Protein kinase C and casein kinase substrate in neurons protein

Overview
NameProtein kinase C and casein kinase substrate in neurons protein
Smed IDSMED30030763
Length (bp)1730
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase C and casein kinase substrate in neurons protein (SMED30030763) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase C and casein kinase substrate in neurons protein (SMED30030763) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase C and casein kinase substrate in neurons protein (SMED30030763) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase C and casein kinase substrate in neurons protein (SMED30030763) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Human
Match: PACSIN1 (protein kinase C and casein kinase substrate in neurons 1 [Source:HGNC Symbol;Acc:HGNC:8570])

HSP 1 Score: 281.952 bits (720), Expect = 2.034e-88
Identity = 158/496 (31.85%), Postives = 266/496 (53.63%), Query Frame = 3
Query:  114 MSNSFEFEGETSNSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQEL-HSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
            MS+S++ E   +     ++FW++  Y +T++R+++ ++LC D+ N +Q+R +IEK+Y   L  W+ +W   +E G +YGS ++ W     EA+++S+LH++++  L+++    V+NWQ++ +HK  +     KE K  E  F  AQKPWAKK+K++   KK YH  CK  +    +  N+  + S++ EQ KK+++K+ K ++D +K +  Y+  L ++     +Y+E M +VF + Q  E++R+ F K +   I++ LNL+EN +   +Y+  E  I+  D   D+  +    G   P + PQFEE+  +L H+ +KK+       GV LT     + +++ ++GD G      S++S   G   +T   + E+ +P   S                                          ET    +P   D   V+VRALYDY G E+DEL+ K GD   KL +EDEQGWC+G+ D G++GLYPANY E +
Sbjct:    1 MSSSYD-EASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMG--GFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEGVALTNAT-GAVESTSQAGDRG------SVSSYDRGQPYATEWSDDESGNPFGGS------------------------------------------ETNGGANPFEDDSKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEAI 444          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Human
Match: PACSIN1 (protein kinase C and casein kinase substrate in neurons 1 [Source:HGNC Symbol;Acc:HGNC:8570])

HSP 1 Score: 281.952 bits (720), Expect = 2.034e-88
Identity = 158/496 (31.85%), Postives = 266/496 (53.63%), Query Frame = 3
Query:  114 MSNSFEFEGETSNSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQEL-HSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
            MS+S++ E   +     ++FW++  Y +T++R+++ ++LC D+ N +Q+R +IEK+Y   L  W+ +W   +E G +YGS ++ W     EA+++S+LH++++  L+++    V+NWQ++ +HK  +     KE K  E  F  AQKPWAKK+K++   KK YH  CK  +    +  N+  + S++ EQ KK+++K+ K ++D +K +  Y+  L ++     +Y+E M +VF + Q  E++R+ F K +   I++ LNL+EN +   +Y+  E  I+  D   D+  +    G   P + PQFEE+  +L H+ +KK+       GV LT     + +++ ++GD G      S++S   G   +T   + E+ +P   S                                          ET    +P   D   V+VRALYDY G E+DEL+ K GD   KL +EDEQGWC+G+ D G++GLYPANY E +
Sbjct:    1 MSSSYD-EASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMG--GFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEGVALTNAT-GAVESTSQAGDRG------SVSSYDRGQPYATEWSDDESGNPFGGS------------------------------------------ETNGGANPFEDDSKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEAI 444          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Human
Match: PACSIN1 (protein kinase C and casein kinase substrate in neurons 1 [Source:HGNC Symbol;Acc:HGNC:8570])

HSP 1 Score: 281.952 bits (720), Expect = 2.034e-88
Identity = 158/496 (31.85%), Postives = 266/496 (53.63%), Query Frame = 3
Query:  114 MSNSFEFEGETSNSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQEL-HSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
            MS+S++ E   +     ++FW++  Y +T++R+++ ++LC D+ N +Q+R +IEK+Y   L  W+ +W   +E G +YGS ++ W     EA+++S+LH++++  L+++    V+NWQ++ +HK  +     KE K  E  F  AQKPWAKK+K++   KK YH  CK  +    +  N+  + S++ EQ KK+++K+ K ++D +K +  Y+  L ++     +Y+E M +VF + Q  E++R+ F K +   I++ LNL+EN +   +Y+  E  I+  D   D+  +    G   P + PQFEE+  +L H+ +KK+       GV LT     + +++ ++GD G      S++S   G   +T   + E+ +P   S                                          ET    +P   D   V+VRALYDY G E+DEL+ K GD   KL +EDEQGWC+G+ D G++GLYPANY E +
Sbjct:    1 MSSSYD-EASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMG--GFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEGVALTNAT-GAVESTSQAGDRG------SVSSYDRGQPYATEWSDDESGNPFGGS------------------------------------------ETNGGANPFEDDSKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEAI 444          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Human
Match: PACSIN2 (protein kinase C and casein kinase substrate in neurons 2 [Source:HGNC Symbol;Acc:HGNC:8571])

HSP 1 Score: 280.796 bits (717), Expect = 5.585e-88
Identity = 165/487 (33.88%), Postives = 267/487 (54.83%), Query Frame = 3
Query:  150 NSAGV----NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
            +S GV    ++FW++  Y +T++R+++ ++LC+D+ N + +R  IEK+Y+  L +W+ +W   +E G +YG+ ++ W+ F  EAE +S+LH +++  L++D    ++NWQ+E FHK  +     KE K  E  F  AQKPWAKKLK++   KK +H  CK  +    +  N+  D S++ EQLKK+++K+ K ++D  K K  Y+ SL EL+    +Y+E M +VF + Q  E++R+ FF+ +   +QK L+LS       IY + E +I+  D   D+  +   +G     + PQFEE++ +L+    ++       GVTLT +N    Q S+ S  +   S  K+ + P+  ++        E+++P S++       D    + P                    +  ++ TE              V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:    7 DSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEAFHKQMMG--GFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADPSLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQ-SLPSKPSSVSSYEKTQSYPTDWSDD-------ESNNPFSST-------DANGDSNPF------------------DDDATSGTE--------------VRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAI 444          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Human
Match: PACSIN2 (protein kinase C and casein kinase substrate in neurons 2 [Source:HGNC Symbol;Acc:HGNC:8571])

HSP 1 Score: 280.796 bits (717), Expect = 5.585e-88
Identity = 165/487 (33.88%), Postives = 267/487 (54.83%), Query Frame = 3
Query:  150 NSAGV----NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
            +S GV    ++FW++  Y +T++R+++ ++LC+D+ N + +R  IEK+Y+  L +W+ +W   +E G +YG+ ++ W+ F  EAE +S+LH +++  L++D    ++NWQ+E FHK  +     KE K  E  F  AQKPWAKKLK++   KK +H  CK  +    +  N+  D S++ EQLKK+++K+ K ++D  K K  Y+ SL EL+    +Y+E M +VF + Q  E++R+ FF+ +   +QK L+LS       IY + E +I+  D   D+  +   +G     + PQFEE++ +L+    ++       GVTLT +N    Q S+ S  +   S  K+ + P+  ++        E+++P S++       D    + P                    +  ++ TE              V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:    7 DSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEAFHKQMMG--GFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADPSLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQ-SLPSKPSSVSSYEKTQSYPTDWSDD-------ESNNPFSST-------DANGDSNPF------------------DDDATSGTE--------------VRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAI 444          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Celegans
Match: sdpn-1 (SynDaPiN (Synaptic dynamin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q6AHQ8])

HSP 1 Score: 197.593 bits (501), Expect = 1.992e-56
Identity = 138/488 (28.28%), Postives = 236/488 (48.36%), Query Frame = 3
Query:  171 FWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQK-ILNLSENKNLTDIYQNFENTIQTLDPDS---DIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLT-AVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSS-----PLSTSALRRLEP-DLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSD-EDYVQVR---ALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 1589
            FW++  Y   ++R ++  +   D C M ++R EIE  YS  L + + KW ++++  +  GS K  W     EA  +S +H  ++  LIDDI  +   +++   H S    +  KE + +E  F+ AQKPW K + KM   + +Y+  C+  +S  V  +N   DTS+S +   K  E+  K +++ ++ K  Y  +L  LN   N Y+E M  VF   Q  E +R  F   +  + Q+   N+  N  ++ ++Q  E +I++ D ++   D+AQWS + G D     P F EY+ E+ +I+ +  +  +  GV LT  +N +    S  S      ++  + +    G  +   S   +TS+       ST+   + +P +     PP  P     S+          +S    TETP  +S  + D E++   +    LYDY   E DE+ L++G++   L + D  GWC G+  G VGL+PA+Y +
Sbjct:   10 FWEVGSYKHNVKRFKDGVEQLDDYCKMSRERAEIEAKYSKMLSQHAEKWRAHVDRTVSAGSVKTVWNELIGEATALSRVHNSLKDCLIDDIVNETTTYRKNSLHTSVF--KGPKEIREIEDHFEKAQKPWKKLVDKMEDKRGKYYNVCRQEKSALVNLQNCQTDTSVSPDAATKFRERHEKLKEEVQRTKVDYQKTLTNLNEYKNVYMEAMAHVFKMCQEKEMDRSQFLIGIVQKTQRHYANIIRNSQMSGLHQQLEQSIRSADSEAVKRDLAQWSSVNGVDAFSEWPSFVEYSPEIRNIAARGGSTKDAGGVILTRQINRSEDIPSTHSNTLPSVAVNTASSHEDVGKSSPKSSSESDTSTFDSRKHNSTANKYKNQPQNTTQIQPP--PVGWHPSDGP--------DSPPLSTETP--DSAKYGDFEEFTTSKPAVVLYDYAPAEGDEIALRKGEMIEVLTEPDSLGWCTGRVSGNVGLFPASYVQ 483          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Celegans
Match: sdpn-1 (SynDaPiN (Synaptic dynamin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q6AHQ8])

HSP 1 Score: 197.593 bits (501), Expect = 1.992e-56
Identity = 138/488 (28.28%), Postives = 236/488 (48.36%), Query Frame = 3
Query:  171 FWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQK-ILNLSENKNLTDIYQNFENTIQTLDPDS---DIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLT-AVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSS-----PLSTSALRRLEP-DLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSD-EDYVQVR---ALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 1589
            FW++  Y   ++R ++  +   D C M ++R EIE  YS  L + + KW ++++  +  GS K  W     EA  +S +H  ++  LIDDI  +   +++   H S    +  KE + +E  F+ AQKPW K + KM   + +Y+  C+  +S  V  +N   DTS+S +   K  E+  K +++ ++ K  Y  +L  LN   N Y+E M  VF   Q  E +R  F   +  + Q+   N+  N  ++ ++Q  E +I++ D ++   D+AQWS + G D     P F EY+ E+ +I+ +  +  +  GV LT  +N +    S  S      ++  + +    G  +   S   +TS+       ST+   + +P +     PP  P     S+          +S    TETP  +S  + D E++   +    LYDY   E DE+ L++G++   L + D  GWC G+  G VGL+PA+Y +
Sbjct:   10 FWEVGSYKHNVKRFKDGVEQLDDYCKMSRERAEIEAKYSKMLSQHAEKWRAHVDRTVSAGSVKTVWNELIGEATALSRVHNSLKDCLIDDIVNETTTYRKNSLHTSVF--KGPKEIREIEDHFEKAQKPWKKLVDKMEDKRGKYYNVCRQEKSALVNLQNCQTDTSVSPDAATKFRERHEKLKEEVQRTKVDYQKTLTNLNEYKNVYMEAMAHVFKMCQEKEMDRSQFLIGIVQKTQRHYANIIRNSQMSGLHQQLEQSIRSADSEAVKRDLAQWSSVNGVDAFSEWPSFVEYSPEIRNIAARGGSTKDAGGVILTRQINRSEDIPSTHSNTLPSVAVNTASSHEDVGKSSPKSSSESDTSTFDSRKHNSTANKYKNQPQNTTQIQPP--PVGWHPSDGP--------DSPPLSTETP--DSAKYGDFEEFTTSKPAVVLYDYAPAEGDEIALRKGEMIEVLTEPDSLGWCTGRVSGNVGLFPASYVQ 483          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Celegans
Match: sdpn-1 (SynDaPiN (Synaptic dynamin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q6AHQ8])

HSP 1 Score: 197.208 bits (500), Expect = 3.667e-56
Identity = 138/488 (28.28%), Postives = 236/488 (48.36%), Query Frame = 3
Query:  171 FWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQK-ILNLSENKNLTDIYQNFENTIQTLDPDS---DIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLT-AVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSS-----PLSTSALRRLEP-DLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSD-EDYVQVR---ALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 1589
            FW++  Y   ++R ++  +   D C M ++R EIE  YS  L + + KW ++++  +  GS K  W     EA  +S +H  ++  LIDDI  +   +++   H S    +  KE + +E  F+ AQKPW K + KM   + +Y+  C+  +S  V  +N   DTS+S +   K  E+  K +++ ++ K  Y  +L  LN   N Y+E M  VF   Q  E +R  F   +  + Q+   N+  N  ++ ++Q  E +I++ D ++   D+AQWS + G D     P F EY+ E+ +I+ +  +  +  GV LT  +N +    S  S      ++  + +    G  +   S   +TS+       ST+   + +P +     PP  P     S+          +S    TETP  +S  + D E++   +    LYDY   E DE+ L++G++   L + D  GWC G+  G VGL+PA+Y +
Sbjct:   16 FWEVGSYKHNVKRFKDGVEQLDDYCKMSRERAEIEAKYSKMLSQHAEKWRAHVDRTVSAGSVKTVWNELIGEATALSRVHNSLKDCLIDDIVNETTTYRKNSLHTSVF--KGPKEIREIEDHFEKAQKPWKKLVDKMEDKRGKYYNVCRQEKSALVNLQNCQTDTSVSPDAATKFRERHEKLKEEVQRTKVDYQKTLTNLNEYKNVYMEAMAHVFKMCQEKEMDRSQFLIGIVQKTQRHYANIIRNSQMSGLHQQLEQSIRSADSEAVKRDLAQWSSVNGVDAFSEWPSFVEYSPEIRNIAARGGSTKDAGGVILTRQINRSEDIPSTHSNTLPSVAVNTASSHEDVGKSSPKSSSESDTSTFDSRKHNSTANKYKNQPQNTTQIQPP--PVGWHPSDGP--------DSPPLSTETP--DSAKYGDFEEFTTSKPAVVLYDYAPAEGDEIALRKGEMIEVLTEPDSLGWCTGRVSGNVGLFPASYVQ 489          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Celegans
Match: abi-1 (ABl Interactor homolog [Source:UniProtKB/TrEMBL;Acc:Q10929])

HSP 1 Score: 53.9138 bits (128), Expect = 1.891e-7
Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 3
Query: 1431 QVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 1595
            +VR LYDY   +EDELTL++  + Y L+  D+  W +G  DG  GL+P NY   V
Sbjct:  416 KVRVLYDYDAAKEDELTLRENAIVYVLKKNDDD-WYEGVLDGVTGLFPGNYVVPV 469          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Celegans
Match: abi-1 (ABl Interactor homolog [Source:UniProtKB/TrEMBL;Acc:Q10929])

