRTCTVDFSISFEFRSILHSQLATVFFDEVVKQMVAAFENRAGKLYGP 215          
BLAST of asterix vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001448.1 (pep scaffold:Pmarinus_7.0:GL476436:271081:272492:-1 gene:ENSPMAG00000001303.1 transcript:ENSPMAT00000001448.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.303 bits (399), Expect = 3.454e-47
Identity = 71/149 (47.65%), Postives = 105/149 (70.47%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
            KR  Y+E+ ++GYS +QM+ +V++VE Y +FVP+CK+S +  +     +A++ VGFPPL E+Y ST+T+ +P++V +  + G LFN L T W+F  G    P+SC ++FS+SFEFR  LHSQ A +FFD +V  MV AFL+RA  +YGP
Sbjct:   46 KRKDYAERHLVGYSKEQMYAIVANVESYREFVPWCKRSRVTFRRPGFMRADLQVGFPPLVESYSSTVTLVEPHIVRATCTDGRLFNHLETEWRFGRGAPGHPESCTIEFSISFEFRSLLHSQMASMFFDEVVKQMVTAFLRRAAKMYGP 194          
BLAST of asterix vs. Ensembl Sea Lamprey
Match: coq10b (coenzyme Q10B [Source:NCBI gene;Acc:550442])

HSP 1 Score: 156.762 bits (395), Expect = 1.129e-46
Identity = 73/149 (48.99%), Postives = 103/149 (69.13%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYG 588
             KR +YSE+RI+GYSM +M+ VV++VE Y  FVP+ KKS +  +     KA + VGFPP+ E Y S++T+ +P+LV ++ + G +FN L T+W+F PG+  I +SC LDFS SFEFR  LHSQ A +FFD +V  MV AF +R   ++G
Sbjct:   41 NKRKEYSERRILGYSMQEMYGVVANVEDYKTFVPWVKKSLVVFQRSSHIKAQLEVGFPPMIERYTSSVTLVEPHLVKAICTDGRIFNHLETVWRFSPGIPGIQRSCTLDFSTSFEFRSLLHSQLAGMFFDEVVKQMVGAFERRVCKLHG 189          
BLAST of asterix vs. Ensembl Yeast
Match: COQ10 (Coenzyme Q (ubiquinone) binding protein; functions in the delivery of Q6 to its proper location for electron transport during respiration; START domain protein with homologs in bacteria and eukaryotes; respiratory growth defect of the null mutant is functionally complemented by human COQ10A [Source:SGD;Acc:S000005368])

HSP 1 Score: 56.225 bits (134), Expect = 9.172e-10
Identity = 40/170 (23.53%), Postives = 81/170 (47.65%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYC------KKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGI---LFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDI-----YGPGSLEKQP 612
            +  +Y  ++ I      ++  VS+V +Y +F+PYC      K++ + NK      A + VGF    E ++  +T    +  ++V +  I   LF+ L++ W   P     P + +++  + F+F+  +++  + IF   +  ++++AF KRA  +       P S E  P
Sbjct:   42 REQRYVLRKAINAPPSTVYAAVSEVAQYKEFIPYCVDSFVDKRNPVDNKP---LIAGLRVGFKQYDEEFICNVTCKDTDHTYTVVAETISHNLFHLLISKWTIMPH-PNRPNAAMVELLLRFKFKSRIYNSVSLIFAKTVTELVMNAFAKRAYHLVRLAMLKPSSKEGSP 207          
BLAST of asterix vs. Ensembl Nematostella
Match: EDO42929 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZZ7])

HSP 1 Score: 150.599 bits (379), Expect = 8.992e-45
Identity = 71/144 (49.31%), Postives = 95/144 (65.97%), Query Frame = 1
Query:  175 IGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPL-KEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLE 603
            +GYSM+ M+ VV+DV+ Y  FVP+C+ S  F +    FKA + VGFPPL  E Y ST+T+  PNLV S  + G +FN +LT+WKF PGL + P +C LDF V FEF+  LHS+ + +FFD +V  MV AF  R   +YGP  L+
Sbjct:    1 MGYSMEDMYNVVADVDDYKHFVPWCRDSTTFRRRPGCFKAKLCVGFPPLLSEKYTSTVTIVPPNLVKSECTDGEMFNYMLTVWKFGPGLKDNPNTCTLDFFVEFEFKSLLHSRLSTMFFDEVVKKMVRAFEDRCAYLYGPQRLK 144          
BLAST of asterix vs. Ensembl Nematostella
Match: EDO45165 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTY3])