HSP 1 Score: 53.9138 bits (128), Expect = 1.891e-7
Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 3
Query: 1431 QVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 1595
            +VR LYDY   +EDELTL++  + Y L+  D+  W +G  DG  GL+P NY   V
Sbjct:  416 KVRVLYDYDAAKEDELTLRENAIVYVLKKNDDD-WYEGVLDGVTGLFPGNYVVPV 469          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Fly
Match: Synd (gene:FBgn0053094 transcript:FBtr0334725)

HSP 1 Score: 319.701 bits (818), Expect = 1.186e-102
Identity = 177/485 (36.49%), Postives = 272/485 (56.08%), Query Frame = 3
Query:  156 AGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMAS-PSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISS---NKSVTRNDHRQNS---ISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 1589
            AG ++FW+   Y +T +R+E+  KLC D+  +IQ+R +IEK Y+ SL  WS KW   +E G EYG+T+  W G   E+E ISD+H  ++  L +D+ + ++ WQ+E++H + +    +KE K LE  F  AQKPWAK L K+ + K +YH  CK  RS   Q +NA  D+S+S +Q+KKM ++++K++   +K +  Y+ ++ E+    + Y+E+MT VF K Q  EK R+ FFK +   +   L+L++ ++L  IY+ F +TI   D   D+  WS  +G +   + P F EYT+E   I+K   +        +T +N       +       +S+ K+ ++  S  + AS  S    T S ++TS  +        +        + ++   N SVT  + + ++      E         V + E  V V+ALYDY G E DELT KQGD+F KLEDEDEQGWCKG+ +GRVGLYPANY E
Sbjct:   12 AGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRTWSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYHHTLM---QIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSLSPDQVKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQTFEKTRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMAMNWPSFVEYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHQEYPQTNSLKKNTSTLSSVSSRASVKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNGNGKVDANPFDEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDEDEQGWCKGRMNGRVGLYPANYVE 493          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Fly
Match: Synd (gene:FBgn0053094 transcript:FBtr0334724)

HSP 1 Score: 319.701 bits (818), Expect = 1.186e-102
Identity = 177/485 (36.49%), Postives = 272/485 (56.08%), Query Frame = 3
Query:  156 AGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMAS-PSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISS---NKSVTRNDHRQNS---ISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 1589
            AG ++FW+   Y +T +R+E+  KLC D+  +IQ+R +IEK Y+ SL  WS KW   +E G EYG+T+  W G   E+E ISD+H  ++  L +D+ + ++ WQ+E++H + +    +KE K LE  F  AQKPWAK L K+ + K +YH  CK  RS   Q +NA  D+S+S +Q+KKM ++++K++   +K +  Y+ ++ E+    + Y+E+MT VF K Q  EK R+ FFK +   +   L+L++ ++L  IY+ F +TI   D   D+  WS  +G +   + P F EYT+E   I+K   +        +T +N       +       +S+ K+ ++  S  + AS  S    T S ++TS  +        +        + ++   N SVT  + + ++      E         V + E  V V+ALYDY G E DELT KQGD+F KLEDEDEQGWCKG+ +GRVGLYPANY E
Sbjct:   12 AGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRTWSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYHHTLM---QIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSLSPDQVKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQTFEKTRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMAMNWPSFVEYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHQEYPQTNSLKKNTSTLSSVSSRASVKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNGNGKVDANPFDEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDEDEQGWCKGRMNGRVGLYPANYVE 493          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Fly
Match: Synd (gene:FBgn0053094 transcript:FBtr0083966)

HSP 1 Score: 316.62 bits (810), Expect = 1.750e-101
Identity = 175/484 (36.16%), Postives = 266/484 (54.96%), Query Frame = 3
Query:  156 AGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISS---NKSVTRNDHRQNS---ISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 1589
            AG ++FW+   Y +T +R+E+  KLC D+  +IQ+R +IEK Y+ SL  WS KW   +E G EYG+T+  W G   E+E ISD+H  ++  L +D+ + ++ WQ+E++H + +    +KE K LE  F  AQKPWAK L K+ + K +YH  CK  RS   Q +NA  D+S+S +Q+KKM ++++K++   +K +  Y+ ++ E+    + Y+E+MT VF K Q  EK R+ FFK +   +   L+L++ ++L  IY+ F +TI   D   D+  WS  +G +   + P F EYT+E   I+K   +        +T +N       +            +    S  + AS  S    T S ++TS  +        +        + ++   N SVT  + + ++      E         V + E  V V+ALYDY G E DELT KQGD+F KLEDEDEQGWCKG+ +GRVGLYPANY E
Sbjct:   12 AGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRTWSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYHHTLM---QIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSLSPDQVKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQTFEKTRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMAMNWPSFVEYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHEYPQTNSLKKNTSTLSSVSSRASVKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNGNGKVDANPFDEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDEDEQGWCKGRMNGRVGLYPANYVE 492          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Fly
Match: Abp1 (gene:FBgn0036372 transcript:FBtr0075819)

HSP 1 Score: 56.225 bits (134), Expect = 5.164e-8
Identity = 26/56 (46.43%), Postives = 35/56 (62.50%), Query Frame = 3
Query: 1431 QVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKG-KKDGRVGLYPANYAEIV 1595
            + RALYDY   +E E+T   GD+   ++  DE GW +G   DG  GL+PANY EI+
Sbjct:  476 RARALYDYQAADETEITFDPGDVITHIDQIDE-GWWQGLGPDGTYGLFPANYVEII 530          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Fly
Match: Abi (gene:FBgn0020510 transcript:FBtr0307076)

HSP 1 Score: 51.6026 bits (122), Expect = 1.260e-6
Identity = 22/53 (41.51%), Postives = 34/53 (64.15%), Query Frame = 3
Query: 1431 QVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 1589
            +V A+YDY   ++DEL+ ++  + Y L+  D+ GW +G  DG  GL+P NY E
Sbjct:  418 KVVAIYDYYADKDDELSFQESSVLYVLKKNDD-GWWEGVMDGVTGLFPGNYVE 469          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Zebrafish
Match: pacsin1b (protein kinase C and casein kinase substrate in neurons 1b [Source:NCBI gene;Acc:619246])

HSP 1 Score: 306.22 bits (783), Expect = 5.279e-98
Identity = 171/482 (35.48%), Postives = 266/482 (55.19%), Query Frame = 3
Query:  162 VNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQEL-HSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSF--NMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
             ++FW++  Y +T++R+E+ ++LC D+ + IQ+R +IEK+YS  L  WS +W   +E G +YG+ ++ WL    EAE++S+LH++++  L+++    V+NWQ++ +HK  +     KE K  +  F  AQKPWAKKLK++   KK YH  CK  +    +  N+  + S++ +Q KK++EK+ K + D +K K  Y+ SL+ELN    +Y+E M  VF++ Q  E++R+ F + +    ++ LNL+E+++   +Y+  E TI +     D+  +S ++G     + PQFEE+  +L H+ISKK+    N  GVTLT V                 + G    +P TG   S  S+  N + S+  S           +D  PP     +  +N                       +P   D   V+VRALYDY G E+DELT K GD   KLEDEDEQGWCKG+ D G++GLYPANY E V
Sbjct:   15 TDSFWEVGNYKRTVKRIEDGHRLCNDMMSCIQERAKIEKAYSQQLTDWSKRWRQLVERGPQYGTLERAWLAVMTEAEKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQMMG--GFKETKEADEGFRKAQKPWAKKLKELETAKKTYHMACKEEKIASAREANSKGEASVTTDQQKKLQEKVDKCKNDVQKAKEKYEKSLDELNKCTPQYMENMEVVFDQCQQFEEKRLNFLREVLLDTKRHLNLTESQSYATVYRELERTIVSASAQEDLKWFSSVHGPGMHMNWPQFEEFNPDLSHAISKKEKVKRNHDGVTLTQV-----------------THGAEHGTPQTGDRGSVSSYEKNQQYSAEWS-----------DDEQPPTAAQSASETNGG---------------------NPFEEDSKGVRVRALYDYEGQEQDELTFKAGDELTKLEDEDEQGWCKGRLDSGQLGLYPANYVEPV 445          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Zebrafish
Match: pacsin1b (protein kinase C and casein kinase substrate in neurons 1b [Source:NCBI gene;Acc:619246])

HSP 1 Score: 306.22 bits (783), Expect = 5.279e-98
Identity = 171/482 (35.48%), Postives = 266/482 (55.19%), Query Frame = 3
Query:  162 VNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQEL-HSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSF--NMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
             ++FW++  Y +T++R+E+ ++LC D+ + IQ+R +IEK+YS  L  WS +W   +E G +YG+ ++ WL    EAE++S+LH++++  L+++    V+NWQ++ +HK  +     KE K  +  F  AQKPWAKKLK++   KK YH  CK  +    +  N+  + S++ +Q KK++EK+ K + D +K K  Y+ SL+ELN    +Y+E M  VF++ Q  E++R+ F + +    ++ LNL+E+++   +Y+  E TI +     D+  +S ++G     + PQFEE+  +L H+ISKK+    N  GVTLT V                 + G    +P TG   S  S+  N + S+  S           +D  PP     +  +N                       +P   D   V+VRALYDY G E+DELT K GD   KLEDEDEQGWCKG+ D G++GLYPANY E V
Sbjct:   15 TDSFWEVGNYKRTVKRIEDGHRLCNDMMSCIQERAKIEKAYSQQLTDWSKRWRQLVERGPQYGTLERAWLAVMTEAEKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQMMG--GFKETKEADEGFRKAQKPWAKKLKELETAKKTYHMACKEEKIASAREANSKGEASVTTDQQKKLQEKVDKCKNDVQKAKEKYEKSLDELNKCTPQYMENMEVVFDQCQQFEEKRLNFLREVLLDTKRHLNLTESQSYATVYRELERTIVSASAQEDLKWFSSVHGPGMHMNWPQFEEFNPDLSHAISKKEKVKRNHDGVTLTQV-----------------THGAEHGTPQTGDRGSVSSYEKNQQYSAEWS-----------DDEQPPTAAQSASETNGG---------------------NPFEEDSKGVRVRALYDYEGQEQDELTFKAGDELTKLEDEDEQGWCKGRLDSGQLGLYPANYVEPV 445          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Zebrafish
Match: pacsin1b (protein kinase C and casein kinase substrate in neurons 1b [Source:NCBI gene;Acc:619246])

HSP 1 Score: 306.22 bits (783), Expect = 5.279e-98
Identity = 171/482 (35.48%), Postives = 266/482 (55.19%), Query Frame = 3
Query:  162 VNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQEL-HSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSF--NMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
             ++FW++  Y +T++R+E+ ++LC D+ + IQ+R +IEK+YS  L  WS +W   +E G +YG+ ++ WL    EAE++S+LH++++  L+++    V+NWQ++ +HK  +     KE K  +  F  AQKPWAKKLK++   KK YH  CK  +    +  N+  + S++ +Q KK++EK+ K + D +K K  Y+ SL+ELN    +Y+E M  VF++ Q  E++R+ F + +    ++ LNL+E+++   +Y+  E TI +     D+  +S ++G     + PQFEE+  +L H+ISKK+    N  GVTLT V                 + G    +P TG   S  S+  N + S+  S           +D  PP     +  +N                       +P   D   V+VRALYDY G E+DELT K GD   KLEDEDEQGWCKG+ D G++GLYPANY E V
Sbjct:   15 TDSFWEVGNYKRTVKRIEDGHRLCNDMMSCIQERAKIEKAYSQQLTDWSKRWRQLVERGPQYGTLERAWLAVMTEAEKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQMMG--GFKETKEADEGFRKAQKPWAKKLKELETAKKTYHMACKEEKIASAREANSKGEASVTTDQQKKLQEKVDKCKNDVQKAKEKYEKSLDELNKCTPQYMENMEVVFDQCQQFEEKRLNFLREVLLDTKRHLNLTESQSYATVYRELERTIVSASAQEDLKWFSSVHGPGMHMNWPQFEEFNPDLSHAISKKEKVKRNHDGVTLTQV-----------------THGAEHGTPQTGDRGSVSSYEKNQQYSAEWS-----------DDEQPPTAAQSASETNGG---------------------NPFEEDSKGVRVRALYDYEGQEQDELTFKAGDELTKLEDEDEQGWCKGRLDSGQLGLYPANYVEPV 445          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Zebrafish
Match: pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2596])

HSP 1 Score: 284.263 bits (726), Expect = 6.243e-89
Identity = 162/479 (33.82%), Postives = 269/479 (56.16%), Query Frame = 3
Query:  165 NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELH-SISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETE--TPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGK-KDGRVGLYPANYAE 1589
            ++FW++  Y ++++R+++ N+LC D+ + + +R  IEKSYS+ L  W+ +W   +E G +YG+ ++ W     EAE++SDLH +++  L+ +    ++NWQ++ +HK  +     KE K  E  F  AQKPWAKKLK+M   KK YH  CK  ++   +  ++  D S  + Q KK++EK+ K +++ +K K  Y+ SL +L+    +Y+E M +VF + Q  E +R++FFK +   +++ L+LS N   T +Y   ++TIQ  DP  D+  +   +G     + PQFEE++ +L+ ++S+++       GVTLTA++ N  Q+S  S      S   +  +P    +           +   +S ++  E   + +A    P  +  +      ++   N  S+ +    P +E P  S E  V VRA+YDY G E+DEL+ K GD   KL +EDEQGWCKG+  +G VGLYPANY E
Sbjct:   14 DSFWEVGNYKRSVKRVDDGNRLCNDLMSCLHERARIEKSYSTQLTDWAKRWRQTIEKGPQYGTVERAWCALMTEAEKVSDLHMEVKAALMAEDFEKIKNWQKDAYHKQMIG--GFKETKEAEDGFRKAQKPWAKKLKEMETMKKAYHTACKEEKTATSRENSSKLDNSNPEAQ-KKLQEKVEKCQQEVQKTKERYEKSLEDLDKVTPQYMENMEQVFEQWQQFEGKRLSFFKEVLLEVKQHLDLSSNHKYTTVYHTLQDTIQGADPQEDLKWFRSNHGPGMTMNWPQFEEWSMDLNRTLSRRETKRRPAEGVTLTAISHNPEQSSRVSSVPAVSSSEAACLNPFDDDDDDEDEDEEPVVTHTHSSPVKHEEAVAQTAAVEKAPAPAAITAADDDDDEESGNPFSSSSANGNPFEEEP--STEMCVPVRAVYDYEGQEQDELSFKAGDELVKLSEEDEQGWCKGRLSNGTVGLYPANYVE 487          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Zebrafish
Match: pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2596])