HSP 1 Score: 141.739 bits (356), Expect = 6.820e-42
Identity = 65/96 (67.71%), Postives = 79/96 (82.29%), Query Frame = -1
Query:  779 STNDPRRPNKIHRYKAPVADGIPQDPTSDYINAIGMVLSMCGLMLKLKWAAWMAIYCAFITFANTKSSEDTKQTLSGFMLSISAVIMSYMQNIQPM 1066
            S+ DPRR NKI RYK P A+   +DP  DY+N +GMVLSMCGLM+KLKWAAW A+YC+FI+FAN +SSEDTKQ  S F+LS+SAV+MSY+QN QPM
Sbjct:   11 SSQDPRRSNKIFRYK-PSANKPLEDPIPDYMNLLGMVLSMCGLMMKLKWAAWAAVYCSFISFANARSSEDTKQMFSSFLLSVSAVVMSYLQNPQPM 105          
BLAST of asterix vs. Ensembl Nematostella
Match: EDO25411 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWJ9])

HSP 1 Score: 46.595 bits (109), Expect = 4.925e-6
Identity = 27/110 (24.55%), Postives = 54/110 (49.09%), Query Frame = 1
Query:  172 IIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHAL 501
            ++ Y    +F++V+DV  Y QF+P+C  S++   S    +A++ V    L + +V+  T+    L+      G  F +L   W+F+       K+C +   ++F++   L
Sbjct:  138 LLPYPARALFDLVNDVASYPQFLPWCSASEVLESSDTHMRASLAVAKGGLSQRFVTANTLVPGELIKLTLVEGP-FTQLYGHWEFKA---LGDKACKISLDLTFDYAGPL 243          
BLAST of asterix vs. Ensembl Medaka
Match: coq10b (coenzyme Q10B [Source:NCBI gene;Acc:101164043])

HSP 1 Score: 166.392 bits (420), Expect = 2.494e-49
Identity = 77/148 (52.03%), Postives = 102/148 (68.92%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYG 588
            KR +YSE+RIIGYSM +++EVV+ VE Y  FVP+C KS++        KA + VGFPP+ E Y S +T  +P+LV +  S G LFN L T+W+F PGL   P++C +DFS+SFEFR  LHSQ A +FFD +V  MV AF +RA  I+G
Sbjct:   74 KRREYSERRIIGYSMQEIYEVVAGVENYRLFVPWCTKSEVVFSRSGFCKAKLTVGFPPVVENYTSLVTTVRPHLVKASCSEGKLFNHLETVWRFSPGLPGYPRTCTVDFSISFEFRSLLHSQLAHVFFDEVVKQMVSAFERRASKIHG 221          
BLAST of asterix vs. Ensembl Medaka
Match: si:dkey-190g6.2 (coenzyme Q-binding protein COQ10 homolog A, mitochondrial [Source:NCBI gene;Acc:101155688])

HSP 1 Score: 164.851 bits (416), Expect = 1.285e-48
Identity = 77/150 (51.33%), Postives = 103/150 (68.67%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGP 591
             KR +YSE+RI+GYSM +M++VV++V+ Y  FVP+CKKS    K     KA + VGF P+ E Y S IT  +P+LV +V + G LFN L TIW+F PG+   P++C +DFS+SFEFR  LHSQ A +FFD +V   V AF +RA  +YGP
Sbjct:   84 NKRKEYSERRILGYSMQEMYDVVANVDDYKLFVPWCKKSQTIMKRAGHSKAQLEVGFSPVIERYTSMITCVRPHLVKAVCTDGKLFNHLETIWRFSPGIPGYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRASKLYGP 233          
BLAST of asterix vs. Ensembl Medaka
Match: wdr83os (WD repeat domain 83 opposite strand [Source:NCBI gene;Acc:101169408])

HSP 1 Score: 146.362 bits (368), Expect = 2.801e-43
Identity = 67/103 (65.05%), Postives = 84/103 (81.55%), Query Frame = -1
Query:  767 NSTNDPRRPNKIHRYKAPVADGIP--QDPTSDYINAIGMVLSMCGLMLKLKWAAWMAIYCAFITFANTKSSEDTKQTLSGFMLSISAVIMSYMQNIQPMTLPF 1069
            N+  DPRR NKI RYK P  +  P  +DPT DY+N +GM+ SMCGLMLKLKW AW+A+YC+FI+FAN++SSEDTKQ +S FMLSISAV+MSY+QN QPM+ P+
Sbjct:    4 NNMADPRRQNKILRYKPPSTESNPTLEDPTPDYMNLLGMIFSMCGLMLKLKWCAWIAVYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMSPPW 106          
BLAST of asterix vs. Ensembl Medaka
Match: si:ch73-141c7.1 (coenzyme Q-binding protein COQ10 homolog, mitochondrial [Source:NCBI gene;Acc:101164311])

HSP 1 Score: 146.362 bits (368), Expect = 1.296e-41
Identity = 66/147 (44.90%), Postives = 94/147 (63.95%), Query Frame = 1
Query:  145 KRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIY 585
            +R++Y+E R + Y+ +QM+ VV++VEKY  FVP+CKKS +        +A + +GFPP+ E Y S +T      V ++ + G LFN L TIW+F PG  + P SC++DF VSFEF+  LHSQ A +F D +V  MV AF  RA  +Y
Sbjct:   71 RRVEYTESRTLEYTPEQMYNVVANVEKYQYFVPWCKKSRVIKGRNGNVQAELEIGFPPITERYTSDVTFDPNRQVRAICTEGSLFNHLETIWRFSPGAKDQPNSCLVDFLVSFEFKSLLHSQLASMFLDEVVKQMVGAFESRAAALY 217          
BLAST of asterix vs. Ensembl Medaka
Match: si:dkey-190g6.2 (coenzyme Q-binding protein COQ10 homolog A, mitochondrial [Source:NCBI gene;Acc:101155688])

HSP 1 Score: 122.094 bits (305), Expect = 3.326e-32
Identity = 57/113 (50.44%), Postives = 78/113 (69.03%), Query Frame = 1
Query:  142 GKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVS 480
             KR +YSE+RI+GYSM +M++VV++V+ Y  FVP+CKKS    K     KA + VGF P+ E Y S IT  +P+LV +V + G LFN L TIW+F PG+   P++C +DFSVS
Sbjct:   84 NKRKEYSERRILGYSMQEMYDVVANVDDYKLFVPWCKKSQTIMKRAGHSKAQLEVGFSPVIERYTSMITCVRPHLVKAVCTDGKLFNHLETIWRFSPGIPGYPRTCTVDFSVS 196          
BLAST of asterix vs. Planmine SMEST
Match: SMESG000020570.1 (SMESG000020570.1)

HSP 1 Score: 398.667 bits (1023), Expect = 4.174e-141
Identity = 195/195 (100.00%), Postives = 195/195 (100.00%), Query Frame = 1
Query:   52 MISKKNLIFVSRFNLFYSKRCLFKDGIFGKGKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKIISYEK 636
            MISKKNLIFVSRFNLFYSKRCLFKDGIFGKGKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKIISYEK
Sbjct:    1 MISKKNLIFVSRFNLFYSKRCLFKDGIFGKGKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKIISYEK 195          
BLAST of asterix vs. Planmine SMEST
Match: SMESG000020570.1 (SMESG000020570.1)

HSP 1 Score: 332.413 bits (851), Expect = 1.371e-115
Identity = 162/162 (100.00%), Postives = 162/162 (100.00%), Query Frame = 1
Query:  151 MKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKIISYEK 636
            MKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKIISYEK
Sbjct:    1 MKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKIISYEK 162          
BLAST of asterix vs. Planmine SMEST
Match: SMESG000020571.1 (SMESG000020571.1)