HSP 1 Score: 283.878 bits (725), Expect = 9.825e-89
Identity = 164/480 (34.17%), Postives = 268/480 (55.83%), Query Frame = 3
Query:  165 NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELH-SISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQN---SISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGK-KDGRVGLYPANYAE 1589
            ++FW++  Y ++++R+++ N+LC D+ + + +R  IEKSYS+ L  W+ +W   +E G +YG+ ++ W     EAE++SDLH +++  L+ +    ++NWQ++ +HK  +     KE K  E  F  AQKPWAKKLK+M   KK YH  CK  ++   +  ++  D S  + Q KK++EK+ K +++ +K K  Y+ SL +L+    +Y+E M +VF + Q  E +R++FFK +   +++ L+LS N   T +Y   ++TIQ  DP  D+  +   +G     + PQFEE++ +L+ ++S+++       GVTLTA++ N  Q+S  S      S   +  +P    +           +   +S ++  E   + SA   K     +   +   +D       S S+    P +E P  S E  V VRA+YDY G E+DEL+ K GD   KL +EDEQGWCKG+  +G VGLYPANY E
Sbjct:   14 DSFWEVGNYKRSVKRVDDGNRLCNDLMSCLHERARIEKSYSTQLTDWAKRWRQTIEKGPQYGTVERAWCALMTEAEKVSDLHMEVKAALMAEDFEKIKNWQKDAYHKQMIG--GFKETKEAEDGFRKAQKPWAKKLKEMETMKKAYHTACKEEKTATSRENSSKLDNSNPEAQ-KKLQEKVEKCQQEVQKTKERYEKSLEDLDKVTPQYMENMEQVFEQWQQFEGKRLSFFKEVLLEVKQHLDLSSNHKYTTVYHTLQDTIQGADPQEDLKWFRSNHGPGMTMNWPQFEEWSMDLNRTLSRRETKRRPAEGVTLTAISHNPEQSSRVSSVPAVSSSEAACLNPFDDDDDDEDEDEEPVVTHTHSSPVKHEEAVAQTSAAVEKAPAPAAITAADDDDDEESGNPFSSSSANGNPFEEEP--STEMCVPVRAVYDYEGQEQDELSFKAGDELVKLSEEDEQGWCKGRLSNGTVGLYPANYVE 488          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Xenopus
Match: pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:NCBI gene;Acc:496460])

HSP 1 Score: 294.278 bits (752), Expect = 9.056e-93
Identity = 170/492 (34.55%), Postives = 280/492 (56.91%), Query Frame = 3
Query:  138 GETSNSAGV----NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLE-PDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
            G   +S GV    ++FW++  Y +T++R+++ ++LC+D+ N I +R +IEK+Y+  L +W+ +W   +E G +YG+ ++ W     EAE++S+LH +++  L+++    ++NWQ+E FHK  +     KE K  E  F  AQKPWAKKLK++   KK YH  CK  +    +  N+  D +++ EQLKK+++K+ KS++DS+K K  Y+ +L +L+G   +Y+E M +VF + Q  E +R+ FF+ +   ++K L+LS   +  +IY+  E  I++ D   D+  +    G     + PQFEE++ +L+    ++       GVTLT ++    QA +++  +   S+    + PS    A+ P  + E +  ++ +  ++ +     D   P +      SN   T ND   +S       P  E    + E  V+VRALYDY G E DEL+ K G+   K+EDEDEQGWCKG+ D G+VGLYPANY E V
Sbjct:    3 GTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCIHERAKIEKAYAQQLTEWAKRWKQLVERGPQYGTVEKAWHNLMTEAEKVSELHLEVKNALMNEDFEKIKNWQKEAFHKQMMG--GFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAYHAACKEEKLATSRETNSKADPAMNPEQLKKLQDKVEKSKQDSQKTKEKYEKALKDLDGTTPQYMENMEQVFEQCQQFEDKRLRFFREVLLEVEKHLDLSNVDSYANIYRELEYAIKSADATEDLKWFRNNNGPGMSMNWPQFEEWSADLNRTLSRREKKKPTDGVTLTGISQAGEQAPVQNKHSSHLSV---QSVPS----ANNPFEDEEDTGSINETENKKTKNVGSYDKTYPAE-WSDDESNNPFTANDANGDS------NPFDEDAPGATE--VRVRALYDYEGQELDELSFKAGEELTKIEDEDEQGWCKGRLDGGQVGLYPANYVESV 476          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Xenopus
Match: pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:NCBI gene;Acc:496460])

HSP 1 Score: 293.893 bits (751), Expect = 1.127e-92
Identity = 167/491 (34.01%), Postives = 270/491 (54.99%), Query Frame = 3
Query:  138 GETSNSAGV----NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
            G   +S GV    ++FW++  Y +T++R+++ ++LC+D+ N I +R +IEK+Y+  L +W+ +W   +E G +YG+ ++ W     EAE++S+LH +++  L+++    ++NWQ+E FHK  +     KE K  E  F  AQKPWAKKLK++   KK YH  CK  +    +  N+  D +++ EQLKK+++K+ KS++DS+K K  Y+ +L +L+G   +Y+E M +VF + Q  E +R+ FF+ +   ++K L+LS   +  +IY+  E  I++ D   D+  +    G     + PQFEE++ +L+    ++       GVTLT ++    QA +++  +    +  +   P       + +F     S               D   P +      SN   T ND   +S       P  E    + E  V+VRALYDY G E DEL+ K G+   K+EDEDEQGWCKG+ D G+VGLYPANY E V
Sbjct:    3 GTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCIHERAKIEKAYAQQLTEWAKRWKQLVERGPQYGTVEKAWHNLMTEAEKVSELHLEVKNALMNEDFEKIKNWQKEAFHKQMM--GGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAYHAACKEEKLATSRETNSKADPAMNPEQLKKLQDKVEKSKQDSQKTKEKYEKALKDLDGTTPQYMENMEQVFEQCQQFEDKRLRFFREVLLEVEKHLDLSNVDSYANIYRELEYAIKSADATEDLKWFRNNNGPGMSMNWPQFEEWSADLNRTLSRREKKKPTDGVTLTGISQAGEQAPVQNKHSRYVPLAVASVPPPRFVSHHSCTFIHSVGS--------------YDKTYPAE-WSDDESNNPFTANDANGDS------NPFDEDAPGATE--VRVRALYDYEGQELDELSFKAGEELTKIEDEDEQGWCKGRLDGGQVGLYPANYVESV 468          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Xenopus
Match: sult6b1.4 (sulfotransferase family 6B member 1 gene 4 [Source:Xenbase;Acc:XB-GENE-5735978])

HSP 1 Score: 280.796 bits (717), Expect = 6.922e-88
Identity = 164/477 (34.38%), Postives = 255/477 (53.46%), Query Frame = 3
Query:  171 FWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELH-SISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGK-KDGRVGLYPANYAEIV 1595
            FW+   Y +T++R+E+ N+LC D+ +  ++R +IEKSY+  L  WS KW + LE G +YG+ ++ W  F   AE++S++H ++R +L D+    VR+WQ+E FHK  +     +E+K  E  F  AQKPW KKLK +   KK YH   K  R+  V+  ++  D+++SQEQL+K+ +++ K  ++++K K +Y+ +L ELN    RY+E+M + F   Q  E++R+ FFK M     K L+LS   +   + ++   +IQT D   D+  W   +G     + PQFEE++ E   +ISKK+ +  N   VTLT + + +R        T + + G S       T+     +   T +P S +         ED +P           KS+  N    + +                   V+VRALYDY G E DEL+   G+   K+  EDEQGWC+G+   GR+GLYPANY E V
Sbjct:   15 FWEAGNYRQTVKRIEDGNRLCNDLVSCFRERAKIEKSYAQQLSDWSNKWRTSLEKGPQYGTLEKSWQAFLTAAEKLSEIHTELRNQLWDEDSGKVRDWQKEAFHKQMIG--GFRESKEAEESFSKAQKPWVKKLKDVEVAKKRYHVARKDERAAQVREDHSKADSTVSQEQLRKLRDRVEKCNQEADKTKGVYEKALEELNRYNPRYMEDMEQAFESCQEAEQKRLCFFKEMLLDFHKHLDLSSKDSFHVLNKDLHQSIQTADDQQDLKWWRNTHGPSMAMNWPQFEEWSPETQRTISKKERSNKNVEEVTLTGI-LPARDGVSAGTPTQQLNRGFSY------TDEDQDFYATLTDTPHSDTGKDDASEWSEDDSP----------KKSMDSNGREVSQVEG-----------------VRVRALYDYAGQEADELSFTAGEELMKIGSEDEQGWCRGRLLSGRIGLYPANYVEGV 455          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Xenopus
Match: PACSIN1 (protein kinase C and casein kinase substrate in neurons 1 [Source:NCBI gene;Acc:100494558])

HSP 1 Score: 279.256 bits (713), Expect = 1.631e-87
Identity = 163/481 (33.89%), Postives = 259/481 (53.85%), Query Frame = 3
Query:  162 VNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLY-GADFPFSTPQFEEYTQEL-HSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
             ++FW+L  Y +T++R+++ ++LC D+ + +QDR +IEK+YS  L  W+ +W   +E G +YG+ ++ W     EAE I +LH++++  L+ +    VRNWQ+E +HK  +     KE++  E  F  AQKPWAKK+K++   KK YH  CK  +    +  +   D S++ +QL+K+++K+ K ++D +K +  Y+  L+++     +Y+E M  VF + Q ME++R+ F K     I+  LNLSE+ +   +YQ  E TIQ+ D   D+ +W ++Y G     + PQFEE+  ++ H+I++K+       G  LT V + +  +S + GD G         S    T+A T  ++                 D E       P  +  SN                   P +E         V+VRALYDY G E+DEL+ K G+   KLEDEDEQGWC+G+ D GR GLYPANY E +
Sbjct:    9 TDSFWELGHYKRTVKRIDDGHRLCNDLMSCLQDRAKIEKAYSQQLTDWAKRWRQLIEKGPQYGTLERAWGALLTEAERIGELHQEVKNHLVSEDMEKVRNWQKESYHKQMMG--GFKESREAEEGFRKAQKPWAKKMKEVEAAKKTYHMACKEEKLASSREASGKADASVTADQLRKLQDKVEKCKQDVQKAQERYEKILDDIQKFTPQYMESMDLVFEQCQQMEEKRLVFLKEALLDIKHHLNLSESSSYAAVYQELEQTIQSSDVQEDL-RWFRVYHGPGMHMNWPQFEEWNPDVTHTIARKE-KTKKTEGAVLTNVAVTTENSS-QGGDRGS-------VSSYDRTQAYTADWS-----------------DDEGGNSSSYP--TADSNGGA---------------NPFEEEGALR----VRVRALYDYEGQEQDELSFKAGEELTKLEDEDEQGWCRGQLDSGRQGLYPANYVESI 439          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Xenopus
Match: sult6b1.4 (sulfotransferase family 6B member 1 gene 4 [Source:Xenbase;Acc:XB-GENE-5735978])

HSP 1 Score: 275.018 bits (702), Expect = 7.070e-86
Identity = 162/481 (33.68%), Postives = 252/481 (52.39%), Query Frame = 3
Query:  171 FWDLK----QYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELH-SISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGK-KDGRVGLYPANYAEIV 1595
            FW+++     Y +T++R+E+ N+LC D+ +  ++R +IEKSY+  L  WS KW + LE G +YG+ ++ W  F   AE++S++H ++R +L D+    VR+WQ+E FHK  +     +E+K  E  F  AQKPW KKLK +   KK YH   K  R+  V+  ++  D+++SQEQL+K+ +++ K  ++++K K +Y+ +L ELN    RY+E+M + F   Q  E++R+ FFK M     K L+LS   +   + ++   +IQT D   D+  W   +G     + PQFEE++ E   +ISKK+ +  N   VTLT +               RD           G  A TP+  +   +          + D  + +    P +S+ SN                           S  + V+VRALYDY G E DEL+   G+   K+  EDEQGWC+G+   GR+GLYPANY E V
Sbjct:   15 FWEVRGSAGNYRQTVKRIEDGNRLCNDLVSCFRERAKIEKSYAQQLSDWSNKWRTSLEKGPQYGTLEKSWQAFLTAAEKLSEIHTELRNQLWDEDSGKVRDWQKEAFHKQMIG--GFRESKEAEESFSKAQKPWVKKLKDVEVAKKRYHVARKDERAAQVREDHSKADSTVSQEQLRKLRDRVEKCNQEADKTKGVYEKALEELNRYNPRYMEDMEQAFESCQEAEQKRLCFFKEMLLDFHKHLDLSSKDSFHVLNKDLHQSIQTADDQQDLKWWRNTHGPSMAMNWPQFEEWSPETQRTISKKERSNKNVEEVTLTGIL------------PARD-----------GVSAGTPTQQLNRGTG---------KDDASEWSEDDSPKKSMDSN-----------------------GREVSQVEGVRVRALYDYAGQEADELSFTAGEELMKIGSEDEQGWCRGRLLSGRIGLYPANYVEGV 438          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Mouse
Match: Pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:MGI Symbol;Acc:MGI:1345153])

HSP 1 Score: 293.123 bits (749), Expect = 2.632e-92
Identity = 165/490 (33.67%), Postives = 278/490 (56.73%), Query Frame = 3
Query:  150 NSAGV----NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEAS--TPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETET-PIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
            +S GV    ++FW++  Y +T++R+++ ++LC D+ N + +R  IEK+Y+  L +W+ +W   +E G +YG+ ++ W+    EAE +S+LH +++  L+++    ++NWQ+E FHK  +     KE K  E  F  AQKPWAKKLK++   KK +H  CK  +    +  N+  D S++ EQLKK+++K+ K ++D  K K+ Y+ SL EL+    +Y+E M +VF + Q  E++R+ FF+ +   +QK L+LS   +   IY+  E +I+  D   D+  +   +G     + PQFEE++ +L+    ++       GVTLT +N    Q       +G++  G +++ PS   +++    S+N       + S++   E     +    +  ++  ++ S   +++  +S  A  ++ P  E      E  V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:    7 DSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCGDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKGPQYGTVEKAWIAVMSEAERVSELHLEVKASLMNEDFEKIKNWQKEAFHKQMMG--GFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHTACKEEKLAISREANSKADPSLNPEQLKKLQDKIEKCKQDVLKTKDKYEKSLKELDQTTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVASYKTIYRELEQSIKAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKAVDGVTLTGINQTGDQ-------SGQNKPGSNLSVPSNPAQSTQLQSSYNPFEDEDDTGSSISEKEDIKAKNVSSYEKTQTYPTDWSDDESNNPFSSTDANGDSNPFDEDTTSGTE--VRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAI 485          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Mouse
Match: Pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:MGI Symbol;Acc:MGI:1345153])

HSP 1 Score: 293.123 bits (749), Expect = 2.632e-92
Identity = 165/490 (33.67%), Postives = 278/490 (56.73%), Query Frame = 3
Query:  150 NSAGV----NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEAS--TPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETET-PIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
            +S GV    ++FW++  Y +T++R+++ ++LC D+ N + +R  IEK+Y+  L +W+ +W   +E G +YG+ ++ W+    EAE +S+LH +++  L+++    ++NWQ+E FHK  +     KE K  E  F  AQKPWAKKLK++   KK +H  CK  +    +  N+  D S++ EQLKK+++K+ K ++D  K K+ Y+ SL EL+    +Y+E M +VF + Q  E++R+ FF+ +   +QK L+LS   +   IY+  E +I+  D   D+  +   +G     + PQFEE++ +L+    ++       GVTLT +N    Q       +G++  G +++ PS   +++    S+N       + S++   E     +    +  ++  ++ S   +++  +S  A  ++ P  E      E  V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:    7 DSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCGDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKGPQYGTVEKAWIAVMSEAERVSELHLEVKASLMNEDFEKIKNWQKEAFHKQMMG--GFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHTACKEEKLAISREANSKADPSLNPEQLKKLQDKIEKCKQDVLKTKDKYEKSLKELDQTTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVASYKTIYRELEQSIKAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKAVDGVTLTGINQTGDQ-------SGQNKPGSNLSVPSNPAQSTQLQSSYNPFEDEDDTGSSISEKEDIKAKNVSSYEKTQTYPTDWSDDESNNPFSSTDANGDSNPFDEDTTSGTE--VRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAI 485          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Mouse
Match: Pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:MGI Symbol;Acc:MGI:1345153])

HSP 1 Score: 293.123 bits (749), Expect = 2.632e-92
Identity = 165/490 (33.67%), Postives = 278/490 (56.73%), Query Frame = 3
Query:  150 NSAGV----NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEAS--TPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETET-PIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
            +S GV    ++FW++  Y +T++R+++ ++LC D+ N + +R  IEK+Y+  L +W+ +W   +E G +YG+ ++ W+    EAE +S+LH +++  L+++    ++NWQ+E FHK  +     KE K  E  F  AQKPWAKKLK++   KK +H  CK  +    +  N+  D S++ EQLKK+++K+ K ++D  K K+ Y+ SL EL+    +Y+E M +VF + Q  E++R+ FF+ +   +QK L+LS   +   IY+  E +I+  D   D+  +   +G     + PQFEE++ +L+    ++       GVTLT +N    Q       +G++  G +++ PS   +++    S+N       + S++   E     +    +  ++  ++ S   +++  +S  A  ++ P  E      E  V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:    7 DSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCGDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKGPQYGTVEKAWIAVMSEAERVSELHLEVKASLMNEDFEKIKNWQKEAFHKQMMG--GFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHTACKEEKLAISREANSKADPSLNPEQLKKLQDKIEKCKQDVLKTKDKYEKSLKELDQTTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVASYKTIYRELEQSIKAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKAVDGVTLTGINQTGDQ-------SGQNKPGSNLSVPSNPAQSTQLQSSYNPFEDEDDTGSSISEKEDIKAKNVSSYEKTQTYPTDWSDDESNNPFSSTDANGDSNPFDEDTTSGTE--VRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAI 485          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Mouse
Match: Pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:MGI Symbol;Acc:MGI:1345153])

HSP 1 Score: 293.123 bits (749), Expect = 2.632e-92
Identity = 165/490 (33.67%), Postives = 278/490 (56.73%), Query Frame = 3
Query:  150 NSAGV----NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEAS--TPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETET-PIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
            +S GV    ++FW++  Y +T++R+++ ++LC D+ N + +R  IEK+Y+  L +W+ +W   +E G +YG+ ++ W+    EAE +S+LH +++  L+++    ++NWQ+E FHK  +     KE K  E  F  AQKPWAKKLK++   KK +H  CK  +    +  N+  D S++ EQLKK+++K+ K ++D  K K+ Y+ SL EL+    +Y+E M +VF + Q  E++R+ FF+ +   +QK L+LS   +   IY+  E +I+  D   D+  +   +G     + PQFEE++ +L+    ++       GVTLT +N    Q       +G++  G +++ PS   +++    S+N       + S++   E     +    +  ++  ++ S   +++  +S  A  ++ P  E      E  V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:    7 DSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCGDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKGPQYGTVEKAWIAVMSEAERVSELHLEVKASLMNEDFEKIKNWQKEAFHKQMMG--GFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHTACKEEKLAISREANSKADPSLNPEQLKKLQDKIEKCKQDVLKTKDKYEKSLKELDQTTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVASYKTIYRELEQSIKAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKAVDGVTLTGINQTGDQ-------SGQNKPGSNLSVPSNPAQSTQLQSSYNPFEDEDDTGSSISEKEDIKAKNVSSYEKTQTYPTDWSDDESNNPFSSTDANGDSNPFDEDTTSGTE--VRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAI 485          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Mouse
Match: Pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:MGI Symbol;Acc:MGI:1345153])