HSP 1 Score: 214.542 bits (545), Expect = 5.207e-70
Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = -1
Query:  767 MNSTNDPRRPNKIHRYKAPVADGIPQDPTSDYINAIGMVLSMCGLMLKLKWAAWMAIYCAFITFANTKSSEDTKQTLSGFMLSISAVIMSYMQNIQPMTLPF 1072
            MNSTNDPRRPNKIHRYKAPVADGIPQDPTSDYINAIGMVLSMCGLMLKLKWAAWMAIYCAFITFANTKSSEDTKQTLSGFMLSISAVIMSYMQNIQPMTLPF
Sbjct:    1 MNSTNDPRRPNKIHRYKAPVADGIPQDPTSDYINAIGMVLSMCGLMLKLKWAAWMAIYCAFITFANTKSSEDTKQTLSGFMLSISAVIMSYMQNIQPMTLPF 102          
BLAST of asterix vs. Planmine SMEST
Match: SMESG000052094.1 (SMESG000052094.1)

HSP 1 Score: 204.527 bits (519), Expect = 2.849e-65
Identity = 97/162 (59.88%), Postives = 125/162 (77.16%), Query Frame = 1
Query:  151 MKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKIISYEK 636
            M+Y EKRIIGYS +QMF VVS VE+YYQFVPYCKKS I ++   TFKA+++VGFPPL  +YVS +T  +PN+V S+ SG  +FNEL+T W FR GL EIP S IL+FS++FEF+  L+S+ A++FFDHIV  MV+AFL R+E  YGP S+ KQ P I+SY +
Sbjct:    1 MQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSLIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIPKQSPMILSYSR 162          
The following BLAST results are available for this feature:
BLAST of asterix vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COQ10B8.803e-5354.36coenzyme Q10B [Source:HGNC Symbol;Acc:HGNC:25819][more]
COQ10B9.750e-5353.29coenzyme Q10B [Source:HGNC Symbol;Acc:HGNC:25819][more]
COQ10A3.697e-5050.67coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515][more]
COQ10A3.712e-5050.67coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515][more]
COQ10A4.042e-5050.67coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515][more]
back to top
BLAST of asterix vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
R144.132.313e-4344.44pep chromosome:WBcel235:III:5023264:5024064:1 gene... [more]
K10B2.42.988e-3349.53pep chromosome:WBcel235:II:6360331:6360959:-1 gene... [more]
back to top
BLAST of asterix vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG94105.935e-4949.04gene:FBgn0033086 transcript:FBtr0086115[more]
CG94101.489e-4849.04gene:FBgn0033086 transcript:FBtr0086116[more]
CG106745.507e-3656.60gene:FBgn0035592 transcript:FBtr0077181[more]
back to top
BLAST of asterix vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coq10b7.243e-5352.20coenzyme Q10B [Source:NCBI gene;Acc:550442][more]
COQ10A2.231e-5154.00si:dkey-190g6.2 [Source:ZFIN;Acc:ZDB-GENE-090312-3... [more]
wdr83os5.878e-4464.76WD repeat domain 83 opposite strand [Source:ZFIN;A... [more]
si:ch73-141c7.11.706e-4346.45si:ch73-141c7.1 [Source:NCBI gene;Acc:393762][more]
coq10b9.336e-3541.21coenzyme Q10B [Source:NCBI gene;Acc:550442][more]
back to top
BLAST of asterix vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
coq10a2.425e-5253.69coenzyme Q10A [Source:NCBI gene;Acc:780028][more]
wdr83os4.828e-4766.67WD repeat domain 83 opposite strand [Source:NCBI g... [more]
mkx1.751e-4348.65mohawk homeobox [Source:Xenbase;Acc:XB-GENE-853539... [more]
mkx2.309e-4348.65mohawk homeobox [Source:Xenbase;Acc:XB-GENE-853539... [more]
back to top
BLAST of asterix vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Coq10b1.620e-5254.00coenzyme Q10B [Source:MGI Symbol;Acc:MGI:1915126][more]
Coq10a2.451e-5051.33coenzyme Q10A [Source:MGI Symbol;Acc:MGI:2684847][more]
Coq10a2.648e-5051.33coenzyme Q10A [Source:MGI Symbol;Acc:MGI:2684847][more]
Coq10a3.237e-4748.13coenzyme Q10A [Source:MGI Symbol;Acc:MGI:2684847][more]
Coq10b8.451e-4752.48coenzyme Q10B [Source:MGI Symbol;Acc:MGI:1915126][more]
back to top
BLAST of asterix vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RD79|CQ10B_PONAB4.050e-5254.36Coenzyme Q-binding protein COQ10 homolog B, mitoch... [more]
sp|Q9H8M1|CQ10B_HUMAN4.228e-5254.36Coenzyme Q-binding protein COQ10 homolog B, mitoch... [more]
sp|Q567E6|CQ10B_DANRE4.706e-5252.20Coenzyme Q-binding protein COQ10 homolog B, mitoch... [more]
sp|Q6DFA6|CQ10A_XENLA4.952e-5254.36Coenzyme Q-binding protein COQ10 homolog A, mitoch... [more]