HSP 1 Score: 293.123 bits (749), Expect = 2.632e-92
Identity = 165/490 (33.67%), Postives = 278/490 (56.73%), Query Frame = 3
Query:  150 NSAGV----NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEAS--TPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETET-PIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
            +S GV    ++FW++  Y +T++R+++ ++LC D+ N + +R  IEK+Y+  L +W+ +W   +E G +YG+ ++ W+    EAE +S+LH +++  L+++    ++NWQ+E FHK  +     KE K  E  F  AQKPWAKKLK++   KK +H  CK  +    +  N+  D S++ EQLKK+++K+ K ++D  K K+ Y+ SL EL+    +Y+E M +VF + Q  E++R+ FF+ +   +QK L+LS   +   IY+  E +I+  D   D+  +   +G     + PQFEE++ +L+    ++       GVTLT +N    Q       +G++  G +++ PS   +++    S+N       + S++   E     +    +  ++  ++ S   +++  +S  A  ++ P  E      E  V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:    7 DSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCGDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKGPQYGTVEKAWIAVMSEAERVSELHLEVKASLMNEDFEKIKNWQKEAFHKQMMG--GFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHTACKEEKLAISREANSKADPSLNPEQLKKLQDKIEKCKQDVLKTKDKYEKSLKELDQTTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVASYKTIYRELEQSIKAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKAVDGVTLTGINQTGDQ-------SGQNKPGSNLSVPSNPAQSTQLQSSYNPFEDEDDTGSSISEKEDIKAKNVSSYEKTQTYPTDWSDDESNNPFSSTDANGDSNPFDEDTTSGTE--VRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAI 485          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. UniProt/SwissProt
Match: sp|Q07840|EM13_ECHMU (Antigen EM13 OS=Echinococcus multilocularis OX=6211 GN=EM13 PE=2 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 1.888e-106
Identity = 181/451 (40.13%), Postives = 275/451 (60.98%), Query Frame = 3
Query:  249 MIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTND---SGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDL-EDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSD-----EDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYP 1574
            MIQ+R +IEK+Y+S+L K++ +   +L +G+EYG+      G  +EAE+ ++LH ++   LI+ +Q  ++NWQRE+FHKS++   ++KE K+ +SEF+ AQK W K  K +N+CKKEY   CK VRS  VQ +NA N+   + EQL+K+E+KLRK   + EK +  Y+ +L+ L+    RY+E+MT+VFNK+QA E+ER+ +FK    ++Q++L++S   NL+ I+     T+  +D D+D+ +WS  YG D   + P F+EY+ E+ ++ KK  +   D    GVTLT++       +I S D G          P  GT   T S +  ++SP+ T+A      D   + A P     S++   +         +IS E +  ++++P + D        V +RALYDY+GVE DEL+   GDLF KLEDEDEQGWCKG+KDGRVGLYP
Sbjct:    1 MIQERADIEKAYASNLRKFAARLEMFLRTGVEYGTATNILSGLAKEAEDNAELHSNIAAGLINPVQLGIKNWQRENFHKSSIS-TSIKEVKNFDSEFENAQKTWYKHYKNVNRCKKEYFHACKTVRSLQVQVQNAKNEPFGTPEQLRKIEDKLRKGIMEEEKTRKAYEEALSSLSDVTPRYIEDMTQVFNKAQAFERERIIYFKEQALQMQEVLDISAKPNLSQIFVGLRETVAKVDADADLKKWSLAYGVDMAPNFPVFQEYSPEMSALGKKGRSALADGSSGGVTLTSLK------TITSPDRG---------GPIPGT---TDSGSNISTSPVHTTAYGSNSYDHGSEGATPSDYTSSVNGAAA---------AISKEKQR-VEDTPPYPDFVDDGRPGVPIRALYDYVGVEADELSFNSGDLFEKLEDEDEQGWCKGRKDGRVGLYP 422          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. UniProt/SwissProt
Match: sp|Q07839|EG13_ECHGR (Antigen EG13 OS=Echinococcus granulosus OX=6210 GN=EG13 PE=2 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 7.438e-102
Identity = 175/457 (38.29%), Postives = 265/457 (57.99%), Query Frame = 3
Query:  249 MIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQ-------LKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTND---SGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSD-----EDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYP 1574
            MIQ+R +IEK+Y+S+L K++ +   +L +G+EYG+      G  +EAE+ ++LH ++   LI+ +Q  ++NWQRE+FHKS++   ++KE K+ +SEF+ AQK W K  K +N+CKKEY   CK VRS  VQ +NA N+   + EQ       L+KME+KLRK   + EK +  Y+ +++ L+    RY+E+MT+VFNK+QA E+ER+ +FK    ++Q +L++S   NL+ I+     T+  +D D+D+ +WS  YG D   + P F+EY+ E+ ++ KK  +   D    GVTLT++                    K+  SP  G     P    ++ S +STS                 P  +     SV   +    ++S E +  ++++P + D        V +RALYDY+GVE DEL+   GDLF KLEDEDEQGWCKG+KDGRVGLYP
Sbjct:    1 MIQERADIEKAYASNLRKFAARLEMFLRTGVEYGTATNILSGLAKEAEDNAELHSNIAAGLINPVQLGIKNWQRENFHKSSIS-TSIKEVKNFDSEFENAQKTWYKHYKNVNRCKKEYFHACKTVRSLQVQVQNAKNEPFGTPEQQAQRGKELRKMEDKLRKGIMEEEKTRKAYEEAISSLSDVTPRYIEDMTQVFNKAQAFERERIVYFKEQALQMQAVLDISAKPNLSQIFVELRETVAKVDADADLKKWSLAYGVDMAPNFPVFQEYSPEMSALGKKGRSALADGSSGGVTLTSL--------------------KTFTSPDRG--GPIPG-TTDSGSNISTS-----------------PVHTTDYTSSV---NGAAAAVSKEKQR-VEDTPPYPDFVDDGRPGVPIRALYDYVGVEADELSFNSGDLFEKLEDEDEQGWCKGRKDGRVGLYP 412          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. UniProt/SwissProt
Match: sp|Q4V920|PACN1_DANRE (Protein kinase C and casein kinase substrate in neurons protein 1 OS=Danio rerio OX=7955 GN=pacsin1b PE=1 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 3.985e-97
Identity = 171/482 (35.48%), Postives = 266/482 (55.19%), Query Frame = 3
Query:  162 VNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQEL-HSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSF--NMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
             ++FW++  Y +T++R+E+ ++LC D+ + IQ+R +IEK+YS  L  WS +W   +E G +YG+ ++ WL    EAE++S+LH++++  L+++    V+NWQ++ +HK  +     KE K  +  F  AQKPWAKKLK++   KK YH  CK  +    +  N+  + S++ +Q KK++EK+ K + D +K K  Y+ SL+ELN    +Y+E M  VF++ Q  E++R+ F + +    ++ LNL+E+++   +Y+  E TI +     D+  +S ++G     + PQFEE+  +L H+ISKK+    N  GVTLT V                 + G    +P TG   S  S+  N + S+  S           +D  PP     +  +N                       +P   D   V+VRALYDY G E+DELT K GD   KLEDEDEQGWCKG+ D G++GLYPANY E V
Sbjct:   15 TDSFWEVGNYKRTVKRIEDGHRLCNDMMSCIQERAKIEKAYSQQLTDWSKRWRQLVERGPQYGTLERAWLAVMTEAEKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQMMG--GFKETKEADEGFRKAQKPWAKKLKELETAKKTYHMACKEEKIASAREANSKGEASVTTDQQKKLQEKVDKCKNDVQKAKEKYEKSLDELNKCTPQYMENMEVVFDQCQQFEEKRLNFLREVLLDTKRHLNLTESQSYATVYRELERTIVSASAQEDLKWFSSVHGPGMHMNWPQFEEFNPDLSHAISKKEKVKRNHDGVTLTQV-----------------THGAEHGTPQTGDRGSVSSYEKNQQYSAEWS-----------DDEQPPTAAQSASETNGG---------------------NPFEEDSKGVRVRALYDYEGQEQDELTFKAGDELTKLEDEDEQGWCKGRLDSGQLGLYPANYVEPV 445          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. UniProt/SwissProt
Match: sp|Q9WVE8|PACN2_MOUSE (Protein kinase C and casein kinase substrate in neurons protein 2 OS=Mus musculus OX=10090 GN=Pacsin2 PE=1 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 1.841e-91
Identity = 165/490 (33.67%), Postives = 278/490 (56.73%), Query Frame = 3
Query:  150 NSAGV----NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEAS--TPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETET-PIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
            +S GV    ++FW++  Y +T++R+++ ++LC D+ N + +R  IEK+Y+  L +W+ +W   +E G +YG+ ++ W+    EAE +S+LH +++  L+++    ++NWQ+E FHK  +     KE K  E  F  AQKPWAKKLK++   KK +H  CK  +    +  N+  D S++ EQLKK+++K+ K ++D  K K+ Y+ SL EL+    +Y+E M +VF + Q  E++R+ FF+ +   +QK L+LS   +   IY+  E +I+  D   D+  +   +G     + PQFEE++ +L+    ++       GVTLT +N    Q       +G++  G +++ PS   +++    S+N       + S++   E     +    +  ++  ++ S   +++  +S  A  ++ P  E      E  V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:    7 DSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCGDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKGPQYGTVEKAWIAVMSEAERVSELHLEVKASLMNEDFEKIKNWQKEAFHKQMMG--GFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHTACKEEKLAISREANSKADPSLNPEQLKKLQDKIEKCKQDVLKTKDKYEKSLKELDQTTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVASYKTIYRELEQSIKAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKAVDGVTLTGINQTGDQ-------SGQNKPGSNLSVPSNPAQSTQLQSSYNPFEDEDDTGSSISEKEDIKAKNVSSYEKTQTYPTDWSDDESNNPFSSTDANGDSNPFDEDTTSGTE--VRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAI 485          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. UniProt/SwissProt
Match: sp|Q9DDA9|PACN2_XENLA (Protein kinase C and casein kinase substrate in neurons protein 2 OS=Xenopus laevis OX=8355 GN=pacsin2 PE=2 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 4.322e-91
Identity = 165/496 (33.27%), Postives = 275/496 (55.44%), Query Frame = 3
Query:  138 GETSNSAGV----NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSM--GKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEP---DLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGK-KDGRVGLYPANYAEIV 1595
            G   +S GV    ++FW++  Y +T++R+++ ++LC D+ N I +R  IEK Y+  L +W+ +W   +E G +YG+ ++ W     EAE++S+LH +++  L+++    ++NWQ+E FHK  +     KE K  +  F  AQKPWAKKLK++   KK YH  CK  +    +  N+  D +++ EQLKK+++K+ KS++DS+K K  Y+ SL +L+G   +Y+E M +VF + Q  E +R++FF+ +   ++K L+LS  ++   IY+  E  I++ D   D+  +   +G     + PQFE+++ +L+    ++       GVTLT ++ +  Q+SI++  +   S+   +S  +P    E +      E     +  +  +  P     ++S  P  P  +   N                   P  E  + + E  V+VRALYDY G E DEL+ K G+   K+EDEDEQGWCKG+ + G+VGLYPANY E V
Sbjct:    3 GTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCNDLMNCIHERARIEKVYAQQLTEWAKRWKQLVERGPQYGTVEKAWHNLMTEAEKVSELHLEVKNALMNEDFEKIKNWQKEAFHKQMMG--GFKETKEADDGFRKAQKPWAKKLKEVEAAKKSYHAACKEEKLATSRETNSKADPAMNPEQLKKLQDKVEKSKQDSQKTKEKYEKSLKDLDGTTPQYMENMEQVFEQCQQFEDKRLSFFREVLLEVEKHLDLSNVESYASIYRELEYAIKSADAMEDLKWFRNNHGPGMSMNWPQFEDWSADLNRTLSRREKKKPTDGVTLTGISQSGEQSSIQNQHSSHLSVQSAQSTNNPFEDEEETVSINETENKKIENVGSYEKTHPAEWSDDESNNPFNPSDTNGDN------------------NPFDEDALTTLE--VRVRALYDYDGQELDELSFKAGEELTKIEDEDEQGWCKGRLEGGQVGLYPANYVESV 476          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. TrEMBL
Match: G4V9S3 (Putative membrane traffic protein OS=Schistosoma mansoni OX=6183 GN=Smp_140490 PE=4 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 6.158e-131
Identity = 211/507 (41.62%), Postives = 311/507 (61.34%), Query Frame = 3
Query:  135 EGETSNSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSI-SKKKLNLTN-DSGVTLTAVNMNSRQASIRSGDT----------GRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDE----------DYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 1589
            E E  NS+  ++FW+ ++Y +T++R++ A KLC ++C MIQ+R E+EK+YSS+L KWS++W S+L+SG+EYGS    W G C+EAE +S+ H+++R  LID+IQT+V+ WQ+EHFHKS+LPPQ LKE K  E +F+IAQK W+K+LKK++  KKEY+Q CK  RS  VQ +NA +D S + EQLKK +EKL K+EKD  + ++ Y  +L +LN + +RYVEEMTKVFN++Q  E+ER++FFK +F+ +   LN+    +   IY     +I   D ++D+  WS  +G D PF +PQFEEY+ +L  I SKK+  LT+ ++ VTLT + M S      S +               +  S+ S + G        N +T++P    A           +   KP   + + +    +            +     P++ +E          + V+VRALYDY+G + DE++   GD F KLE+ D+QGWCKG+KDGRVGLYPANY E
Sbjct:    6 EYEDQNSSNASSFWECREYHRTVKRVDAAYKLCNELCLMIQERAELEKAYSSNLKKWSSRWLSFLDSGLEYGSGSSPWKGLCKEAEAVSNAHQNVRNILIDEIQTEVKQWQKEHFHKSSLPPQTLKETKQFEQDFEIAQKQWSKRLKKVHTTKKEYYQACKTERSLQVQVRNAKSDPSGTAEQLKKTQEKLAKAEKDVHRTRDAYKIALADLNTESSRYVEEMTKVFNRTQDFERERLSFFKEIFNSLHSALNVCAKVDYDSIYNELAESISQCDVEADLNLWSSNHGVDMPFVSPQFEEYSPDLAYITSKKRATLTDPNAPVTLTNITMISHPFDNESDEITSNNSKSNNNHNKKLDNSIVSSANGR-------NHDTNNPFDDKA-----------STNTKPTNGVKAGEYAMSSSSAAAFAGGGDGSV---DPIYFEEINDATYDDGREGVKVRALYDYVGQDGDEISFLAGDTFEKLEEPDDQGWCKGRKDGRVGLYPANYVE 491          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. TrEMBL
Match: A0A504YA41 (Adaptor protein pacsin OS=Fasciola gigantica OX=46835 GN=FGIG_01093 PE=4 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 3.000e-128
Identity = 199/488 (40.78%), Postives = 305/488 (62.50%), Query Frame = 3
Query:  150 NSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQ------LKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTND--SGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 1589
            N    ++FWD + + KT++R E ANKLC+++  MI +R E+E+ Y+++L +W+ +W S+L+SG  YG+    W G C+EAE IS+ H+D+R  L D+IQ  +++WQ+EHFHK++LPPQ+LKE+K  E +FD AQKPWAK++KK+NQCKK+Y+Q CKM RS  VQ +NA ND + + EQ      LKKM++K +KSEK+ E+ +  Y ++L+ L+ D  RY+EEMT VF+++Q  E+ER+ FFK +F+ + + LN++   +   IY++ E +I  +D ++D+  WS  +G D P   PQFEEY+ EL +IS KK +  ++  SGVTLT +        +      +  +  +       ++  TP F+   + P + +     +P  ED      P   ++ +  ++  D+  ++   +    I             VRALYDY G E+DE++   GD F KLE+ D+QGWCKG+KDGRVGLYPANYAE
Sbjct:   10 NGLSASSFWDFRGHQKTVKRAEVANKLCSELSLMIHERAELERVYAANLKRWTARWLSFLDSGFVYGTGISPWKGLCQEAEAISNAHQDIRNVLTDEIQPGLKHWQKEHFHKTSLPPQSLKESKQFEQDFDQAQKPWAKRMKKVNQCKKDYYQACKMERSLQVQVQNAKNDPNGTPEQMEVDPKLKKMQDKWKKSEKEVERTRAAYTNALSGLDADNPRYLEEMTAVFSRTQDFERERLIFFKDLFANLHQALNVTTKADFNVIYRDLEESIAKMDIEADLNWWSANHGVDMPAVLPQFEEYSPELTAISSKKRSTVSETNSGVTLTGITPVISSPEVIPNRPSQAQIETNHNMNGLNSDIHTP-FDDGLTGPPTPTTPVGAQP--EDGGQVSAPVGDLTGHDEISDADYYASATYDDGRPGIP------------VRALYDYTGQEDDEISFVAGDRFEKLEEADDQGWCKGRKDGRVGLYPANYAE 482          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. TrEMBL
Match: A0A4E0RQB9 (Adaptor protein pacsin OS=Fasciola hepatica OX=6192 GN=D915_001138 PE=4 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.638e-127
Identity = 198/488 (40.57%), Postives = 306/488 (62.70%), Query Frame = 3
Query:  150 NSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQ------LKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTND--SGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 1589
            N    ++FWD + + KT++R E ANKLC+++  MI +R E+E+ Y+++L +W+ +W S+L+SG  YG++   W G C+EAE IS+ H+D+R  L D+IQ  +++WQ+EHFHK++LPPQ+LKE+K  E +FD AQKPWAK++KK+NQCKK+Y+Q CKM RS  VQ +NA ND + + EQ      LKKM++K +KSEK+ E+ +  Y ++L+ L+ D  RY+EEMT VF+++Q  E++R+ FFK +F+ + + LN++   +   IY++ E +I  +D ++D+  WS  +G D P   PQFEEY+ EL +IS KK +  ++  SGVTLT +        +      +  +  +       ++  TP F+   + P + +     +P  ED      P   ++ +  ++  D+  ++   +    I             VRALYDY G E+DE++   GD F KLE+ D+QGWCKG+KDGRVGLYPANYAE
Sbjct:   10 NGLSASSFWDFRGHQKTVKRAEVANKLCSELSLMIHERAELERVYAANLKRWTARWLSFLDSGFVYGTSISPWKGLCQEAEAISNAHQDIRNVLTDEIQPGLKHWQKEHFHKTSLPPQSLKESKQFEQDFDQAQKPWAKRMKKVNQCKKDYYQACKMERSLQVQVQNAKNDPNGTPEQMEVDPKLKKMQDKWKKSEKEVERTRAAYTNALSGLDADNPRYLEEMTAVFSRTQDFERDRLIFFKDLFANLHQALNVTTKADFNVIYRDLEESIAKMDIEADLNWWSVNHGVDMPAVLPQFEEYSPELTAISSKKRSTVSETNSGVTLTGITPVISSPEVIPNRPSQAQIETNHNMNGLNSDIHTP-FDDGLTGPPTPTTPVGAQP--EDGGQVSVPVGDMTGHDEISDADYYASATYDDGRPGIP------------VRALYDYTGQEDDEISFVAGDRFEKLEEADDQGWCKGRKDGRVGLYPANYAE 482          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. TrEMBL
Match: A0A430QRV4 (Protein kinase C and casein kinase substrate in neurons protein OS=Schistosoma bovis OX=6184 GN=DC041_0004309 PE=4 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 4.163e-126
Identity = 216/534 (40.45%), Postives = 316/534 (59.18%), Query Frame = 3
Query:  135 EGETSNSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILN-----------------------------------------LSENKNLTD-IYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSIS-KKKLNLTN-DSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTE----ASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEI 1592
            E E  NS+  ++FW+ ++Y +T++R++ A KLC ++C MIQ+R E+EK+YSS+L KWS++W S+L+SG+EYGS    W G C+EAE +S+ H+++R  LIDDIQT V+ WQ+EHFHKS+LPPQ LKE K  E +F++AQK W+K+LKK++  KKEY+Q CK  RS  VQ +NA +D S + EQLKK +EKL K+EKD  + ++ Y  +L +LN + +RYVEEMTKVFN++Q  E+ER++FFK +F+ +   LN                                         L EN    D IY     +I   D ++D+  WS  +G D PF +PQFEEY+ +L  I+ KK+  LT+ DS VTLT + M S      S +   ++   +  + +  +E    +S    N +T++P         +P    +A       ++SS  +          I +     I ++      + V+VRALYDY+G + DE++   GD F KLE+ D+QGWCKG+KDGRVGLYPANY E+
Sbjct:    6 EYEDQNSSNASSFWECREYHRTVKRVDAAYKLCNELCLMIQERAELEKAYSSNLKKWSSRWLSFLDSGLEYGSGSSPWKGLCKEAEAVSNAHQNVRNILIDDIQTGVKQWQKEHFHKSSLPPQTLKETKQFEQDFELAQKQWSKRLKKVHTTKKEYYQACKTERSLQVQVRNAKSDPSGTAEQLKKTQEKLAKAEKDVYRTRDAYKMALADLNTESSRYVEEMTKVFNRTQDFERERLSFFKDIFNSLHGALNVCAKVNNNNNNNNNNNNNNNNNNNNSSSNNNNNNYRNDIFFLVENIFSYDSIYSELAESISQCDVEADLNLWSSNHGVDMPFVSPQFEEYSPDLAYITGKKRATLTDPDSPVTLTNITMISHPFDHESNEITSNNSRSNNNNHNKKSENTIVSSANGRNSDTNNPFDDKVSTNRKPTNGVNA----SVYAMSSGSAAAFAGDGDGGIDSMYTEEINDATYDDGREGVKVRALYDYVGQDGDEISFVAGDTFEKLEEPDDQGWCKGRKDGRVGLYPANYVEL 535          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. TrEMBL
Match: A0A564XWN1 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS511 PE=4 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.321e-121
Identity = 197/488 (40.37%), Postives = 301/488 (61.68%), Query Frame = 3
Query:  147 SNSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTND--SGVTLTAVNMNS---RQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 1595
            +++A   +FW+  QY++T++R++NANKLC+++  MIQ+R +IE++Y+++L K++++  ++L+SGIEYG+      G  +EA + +DLH ++ T LI+ +QT ++NWQ+E+FHKS++   ++KE KS ++EF+ AQK W K  K++N+CKKEY   CK VRS  VQ +NA N+   + EQL++ME+KL+K+  + EK +  Y  +++ LN    RY+++MT+VFNK+QA EK+R+ +FK     +Q++L++S   NL  I+   ++TI  +D D+D+ +WS LYG D P + P F+EY+ EL ++ KK  +   D  SGVTLT++ M S   R  +    DT   +   S+   +T T    P+   E  +         L PDL D   P  P                                         +RALYDY+GVE DEL+ KQGDLF KLEDEDEQGWCKG+KDGRVGLYPANY +++
Sbjct:   10 ADNATTVSFWEPNQYIRTVKRVDNANKLCSELSIMIQERSDIERAYAANLQKFASRLETFLKSGIEYGTGSNLISGLAKEARDTADLHSNIATDLINPVQTGIKNWQKENFHKSSIS-SSIKEVKSFDAEFENAQKTWYKNYKQVNKCKKEYFHACKAVRSLQVQVQNAKNEPFGTPEQLRRMEDKLKKATTEEEKTRKAYLDAISALNDVTPRYMDDMTQVFNKAQAFEKKRIEYFKQQVLAMQEVLDVSSKSNLPKIFAEMKDTISKVDADADLKKWSLLYGVDMPTNFPAFQEYSPELCALGKKGKSAVADTNSGVTLTSMKMISSPERPTNAGVTDTALTAGYNSLNGGTTSTVVQQPTAITENVA---------LYPDLIDDGRPGVP-----------------------------------------IRALYDYVGVESDELSFKQGDLFEKLEDEDEQGWCKGRKDGRVGLYPANYVQVL 446          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Cavefish
Match: pacsin1b (protein kinase C and casein kinase substrate in neurons protein 1 [Source:NCBI gene;Acc:103037534])

HSP 1 Score: 294.278 bits (752), Expect = 1.733e-93
Identity = 166/482 (34.44%), Postives = 261/482 (54.15%), Query Frame = 3
Query:  159 GVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQEL-HSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSD-EDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
              ++FW++  Y +T++R+++ ++LC D+ N I +R +IEK+Y+  L  WS +W   +E G +YG+ ++ W+    E E++S+LH++++  L+++    V+NWQ++ +HK  +     KE K  E  F  AQKPWAKKLK++   KK YH  CK  +    +  N+  +T    EQ KK++EK+ K + D +K K  Y+ +L+EL     +Y+E M  VF + Q  E++R++F + +   +++ LNL+EN++   IY++ E TI +     D+  +S  +G     + PQFEEY  +L H+ISKK+    N  GVTLT V          +GD          A+P TG   S  S++                                +   S   +D  Q +     ET    +P   D    V+VRALYDY G E+DEL+ + GD   KLEDED+QGWCKG+ D G++GLYPANY E +
Sbjct:   14 ATDSFWEVGNYKRTVKRIDDGHRLCNDLMNCIHERAKIEKAYAQQLTDWSKRWRQLVEKGPQYGTVERGWITVMTETEKVSELHQEVKNNLLNEDLEKVKNWQKDSYHKQIMG--GFKETKEAEEGFKKAQKPWAKKLKELETAKKAYHMACKEEKLASTREANSKGETPAPAEQQKKLQEKVEKCKNDVQKAKEKYEKALDELGKCTPQYMENMEGVFEQCQQFEEKRLSFVREVLLDVKRHLNLTENQSYATIYRDLERTITSASAQEDLKWFSNNHGPGMHMNWPQFEEYNPDLTHAISKKEKVKKNHDGVTLTHV--------TPAGD---------HATPPTGDRGSVSSYDK-------------------------------NQGYSAEWSDEDQPAAQQAAETNGGNNPFEEDVSKGVRVRALYDYEGQEQDELSFRAGDELTKLEDEDDQGWCKGRLDSGQLGLYPANYVEPI 445          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Cavefish
Match: pacsin1b (protein kinase C and casein kinase substrate in neurons protein 1 [Source:NCBI gene;Acc:103037534])

HSP 1 Score: 294.278 bits (752), Expect = 1.733e-93
Identity = 166/482 (34.44%), Postives = 261/482 (54.15%), Query Frame = 3
Query:  159 GVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQEL-HSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSD-EDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
              ++FW++  Y +T++R+++ ++LC D+ N I +R +IEK+Y+  L  WS +W   +E G +YG+ ++ W+    E E++S+LH++++  L+++    V+NWQ++ +HK  +     KE K  E  F  AQKPWAKKLK++   KK YH  CK  +    +  N+  +T    EQ KK++EK+ K + D +K K  Y+ +L+EL     +Y+E M  VF + Q  E++R++F + +   +++ LNL+EN++   IY++ E TI +     D+  +S  +G     + PQFEEY  +L H+ISKK+    N  GVTLT V          +GD          A+P TG   S  S++                                +   S   +D  Q +     ET    +P   D    V+VRALYDY G E+DEL+ + GD   KLEDED+QGWCKG+ D G++GLYPANY E +
Sbjct:   14 ATDSFWEVGNYKRTVKRIDDGHRLCNDLMNCIHERAKIEKAYAQQLTDWSKRWRQLVEKGPQYGTVERGWITVMTETEKVSELHQEVKNNLLNEDLEKVKNWQKDSYHKQIMG--GFKETKEAEEGFKKAQKPWAKKLKELETAKKAYHMACKEEKLASTREANSKGETPAPAEQQKKLQEKVEKCKNDVQKAKEKYEKALDELGKCTPQYMENMEGVFEQCQQFEEKRLSFVREVLLDVKRHLNLTENQSYATIYRDLERTITSASAQEDLKWFSNNHGPGMHMNWPQFEEYNPDLTHAISKKEKVKKNHDGVTLTHV--------TPAGD---------HATPPTGDRGSVSSYDK-------------------------------NQGYSAEWSDEDQPAAQQAAETNGGNNPFEEDVSKGVRVRALYDYEGQEQDELSFRAGDELTKLEDEDDQGWCKGRLDSGQLGLYPANYVEPI 445          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Cavefish
Match: pacsin2 (protein kinase C and casein kinase substrate in neurons protein 2 [Source:NCBI gene;Acc:103038884])

HSP 1 Score: 294.278 bits (752), Expect = 8.200e-93
Identity = 165/493 (33.47%), Postives = 275/493 (55.78%), Query Frame = 3
Query:  165 NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELH-SISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPI--------------KESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGK-KDGRVGLYPANYAEIV 1595
            ++FW++  Y +T++R+++ N+LC D+ N I +R  IEK+Y+  L +W+ +W   +E G +YG+ ++ W     EAE++SDLH +++  L+ +    V+NWQ++ +HK  +     KE K  +  F  AQKPWAKKLK+++  KK YH  CK  +    +   +  +++ + E  KK+++K+ K ++D +K K  Y+ SL EL+    +Y+E M +VF + Q  E +R++FFK +   +++ L+LS N     +YQN E++IQ  D + D+  +   +G   P + PQFEE++ +L+ ++S+++    +D  VTLT +N        ++GD    +   S+A PS+        F+ +              P ++  + P+   +    +K+ +  +  Q+    ET  P                 SPV S    V VRALYDY G E+DEL+ K GD F K+ +ED+QGWCKG+ KDG VGLYPANY E +
Sbjct:   15 DSFWEIGNYKRTVKRVDDGNRLCNDLMNCIHERARIEKAYAQQLTEWAKRWRQLIEKGPQYGTVERAWCALMTEAEKVSDLHMEVKAALMAEDFEKVKNWQKDAYHKQMI--GGFKETKEADDGFRKAQKPWAKKLKEVDTTKKVYHTACKEEKLATSRENTSKLESNTNPEAQKKLQDKVEKCQQDVQKTKERYEKSLEELDKVTPQYMENMEQVFEQCQQFEDKRLSFFKELLLEVKQHLDLSTNHKFQTVYQNLEDSIQAADAEEDLKWFRSNHGPGMPMNWPQFEEWSIDLNRTLSRREKKKPSDE-VTLTGIN--------QTGDRPAKTNNNSLAVPSSTEPVGLNPFDDDDEEEEEEEV-----PAVQPKSSPVNVKKEEVISKTASSVEKTQDWSDEETGNPFGADSNGNGNPFEDEPNSPVIS----VPVRALYDYEGQEQDELSFKAGDEFTKIGEEDDQGWCKGRLKDGTVGLYPANYVEDI 487          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Cavefish
Match: pacsin2 (protein kinase C and casein kinase substrate in neurons protein 2 [Source:NCBI gene;Acc:103038884])

HSP 1 Score: 283.878 bits (725), Expect = 1.106e-88
Identity = 165/509 (32.42%), Postives = 275/509 (54.03%), Query Frame = 3
Query:  165 NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFE----------------EYTQELH-SISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPI--------------KESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGK-KDGRVGLYPANYAEIV 1595
            ++FW++  Y +T++R+++ N+LC D+ N I +R  IEK+Y+  L +W+ +W   +E G +YG+ ++ W     EAE++SDLH +++  L+ +    V+NWQ++ +HK  +     KE K  +  F  AQKPWAKKLK+++  KK YH  CK  +    +   +  +++ + E  KK+++K+ K ++D +K K  Y+ SL EL+    +Y+E M +VF + Q  E +R++FFK +   +++ L+LS N     +YQN E++IQ  D + D+  +   +G   P + PQFE                E++ +L+ ++S+++    +D  VTLT +N        ++GD    +   S+A PS+        F+ +              P ++  + P+   +    +K+ +  +  Q+    ET  P                 SPV S    V VRALYDY G E+DEL+ K GD F K+ +ED+QGWCKG+ KDG VGLYPANY E +
Sbjct:   15 DSFWEIGNYKRTVKRVDDGNRLCNDLMNCIHERARIEKAYAQQLTEWAKRWRQLIEKGPQYGTVERAWCALMTEAEKVSDLHMEVKAALMAEDFEKVKNWQKDAYHKQMI--GGFKETKEADDGFRKAQKPWAKKLKEVDTTKKVYHTACKEEKLATSRENTSKLESNTNPEAQKKLQDKVEKCQQDVQKTKERYEKSLEELDKVTPQYMENMEQVFEQCQQFEDKRLSFFKELLLEVKQHLDLSTNHKFQTVYQNLEDSIQAADAEEDLKWFRSNHGPGMPMNWPQFEKVDFSRPRFHKRKSIIEWSIDLNRTLSRREKKKPSDE-VTLTGIN--------QTGDRPAKTNNNSLAVPSSTEPVGLNPFDDDDEEEEEEEV-----PAVQPKSSPVNVKKEEVISKTASSVEKTQDWSDEETGNPFGADSNGNGNPFEDEPNSPVIS----VPVRALYDYEGQEQDELSFKAGDEFTKIGEEDDQGWCKGRLKDGTVGLYPANYVEDI 503          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Cavefish
Match: pacsin2 (protein kinase C and casein kinase substrate in neurons protein 2 [Source:NCBI gene;Acc:103038884])

HSP 1 Score: 272.707 bits (696), Expect = 6.130e-85
Identity = 162/495 (32.73%), Postives = 263/495 (53.13%), Query Frame = 3
Query:  165 NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFE----------------EYTQELH-SISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGK-KDGRVGLYPANYAEIV 1595
            ++FW++  Y +T++R+++ N+LC D+ N I +R  IEK+Y+  L +W+ +W   +E G +YG+ ++ W     EAE++SDLH +++  L+ +    V+NWQ++ +HK  +     KE K  +  F  AQKPWAKKLK+++  KK YH  CK  +    +   +  +++ + E  KK+++K+ K ++D +K K  Y+ SL EL+    +Y+E M +VF + Q  E +R++FFK +   +++ L+LS N     +YQN E++IQ  D + D+  +   +G   P + PQFE                E++ +L+ ++S+++    +D  VTLT +N            TG D   K+  + ++  E +    + ET +P    +     P  ED                                     SPV S    V VRALYDY G E+DEL+ K GD F K+ +ED+QGWCKG+ KDG VGLYPANY E +
Sbjct:   15 DSFWEIGNYKRTVKRVDDGNRLCNDLMNCIHERARIEKAYAQQLTEWAKRWRQLIEKGPQYGTVERAWCALMTEAEKVSDLHMEVKAALMAEDFEKVKNWQKDAYHKQMIG--GFKETKEADDGFRKAQKPWAKKLKEVDTTKKVYHTACKEEKLATSRENTSKLESNTNPEAQKKLQDKVEKCQQDVQKTKERYEKSLEELDKVTPQYMENMEQVFEQCQQFEDKRLSFFKELLLEVKQHLDLSTNHKFQTVYQNLEDSIQAADAEEDLKWFRSNHGPGMPMNWPQFEKVDFSRPRFHKRKSIIEWSIDLNRTLSRREKKKPSDE-VTLTGINQ-----------TG-DRPAKTNNNSASSVEKTQDWSDEETGNPFGADSNGNGNP-FEDEP----------------------------------NSPVIS----VPVRALYDYEGQEQDELSFKAGDEFTKIGEEDDQGWCKGRLKDGTVGLYPANYVEDI 455          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Sea Lamprey
Match: pacsin3 (protein kinase C and casein kinase substrate in neurons 3 [Source:ZFIN;Acc:ZDB-GENE-040426-984])

HSP 1 Score: 157.147 bits (396), Expect = 1.693e-44
Identity = 88/247 (35.63%), Postives = 144/247 (58.30%), Query Frame = 3
Query:  333 SGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLID-DIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELH-SISKK 1067
            +G +YGS    W G   EA+ +S LH DMRT+L+  DI+T ++ WQ++ FHK  +     KE K  E  F  AQKPWAKKLK+++  KK Y   CK  +  + ++  +  D +   +  +K+ EK+ + + + +K K+ Y   L +LN    +Y+E+M  VF++ Q  E +R++FFKS+ S ++  L+LS N     IY+  +  I ++DP+ D+  +    GA  P + P FEEY+ + + +ISK+
Sbjct:    1 AGPQYGSVATAWKGLMNEADNVSTLHVDMRTQLMSKDIET-IKGWQKDAFHKQMI--GGFKETKEAEDNFRKAQKPWAKKLKEVDANKKLYQAACKEEKLAESRDNQSKTDPAQPPDVQRKLAEKVERCKAEVQKSKDRYQKVLVDLNLANPKYMEDMELVFDQCQEAEGKRLSFFKSVLSSVKVHLDLSNNDKFAAIYRELQQDISSIDPEEDLKWFRNTMGAGMPMNWPAFEEYSPDTNRTISKR 244          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000643.1 (pep scaffold:Pmarinus_7.0:GL477040:74682:76763:1 gene:ENSPMAG00000000580.1 transcript:ENSPMAT00000000643.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.132 bits (370), Expect = 2.175e-41
Identity = 75/199 (37.69%), Postives = 118/199 (59.30%), Query Frame = 3
Query:  150 NSAGVNT----FWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEK 734
            + AGV T    FW++  Y +T+RR+++  +LC D+   IQ+R +IEK YS  L  W+ KW + +E G +YGS ++ W     EA+ +SDLH +MR ++ ++    ++NWQ++ FHK  +     KE K  E  F  AQKPWAKKLK++   KK YH  CK  R    +  +  +D +   +Q KK+ +K+ K  +D++K
Sbjct:    7 DCAGVETSSESFWEVGNYKRTVRRIDDGYRLCNDLMACIQERAKIEKVYSQQLTDWTKKWKTLIERGPQYGSMERAWQALMTEADRVSDLHHEMRNQINNEDLEKIKNWQKDTFHKQLIG--GFKETKEAEDGFRKAQKPWAKKLKELEVLKKAYHLACKEERLAVSRETSTKSDPAAPPDQAKKLSDKVEKCRQDTQK 203          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Sea Lamprey
Match: ABI1 (abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:11320])

HSP 1 Score: 54.6842 bits (130), Expect = 3.482e-8
Identity = 23/65 (35.38%), Postives = 41/65 (63.08%), Query Frame = 3
Query: 1404 PVFSDEDYVQ-VRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 1595
            P ++ + Y++ V A+YDY+  ++DEL+  +G + Y +   D+ GW +G  +G  GL+P NY E +
Sbjct:  386 PEWAPKIYIEKVVAVYDYVQDKDDELSFHEGSIIYVVRKNDD-GWYEGATNGHTGLFPGNYVEPI 449          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Sea Lamprey
Match: ABI1 (abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:11320])

HSP 1 Score: 54.299 bits (129), Expect = 4.330e-8
Identity = 24/65 (36.92%), Postives = 43/65 (66.15%), Query Frame = 3
Query: 1404 PVFSDEDYVQ-VRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 1595
            P ++ + Y++ V A+YDY   +EDEL+ ++G + Y ++  D+ GW +G  +G+ GL+P NY E +
Sbjct:  386 PPWAPKSYLEKVVAVYDYNKDKEDELSFQEGSIIYVIKKNDD-GWYEGTMNGQTGLFPGNYVEPI 449          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Sea Lamprey
Match: DBNL (drebrin like [Source:HGNC Symbol;Acc:HGNC:2696])

HSP 1 Score: 50.8322 bits (120), Expect = 5.144e-7
Identity = 22/54 (40.74%), Postives = 31/54 (57.41%), Query Frame = 3
Query: 1434 VRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 1595
             RALYDY   ++ E++   GDL   +E  D+  W     DG  G++PANY E+V
Sbjct:  302 ARALYDYQAADDTEISFDPGDLISNIEQIDDGWWNGSGPDGSRGMFPANYVELV 355          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Yeast
Match: LSB3 (Protein containing a C-terminal SH3 domain; binds Las17p, which is a homolog of human Wiskott-Aldrich Syndrome protein involved in actin patch assembly and actin polymerization; protein abundance increases in response to DNA replication stress; LSB3 has a paralog, YSC84, that arose from the whole genome duplication [Source:SGD;Acc:S000002968])

HSP 1 Score: 51.9878 bits (123), Expect = 1.579e-7
Identity = 22/53 (41.51%), Postives = 33/53 (62.26%), Query Frame = 3
Query: 1440 ALYDYIGVEEDELTLKQGDLFYKLEDEDEQG-WCKGKKDGRVGLYPANYAEIV 1595
            ALY + G E  +L  ++GD+   L+  D Q  W  G+ +GR G++PANY E+V
Sbjct:  407 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV 459          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Yeast
Match: LSB1 (Negative regulator of actin nucleation-promoting factor activity; interacts with Las17p, a homolog of human Wiskott-Aldrich Syndrome protein (WASP), via an N-terminal SH3 domain, and along with PIN3 cooperatively inhibits the nucleation of actin filaments; overexpression blocks receptor-mediated endocytosis; protein increases in abundance and forms nuclear foci in response to DNA replication stress; LSB1 has a paralog, PIN3, that arose from the whole genome duplication [Source:SGD;Acc:S000003368])

HSP 1 Score: 46.2098 bits (108), Expect = 4.895e-6
Identity = 22/57 (38.60%), Postives = 36/57 (63.16%), Query Frame = 3
Query: 1419 EDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 1589
            E+YV+  ALYD+   ++ +L+LK GD    LE      W +GK + ++G++PANY +
Sbjct:   55 EEYVE--ALYDFEAQQDGDLSLKTGDKIQVLEKISPD-WYRGKSNNKIGIFPANYVK 108          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Yeast
Match: YSC84 (Actin-binding protein; involved in bundling of actin filaments and endocytosis of actin cortical patches; activity stimulated by Las17p; contains SH3 domain similar to Rvs167p; YSC84 has a paralog, LSB3, that arose from the whole genome duplication [Source:SGD;Acc:S000001058])

HSP 1 Score: 46.9802 bits (110), Expect = 6.105e-6
Identity = 19/52 (36.54%), Postives = 32/52 (61.54%), Query Frame = 3
Query: 1440 ALYDYIGVEEDELTLKQGDLFYKLEDEDEQG-WCKGKKDGRVGLYPANYAEI 1592
            ALY++ G +  +L  K+GD+   L+  D Q  W  G+ +G+ G++PANY  +
Sbjct:  416 ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVRV 467          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Nematostella
Match: EDO42689 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0K6])