sp|Q3THF9|CQ10B_MOUSE8.624e-5254.00Coenzyme Q-binding protein COQ10 homolog B, mitoch... [more]
back to top
BLAST of asterix vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V9XQP71.872e-66100.00Asterix OS=Schmidtea mediterranea OX=79327 PE=2 SV... [more]
A0A0P4WJT96.882e-5755.28Polyketide_cyc domain-containing protein OS=Scylla... [more]
A0A0L8GK149.925e-5752.27Polyketide_cyc domain-containing protein OS=Octopu... [more]
K1R6463.068e-5651.41Coenzyme Q-binding protein COQ10-like protein B, m... [more]
A0A423SD297.224e-5653.61Polyketide_cyc domain-containing protein OS=Penaeu... [more]
back to top
BLAST of asterix vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coq10b5.218e-5350.30coenzyme Q10B [Source:NCBI gene;Acc:550442][more]
coq10b1.258e-5252.87coenzyme Q10B [Source:NCBI gene;Acc:550442][more]
coq10b1.509e-5252.87coenzyme Q10B [Source:NCBI gene;Acc:550442][more]
COQ10A7.545e-5153.02coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515][more]
COQ10A7.833e-5153.02coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515][more]
back to top
BLAST of asterix vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000001448.13.454e-4747.65pep scaffold:Pmarinus_7.0:GL476436:271081:272492:-... [more]
coq10b1.129e-4648.99coenzyme Q10B [Source:NCBI gene;Acc:550442][more]
back to top
BLAST of asterix vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
COQ109.172e-1023.53Coenzyme Q (ubiquinone) binding protein; functions... [more]
back to top
BLAST of asterix vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO429298.992e-4549.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451656.820e-4267.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO254114.925e-624.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of asterix vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coq10b2.494e-4952.03coenzyme Q10B [Source:NCBI gene;Acc:101164043][more]
si:dkey-190g6.21.285e-4851.33coenzyme Q-binding protein COQ10 homolog A, mitoch... [more]
wdr83os2.801e-4365.05WD repeat domain 83 opposite strand [Source:NCBI g... [more]
si:ch73-141c7.11.296e-4144.90coenzyme Q-binding protein COQ10 homolog, mitochon... [more]
si:dkey-190g6.23.326e-3250.44coenzyme Q-binding protein COQ10 homolog A, mitoch... [more]
back to top
BLAST of asterix vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000020570.14.174e-141100.00SMESG000020570.1[more]
SMESG000020570.11.371e-115100.00SMESG000020570.1[more]
SMESG000020571.15.207e-70100.00SMESG000020571.1[more]
SMESG000052094.12.849e-6559.88SMESG000052094.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30030764
GenBankAHD24737.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030764 ID=SMED30030764|Name=asterix|organism=Schmidtea mediterranea sexual|type=transcript|length=1078bp
TTTGAAATGGTACAAAAATAAAACTTATTTGATTTAAGTTTCTCTTTTTG
GATGATTTCCAAAAAGAATCTTATCTTTGTGTCCCGATTTAATTTATTTT
ATTCTAAACGCTGTCTTTTCAAAGATGGAATATTTGGTAAAGGTAAACGA
ATGAAGTATAGCGAAAAAAGAATTATAGGTTATTCCATGGACCAAATGTT
TGAAGTCGTTTCAGATGTAGAAAAATATTATCAATTTGTACCATATTGTA
AAAAATCGGATATTTTTAATAAAAGCTATCGAACATTTAAAGCCAACATT
GTGGTTGGATTTCCCCCTTTAAAAGAAGCTTACGTATCGACAATTACTGT
ATCAAAACCAAATCTAGTACATTCAGTAGCCTCTGGTGGAATACTTTTCA
ATGAACTGTTAACGATATGGAAGTTTCGTCCAGGATTATTAGAAATTCCT
AAGAGTTGTATTTTAGATTTTTCGGTGTCTTTTGAATTTCGACACGCTTT
GCACTCACAATTCGCAGAAATATTTTTTGATCACATAGTTATTATGATGG
TAGATGCTTTTCTGAAAAGGGCAGAAGATATTTATGGCCCAGGTAGTTTA
GAAAAACAGCCTCCAAAAATTATTTCATATGAAAAATGATAGTTATACTT
TAATTTTTCATTAAACTAAATTTTATTTTAGTAATTTTTGTATACAGATG
ACTACGGTTTTTCATTAATAAATTGATTGTAAAAAGTGTTTCTGGAAATC
AGACGAAAATTTATTAAAATGGCAAAGTCATTGGTTGAATATTTTGCATA
TACGACATTATGACAGCTGAAATCGAAAGCATGAATCCACTTAATGTTTG
TTTCGTATCTTCAGATGATTTAGTATTTGCGAATGTTATGAAAGCACAAT
ATATTGCCATCCATGCTGCCCATTTTAATTTTAACATTAATCCACACATG
CTTAATACCATTCCAATGGCATTAATGTAATCGGAAGTAGGATCTTGAGG
TATACCGTCGGCTACGGGAGCTTTATATCTATGAATTTTATTAGGCCTCC
TTGGATCATTTGTAGAATTCATTGTTTA
back to top

protein sequence of SMED30030764-orf-1

>SMED30030764-orf-1 ID=SMED30030764-orf-1|Name=SMED30030764-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=196bp
MISKKNLIFVSRFNLFYSKRCLFKDGIFGKGKRMKYSEKRIIGYSMDQMF
EVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITV
SKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHAL
HSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKIISYEK*
back to top

protein sequence of SMED30030764-orf-2

>SMED30030764-orf-2 ID=SMED30030764-orf-2|Name=SMED30030764-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
MNSTNDPRRPNKIHRYKAPVADGIPQDPTSDYINAIGMVLSMCGLMLKLK
WAAWMAIYCAFITFANTKSSEDTKQTLSGFMLSISAVIMSYMQNIQPMTL
PF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR005351UPF0139
IPR023393START-like_dom_sf
IPR005031COQ10_START
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023393START-like domain superfamilyGENE3DG3DSA:3.30.530.20coord: 33..180
e-value: 6.4E-41
score: 141.6
IPR005031Coenzyme Q-binding protein COQ10, START domainPFAMPF03364Polyketide_cyccoord: 42..170
e-value: 6.5E-17
score: 61.9
NoneNo IPR availablePANTHERPTHR12901:SF9COENZYME Q-BINDING PROTEIN COQ10 HOMOLOG B, MITOCHONDRIALcoord: 15..181
NoneNo IPR availablePANTHERPTHR12901SPERM PROTEIN HOMOLOGcoord: 15..181
NoneNo IPR availableCDDcd07813COQ10p_likecoord: 36..177
e-value: 1.56095E-47
score: 150.315
NoneNo IPR availableSUPERFAMILYSSF55961Bet v1-likecoord: 34..180