HSP 1 Score: 235.343 bits (599), Expect = 2.499e-71
Identity = 147/485 (30.31%), Postives = 239/485 (49.28%), Query Frame = 3
Query:  141 ETSNSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 1595
            E + +A  ++FWD+  Y +T++R+++ +KLC +   M+ +R EIE  YS+ L  W+ KW   +++G EYGS ++ + G   EA   + +H   R  L++D+   V+ W+ +++ KS    + +KEA   E  F  AQKPWAK L K+ + +K YH   K           A +D ++ QE+ KK+ + + K+ +D +K ++ Y+  L  ++ D  RY  +MT+ F + QA E++R  FFK    +    L++S     + I+ +   T Q  D   D+  WS+L+G   P + P+FEE   EL+           D  +            S+R G TG        +  +   E S PS+N   ++P   +       D E S P         S++  T  D                 P   D+  V V ALYDY   E+DEL+ K G++  KL + D+QGWC+G+ + R GL+PA Y E +
Sbjct:   11 EETLTASSDSFWDVGNYKRTVKRVDDGSKLCDEFMKMVTERAEIEARYSAKLKVWAKKWEEVIKAGSEYGSMEEAFKGAVDEANSRASVHTQCRDDLLNDVVELVKKWKGDNYQKSMFQWKQVKEA---EEGFARAQKPWAKLLMKVMRSRKAYHNAAKATEQAKKLQIEASSDPNVPQEKFKKLTDAVEKARRDMQKCEDKYNDRLENISKDNPRYERDMTEQFERCQAFEQKRKDFFKDALMKYHSCLDVSRKSEFSGIFLHMSTTFQMADSSKDLDYWSRLHGVAMPKNWPRFEELPSELN-------RRPYDEDL----------HGSMRRG-TG--------SYENAALEYSAPSYNQVQAAPQQYN-------DAEQSNP--------FSHQDSTEEDE------------FGAIPPPMDDLAVPVLALYDYEAAEDDELSFKAGEIVTKLSERDDQGWCRGRINHRTGLFPAEYVEAL 439          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Nematostella
Match: EDO41940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2R6])

HSP 1 Score: 187.963 bits (476), Expect = 2.601e-55
Identity = 98/289 (33.91%), Postives = 160/289 (55.36%), Query Frame = 3
Query:  168 TFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNK--NAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQF 1028
            +FW +  Y +T+RR+++  KLC D   M+ +R EIE  Y++ L  WS KW   L  G EYGS K  W+    EAE+++ +H ++++ L+  +   V  W+  ++HKS L   + KE K+ E  F  AQ+PWAK+   + + KK Y+  C   R+ D   K  N+ +  ++ ++Q+KK +EKL KSE++    ++ Y  ++ ++     +Y E+M  VF+K QA E ER AFFK     +   LN+ +    T IY    N  +  +P +D+  W+  YG D P   P++
Sbjct:    1 SFWQVNNYKRTVRRVDDGAKLCDDFMKMVSERAEIEALYAAKLQAWSRKWLDLLNKGPEYGSCKDSWVHVTSEAEQVAQVHINLQSTLLSRVHESVAAWKGANYHKSLL---SWKETKNAEEGFSKAQRPWAKRYDDVLKSKKAYYAAC---RARDQAEKLYNSSDPNTMKEDQIKKTKEKLMKSEREVSTTQDKYKEAVRDITNYNPKYKEDMCFVFDKLQAFEGERKAFFKQTMQGLCNALNVQQ---FTQIYNELSNKFEKTEPTADLGWWASTYGTDMPIKWPEY 280          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Nematostella
Match: EDO43872 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXM7])

HSP 1 Score: 70.8626 bits (172), Expect = 5.753e-13
Identity = 109/516 (21.12%), Postives = 214/516 (41.47%), Query Frame = 3
Query:  168 TFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKN-------AVNDTSIS--QEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGAD-FPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSF-NMETSSPLST-------------SALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIK--ESP--------------VFSDEDYV--QVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 1589
            +FW+ K Y +  +     +  C +I  +  +R +IE SY+ SL K S K    L   +  G+ K  W       E  +D+H+ +  +L  +    +         K+ +  Q+ K  K +E E + A K ++ +L    + K   H + K V +   Q ++       AV+D  I+  + ++KK  E   KS+KD  ++    + +  E     ++Y +   K       +E+ER+   K MFS    +L  +    L  +Y++ ++    + P  D+   + + G+   P     ++ Y ++L           N+         +N++   I + +  ++   K+       T ++TP + N ET + ++              ++  +L+  L       +P   +    + TR+  +Q ++ +    P+   +SP               F  +  V  Q +A+YDY   + DELT+  GD+       D  GW +G  + + G++PA+Y E
Sbjct:    7 SFWEQKGYEELRKSCRQGSDFCKEIAAIFNERSKIELSYADSLSKLSVKAQKLLAKDV-VGTLKSSWEKISWNIESEADIHRTLANQLHGEAAKQI---------KAFVETQS-KTRKPVEVEVEKAYKNFSDRLSDSLKKKGASHSKSKEVETLHDQMEDTKQGKGKAVSDKDITKLEAKIKKGMESAIKSDKDYREMYMKTERTRLEWEATMSKYCQTCEK-------LEEERVGHLKDMFSLYGNML-AAVIPELQQVYESIQHEASQISPKEDVNTIADVKGSPRGPSEQTLYDCYEEDLE----------NNFNFERRKEALNAK-IKILASELEKEKKAKTGVVNLMDTYSATPEYCNQETQNDVAMQITHVNAVIDSLQASSYKLQCSLAKLTGNSQPQHPLMDYITSTRD--KQGTVQSTLRKPLDLVKSPGGYESDDQLDDEFDDFQPDGTVLCQCKAIYDYQATQSDELTIHPGDIITVTARLD-NGWWQGDLNNQQGIFPASYVE 489          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Nematostella
Match: EDO34808 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNC2])

HSP 1 Score: 70.0922 bits (170), Expect = 6.684e-13
Identity = 103/501 (20.56%), Postives = 205/501 (40.92%), Query Frame = 3
Query:  162 VNTFWDLKQYVKTI------RRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEA-KSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQ-----------LKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLY--GADFPFSTPQFEEY-----TQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 1589
            V+ FW   ++  T       +R+ +  + C ++   ++ R +IE+ Y  SL + +   TS  E+  E G+ K  W     E E I   H  +  +L+D ++  ++ ++           +N KE  K LE     +Q+      + +++ K+ Y Q+C+   + D   K +V+  +  +E+            +K    +R  +  S +  + Y +S+  L+     +  EM    N  Q +E+ER+AF ++       + +++  K + ++Y+    +++  + D DI  +  +   G++ P S   +E Y     +Q+   +S   +N+      +LT                 RD +   +  P     A+ P+   E ++ L T+        + +  PP KP   +                           P    E Y   RALY+Y    + EL+ K  D+   L +ED+  WC G+ +G+ G++P  + +
Sbjct:    5 VDCFWG-TEFTSTAGFDALSKRMRDGKQTCQEMEEFVKQRADIEEKYGKSLMRLAK--TS--EAKDEIGTLKSSWDSLRNETENIGKAHVALAQQLLDSLEKGLQEFR-----------ENQKETRKKLEDSVKRSQRNKKTCYENLHKLKRTYEQKCREKEAADDALKKSVSMAAKDEEKTLHSSIVYGHTTEKAPVLVRSPKLSSVEHDSAYQTSVRVLDDTRVVWEREMATCCNVFQNLEEERIAFLRNWMWLYANLGSINCVK-VDEMYEVVRQSLEGCNVDQDIKLFISMRQTGSERP-SHIDYENYYMVQSSQKTSPLSGGSVNIGGPIPGSLTH---------------SRDMV--QVGRPGGRLPAALPAVPTEENADLYTT--------VNEVLPPQKPTARV---------------------------PARPKERY--FRALYEYEAQGDQELSFKASDIIRFLYEEDDT-WCCGELNGKKGMFPKEFVD 432          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Nematostella
Match: EDO38710 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC74])

HSP 1 Score: 51.6026 bits (122), Expect = 1.623e-7
Identity = 28/71 (39.44%), Postives = 43/71 (60.56%), Query Frame = 3
Query: 1389 PIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDE--DEQGWCKGKKDGRVGLYPANYAEIV 1595
            P K+ P  ++E  ++ +  YDY    EDEL LK GD+   ++ E  D  GW +G+ DG+ GL+P N+ EI+
Sbjct:  147 PEKQPP--AEEPVLRAKVTYDYEQQNEDELELKVGDIITIVKKEVFDTPGWMEGELDGKTGLFPDNFVEIL 215          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Medaka
Match: pacsin1b (protein kinase C and casein kinase substrate in neurons protein 1 [Source:NCBI gene;Acc:101158350])

HSP 1 Score: 297.36 bits (760), Expect = 1.132e-94
Identity = 169/481 (35.14%), Postives = 265/481 (55.09%), Query Frame = 3
Query:  162 VNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQEL-HSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDY-VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
             ++FW++  Y +T++R+++ N+LC D+ N IQ+R +IEK+Y+  L +WS +W   ++ G +YG+ ++ W+    EA+++SDLH+D++  LI+     V+NWQ++ +HK  +     KE K  E  F  AQKPWAKKLK++   KK YH  CK  R    +  N+  + S+  EQ KK++EKL K ++DS+K +  Y+ +L EL+    +Y E M +VF + Q  E+ R++F K +   ++  LNL+EN++   +Y++ E TI +  P  D+  +S  +G     + PQFEEY  +L HSI+KK+  +     + LT V  + + +  + GD G         S     +A TPS                                          +D  Q + ++ ++T    +P   D    V+VRALYDY G E+DELT K G+   KLEDEDEQGWCKG+ D G++GLYPANY E +
Sbjct:   14 TDSFWEVGNYKRTVKRIDDGNRLCNDLMNCIQERAKIEKAYAQQLTEWSKRWRQMVDRGPQYGTVERAWMALMTEADKVSDLHQDVKNSLINLDFEKVKNWQKDSYHKQMMG--GFKETKEAEEGFKKAQKPWAKKLKELEAAKKSYHMTCKEERLAVTREANSRAEASVPAEQQKKLQEKLDKCKQDSQKAREKYEKALEELSNSTPQYTESMEQVFEQCQQFEERRLSFIKEVLLDVKHHLNLTENQSYAAVYRDLEQTISSASPQEDLRWFSSSHGPGMHMNWPQFEEYNPDLAHSIAKKE-KIGKGDKIKLTHVTPSVQHS--QGGDRGS-------VSSYEKNQAYTPSTEW---------------------------------------SDEDQMAPNSGSDTNGGSNPFEEDVGRGVRVRALYDYEGQEQDELTFKAGEELTKLEDEDEQGWCKGRLDNGKLGLYPANYVEAI 443          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Medaka
Match: pacsin1b (protein kinase C and casein kinase substrate in neurons protein 1 [Source:NCBI gene;Acc:101158350])

HSP 1 Score: 297.36 bits (760), Expect = 1.132e-94
Identity = 169/481 (35.14%), Postives = 265/481 (55.09%), Query Frame = 3
Query:  162 VNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQEL-HSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDY-VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 1595
             ++FW++  Y +T++R+++ N+LC D+ N IQ+R +IEK+Y+  L +WS +W   ++ G +YG+ ++ W+    EA+++SDLH+D++  LI+     V+NWQ++ +HK  +     KE K  E  F  AQKPWAKKLK++   KK YH  CK  R    +  N+  + S+  EQ KK++EKL K ++DS+K +  Y+ +L EL+    +Y E M +VF + Q  E+ R++F K +   ++  LNL+EN++   +Y++ E TI +  P  D+  +S  +G     + PQFEEY  +L HSI+KK+  +     + LT V  + + +  + GD G         S     +A TPS                                          +D  Q + ++ ++T    +P   D    V+VRALYDY G E+DELT K G+   KLEDEDEQGWCKG+ D G++GLYPANY E +
Sbjct:   14 TDSFWEVGNYKRTVKRIDDGNRLCNDLMNCIQERAKIEKAYAQQLTEWSKRWRQMVDRGPQYGTVERAWMALMTEADKVSDLHQDVKNSLINLDFEKVKNWQKDSYHKQMMG--GFKETKEAEEGFKKAQKPWAKKLKELEAAKKSYHMTCKEERLAVTREANSRAEASVPAEQQKKLQEKLDKCKQDSQKAREKYEKALEELSNSTPQYTESMEQVFEQCQQFEERRLSFIKEVLLDVKHHLNLTENQSYAAVYRDLEQTISSASPQEDLRWFSSSHGPGMHMNWPQFEEYNPDLAHSIAKKE-KIGKGDKIKLTHVTPSVQHS--QGGDRGS-------VSSYEKNQAYTPSTEW---------------------------------------SDEDQMAPNSGSDTNGGSNPFEEDVGRGVRVRALYDYEGQEQDELTFKAGEELTKLEDEDEQGWCKGRLDNGKLGLYPANYVEAI 443          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Medaka
Match: pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:NCBI gene;Acc:101172296])

HSP 1 Score: 280.796 bits (717), Expect = 8.944e-88
Identity = 155/483 (32.09%), Postives = 264/483 (54.66%), Query Frame = 3
Query:  165 NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELH-SISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETE-TPIKESP---VFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGK-KDGRVGLYPANYAEIV 1595
            ++FW++  Y +T++R+++ ++LC+D+   + +R  IEKSY+  L +W  +W   +E G +YGS ++ W   C EAE++S+LH +++ +L+ +    ++NWQ++ +HK  +     KE K  +  F  AQKPWAKKLK++   KK YH  CK  +    +  N+  +++ + E LKK++EK+ K +++ +K K  Y+ SL EL+    +Y+E M +VF + Q  E +R+ FFK +   +++ L+LS N     IY    +TI   D + D+  +   +G   P + PQFE+++ +++ ++S+++       GVTLT +N       +++  T       S+  P+      +  F  +                +  +   +K   S       +  D   N  +A  +  P +E P   V S    V V+ALYDY G E+DEL+ K GD F K+ +ED+QGWCKG+ KDG +GLYPANY E +
Sbjct:   15 DSFWEVGNYKRTVKRVDDGHRLCSDLMTCLHERARIEKSYAQQLTEWGKRWRQLIEKGPQYGSLERAWAALCTEAEKVSELHMEVKAQLMGEDYEKLKNWQKDAYHKQMI--GGFKETKEADDGFRKAQKPWAKKLKEVETMKKTYHAACKEEKLASSRESNSKLESNNNPETLKKLQEKVEKCQQEVQKTKERYEKSLEELDKLTPQYMENMEQVFEQMQQFEDKRICFFKELLLEVKQHLDLSTNHRFQTIYHTLADTITATDVEEDLKWFRFNHGPGMPMNWPQFEDWSIDINRTLSRREKK--KPEGVTLTGINQTGADQPVQAAKT-----SSSLTVPTNTAPVGSNPFEEDEDEEEMAEEPETTVISISVNKEEIKTASSTEKTPDWSDEDTAGNPFAANGDGNPFEEEPASLVIS----VPVKALYDYEGQEQDELSFKAGDEFTKIGEEDDQGWCKGRLKDGHIGLYPANYVEEI 484          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Medaka
Match: pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:NCBI gene;Acc:101172296])

HSP 1 Score: 273.863 bits (699), Expect = 7.387e-85
Identity = 158/497 (31.79%), Postives = 260/497 (52.31%), Query Frame = 3
Query:  165 NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEY-TQELHSISKKK-------LNLT-------NDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETE-TPIKESP---VFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGK-KDGRVGLYPANYAEIV 1595
            ++FW++  Y +T++R+++ ++LC+D+   + +R  IEKSY+  L +W  +W   +E G +YGS ++ W   C EAE++S+LH +++ +L+ +    ++NWQ++ +HK  +     KE K  +  F  AQKPWAKKLK++   KK YH  CK  +    +  N+  +++ + E LKK++EK+ K +++ +K K  Y+ SL EL+    +Y+E M +VF + Q  E +R+ FFK +   +++ L+LS N     IY    +TI   D + D+  +   +G   P + PQFE   +  L S  ++        +N T          GVTLT +N       +++  T       S+  P+      +  F  +                +  +   +K   S       +  D   N  +A  +  P +E P   V S    V V+ALYDY G E+DEL+ K GD F K+ +ED+QGWCKG+ KDG +GLYPANY E +
Sbjct:   15 DSFWEVGNYKRTVKRVDDGHRLCSDLMTCLHERARIEKSYAQQLTEWGKRWRQLIEKGPQYGSLERAWAALCTEAEKVSELHMEVKAQLMGEDYEKLKNWQKDAYHKQMI--GGFKETKEADDGFRKAQKPWAKKLKEVETMKKTYHAACKEEKLASSRESNSKLESNNNPETLKKLQEKVEKCQQEVQKTKERYEKSLEELDKLTPQYMENMEQVFEQMQQFEDKRICFFKELLLEVKQHLDLSTNHRFQTIYHTLADTITATDVEEDLKWFRFNHGPGMPMNWPQFETLDSSHLASFRRRSILDWSIDINRTLSRREKKKPEGVTLTGINQTGADQPVQAAKT-----SSSLTVPTNTAPVGSNPFEEDEDEEEMAEEPETTVISISVNKEEIKTASSTEKTPDWSDEDTAGNPFAANGDGNPFEEEPASLVIS----VPVKALYDYEGQEQDELSFKAGDEFTKIGEEDDQGWCKGRLKDGHIGLYPANYVEEI 500          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Medaka
Match: pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:NCBI gene;Acc:101172296])

HSP 1 Score: 265.774 bits (678), Expect = 1.808e-82
Identity = 156/483 (32.30%), Postives = 260/483 (53.83%), Query Frame = 3
Query:  165 NTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELH-SISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETE-TPIKESP---VFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGK-KDGRVGLYPANYAEIV 1595
            ++FW++  Y +T++R+++ ++LC+D+   + +R  IEKSY+  L +W  +W   +E G +YGS ++ W   C EAE++S+LH +++ +L+ +    ++NWQ++ +HK  +     KE K  +  F  AQKPWAKKLK++   KK YH  CK  +    +  N+  +++ + E LKK++EK+ K +++ +K K  Y+ SL EL+    +Y+E M +VF + Q  E +R+ FFK +   +++ L+LS N     IY    +TI   D + D+  +   +G   P + PQFE+++ +++ ++S+++       GVTLT +N                            T A  P   ++ +   S+++     PD  D                    D   N  +A  +  P +E P   V S    V V+ALYDY G E+DEL+ K GD F K+ +ED+QGWCKG+ KDG +GLYPANY E +
Sbjct:   15 DSFWEVGNYKRTVKRVDDGHRLCSDLMTCLHERARIEKSYAQQLTEWGKRWRQLIEKGPQYGSLERAWAALCTEAEKVSELHMEVKAQLMGEDYEKLKNWQKDAYHKQMIG--GFKETKEADDGFRKAQKPWAKKLKEVETMKKTYHAACKEEKLASSRESNSKLESNNNPETLKKLQEKVEKCQQEVQKTKERYEKSLEELDKLTPQYMENMEQVFEQMQQFEDKRICFFKELLLEVKQHLDLSTNHRFQTIYHTLADTITATDVEEDLKWFRFNHGPGMPMNWPQFEDWSIDINRTLSRREKK--KPEGVTLTGINQ---------------------------TGADQP---VQAAKTSSSASSTEKTPDWSDE-------------------DTAGNPFAANGDGNPFEEEPASLVIS----VPVKALYDYEGQEQDELSFKAGDEFTKIGEEDDQGWCKGRLKDGHIGLYPANYVEEI 440          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Planmine SMEST
Match: SMESG000054559.1 (SMESG000054559.1)

HSP 1 Score: 1026.16 bits (2652), Expect = 0.000e+0
Identity = 492/494 (99.60%), Postives = 492/494 (99.60%), Query Frame = 3
Query:  114 MSNSFEFEGETSNSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 1595
            MSNSFEFEGETSNSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEY QELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDS GKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV
Sbjct:    1 MSNSFEFEGETSNSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYIQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSTGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 494          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Planmine SMEST
Match: SMESG000054559.1 (SMESG000054559.1)

HSP 1 Score: 915.605 bits (2365), Expect = 0.000e+0
Identity = 448/494 (90.69%), Postives = 448/494 (90.69%), Query Frame = 3
Query:  114 MSNSFEFEGETSNSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 1595
            MSNSFEFEGETSNSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEY QELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDS GKSMASPSTGTEASTPSFNMETSSPLSTSALR                                            ESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV
Sbjct:    1 MSNSFEFEGETSNSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYIQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRDSTGKSMASPSTGTEASTPSFNMETSSPLSTSALR--------------------------------------------ESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 450          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Planmine SMEST
Match: SMESG000056577.1 (SMESG000056577.1)

HSP 1 Score: 379.793 bits (974), Expect = 7.407e-127
Identity = 208/472 (44.07%), Postives = 290/472 (61.44%), Query Frame = 3
Query:  183 KQYVKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGD-TGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 1595
            KQY++TI+RLEN+ KLC D+  MI +R EIEK YSSSL KW+ KW  YL+SG EYG+ K  W   C E+ EI+DLH  +RT+LID+ Q +++ WQ++H+HK  +P Q  KE KSLE+EF+  QKPWAKKLKK    KK+Y   CK  +S ++Q +NA ND++++ +Q+KK+EEK RK+EK+ EK K  Y +SLN+L G+  RY+E+M K F K+Q+ME+ER+ +FK  F  I+ ILNLS+   L +IY++ +  I  ++ + D+  WS   G+   F  PQFEEYT EL  IS K+  + N  GV L  V       SI +   +  D   +S+   S   +   PS++ E  +P S +    +E   + SA P           S+T  D++                       V+VRALYDY   EEDELTL  G++F KL +EDEQGWC G++DG VGLYPANYA+ +
Sbjct:    3 KQYMRTIKRLENSYKLCQDLMTMISERAEIEKHYSSSLKKWNGKWMGYLDSGAEYGTAKHGWQSLCTESLEIADLHAIIRTQLIDESQPEIKKWQKDHYHKPAIPTQQFKEVKSLETEFETNQKPWAKKLKKSIIMKKDYFAACKQEKSSNLQLQNAKNDSTVNPDQIKKIEEKYRKAEKEVEKTKASYQASLNDLEGESGRYMEDMEKTFKKAQSMEQERIEYFKETFENIRMILNLSKTDKLHEIYEHCKLGISEMNSEVDLKNWSMTNGSAMVFMIPQFEEYTPELSGISNKRKAVLN-PGVVLKGV------TSIDNDKMSNNDKSNESLNEASKYVDKRLPSYD-EAMNPFSANEENGVE--FKISADPY---------DSITEIDNKPG---------------------VKVRALYDYNSQEEDELTLVAGEIFEKLTEEDEQGWCTGRRDGVVGLYPANYADPI 434          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Planmine SMEST
Match: SMESG000056577.1 (SMESG000056577.1)

HSP 1 Score: 373.629 bits (958), Expect = 1.650e-124
Identity = 205/469 (43.71%), Postives = 287/469 (61.19%), Query Frame = 3
Query:  192 VKTIRRLENANKLCTDICNMIQDRVEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHKDMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWAKKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRKSEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKSMFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPFSTPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGD-TGRDSMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPCRSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 1595
            ++TI+RLEN+ KLC D+  MI +R EIEK YSSSL KW+ KW  YL+SG EYG+ K  W   C E+ EI+DLH  +RT+LID+ Q +++ WQ++H+HK  +P Q  KE KSLE+EF+  QKPWAKKLKK    KK+Y   CK  +S ++Q +NA ND++++ +Q+KK+EEK RK+EK+ EK K  Y +SLN+L G+  RY+E+M K F K+Q+ME+ER+ +FK  F  I+ ILNLS+   L +IY++ +  I  ++ + D+  WS   G+   F  PQFEEYT EL  IS K+  + N  GV L  V       SI +   +  D   +S+   S   +   PS++ E  +P S +    +E   + SA P           S+T  D++                       V+VRALYDY   EEDELTL  G++F KL +EDEQGWC G++DG VGLYPANYA+ +
Sbjct:    1 MRTIKRLENSYKLCQDLMTMISERAEIEKHYSSSLKKWNGKWMGYLDSGAEYGTAKHGWQSLCTESLEIADLHAIIRTQLIDESQPEIKKWQKDHYHKPAIPTQQFKEVKSLETEFETNQKPWAKKLKKSIIMKKDYFAACKQEKSSNLQLQNAKNDSTVNPDQIKKIEEKYRKAEKEVEKTKASYQASLNDLEGESGRYMEDMEKTFKKAQSMEQERIEYFKETFENIRMILNLSKTDKLHEIYEHCKLGISEMNSEVDLKNWSMTNGSAMVFMIPQFEEYTPELSGISNKRKAVLN-PGVVLKGV------TSIDNDKMSNNDKSNESLNEASKYVDKRLPSYD-EAMNPFSANEENGVE--FKISADPY---------DSITEIDNKPG---------------------VKVRALYDYNSQEEDELTLVAGEIFEKLTEEDEQGWCTGRRDGVVGLYPANYADPI 429          
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Planmine SMEST
Match: SMESG000004952.1 (SMESG000004952.1)

HSP 1 Score: 48.521 bits (114), Expect = 3.206e-6
Identity = 21/51 (41.18%), Postives = 30/51 (58.82%), Query Frame = 3
Query: 1434 VRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYA 1586
            VRA+Y Y     DEL+ ++GDL Y  +    Q W K + +G+ GL P+NY 
Sbjct:   17 VRAIYSYEAQSADELSFEEGDLLYIFDMISSQDWWKARANGKEGLIPSNYV 67          
The following BLAST results are available for this feature:
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PACSIN12.034e-8831.85protein kinase C and casein kinase substrate in ne... [more]
PACSIN12.034e-8831.85protein kinase C and casein kinase substrate in ne... [more]
PACSIN12.034e-8831.85protein kinase C and casein kinase substrate in ne... [more]
PACSIN25.585e-8833.88protein kinase C and casein kinase substrate in ne... [more]
PACSIN25.585e-8833.88protein kinase C and casein kinase substrate in ne... [more]
back to top
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sdpn-11.992e-5628.28SynDaPiN (Synaptic dynamin binding protein) homolo... [more]
sdpn-11.992e-5628.28SynDaPiN (Synaptic dynamin binding protein) homolo... [more]
sdpn-13.667e-5628.28SynDaPiN (Synaptic dynamin binding protein) homolo... [more]
abi-11.891e-745.45ABl Interactor homolog [Source:UniProtKB/TrEMBL;A... [more]
abi-11.891e-745.45ABl Interactor homolog [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Synd1.186e-10236.49gene:FBgn0053094 transcript:FBtr0334725[more]
Synd1.186e-10236.49gene:FBgn0053094 transcript:FBtr0334724[more]
Synd1.750e-10136.16gene:FBgn0053094 transcript:FBtr0083966[more]
Abp15.164e-846.43gene:FBgn0036372 transcript:FBtr0075819[more]
Abi1.260e-641.51gene:FBgn0020510 transcript:FBtr0307076[more]
back to top
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pacsin1b5.279e-9835.48protein kinase C and casein kinase substrate in ne... [more]
pacsin1b5.279e-9835.48protein kinase C and casein kinase substrate in ne... [more]
pacsin1b5.279e-9835.48protein kinase C and casein kinase substrate in ne... [more]
pacsin26.243e-8933.82protein kinase C and casein kinase substrate in ne... [more]
pacsin29.825e-8934.17protein kinase C and casein kinase substrate in ne... [more]
back to top
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pacsin29.056e-9334.55protein kinase C and casein kinase substrate in ne... [more]
pacsin21.127e-9234.01protein kinase C and casein kinase substrate in ne... [more]
sult6b1.46.922e-8834.38sulfotransferase family 6B member 1 gene 4 [Source... [more]
PACSIN11.631e-8733.89protein kinase C and casein kinase substrate in ne... [more]
sult6b1.47.070e-8633.68sulfotransferase family 6B member 1 gene 4 [Source... [more]
back to top
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pacsin22.632e-9233.67protein kinase C and casein kinase substrate in ne... [more]
Pacsin22.632e-9233.67protein kinase C and casein kinase substrate in ne... [more]
Pacsin22.632e-9233.67protein kinase C and casein kinase substrate in ne... [more]
Pacsin22.632e-9233.67protein kinase C and casein kinase substrate in ne... [more]
Pacsin22.632e-9233.67protein kinase C and casein kinase substrate in ne... [more]
back to top
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q07840|EM13_ECHMU1.888e-10640.13Antigen EM13 OS=Echinococcus multilocularis OX=621... [more]
sp|Q07839|EG13_ECHGR7.438e-10238.29Antigen EG13 OS=Echinococcus granulosus OX=6210 GN... [more]
sp|Q4V920|PACN1_DANRE3.985e-9735.48Protein kinase C and casein kinase substrate in ne... [more]
sp|Q9WVE8|PACN2_MOUSE1.841e-9133.67Protein kinase C and casein kinase substrate in ne... [more]
sp|Q9DDA9|PACN2_XENLA4.322e-9133.27Protein kinase C and casein kinase substrate in ne... [more]
back to top
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4V9S36.158e-13141.62Putative membrane traffic protein OS=Schistosoma m... [more]
A0A504YA413.000e-12840.78Adaptor protein pacsin OS=Fasciola gigantica OX=46... [more]
A0A4E0RQB91.638e-12740.57Adaptor protein pacsin OS=Fasciola hepatica OX=619... [more]
A0A430QRV44.163e-12640.45Protein kinase C and casein kinase substrate in ne... [more]
A0A564XWN11.321e-12140.37Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pacsin1b1.733e-9334.44protein kinase C and casein kinase substrate in ne... [more]
pacsin1b1.733e-9334.44protein kinase C and casein kinase substrate in ne... [more]
pacsin28.200e-9333.47protein kinase C and casein kinase substrate in ne... [more]
pacsin21.106e-8832.42protein kinase C and casein kinase substrate in ne... [more]
pacsin26.130e-8532.73protein kinase C and casein kinase substrate in ne... [more]
back to top
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pacsin31.693e-4435.63protein kinase C and casein kinase substrate in ne... [more]
ENSPMAT00000000643.12.175e-4137.69pep scaffold:Pmarinus_7.0:GL477040:74682:76763:1 g... [more]
ABI13.482e-835.38abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:1132... [more]
ABI14.330e-836.92abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:1132... [more]
DBNL5.144e-740.74drebrin like [Source:HGNC Symbol;Acc:HGNC:2696][more]
back to top
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
LSB31.579e-741.51Protein containing a C-terminal SH3 domain; binds ... [more]
LSB14.895e-638.60Negative regulator of actin nucleation-promoting f... [more]
YSC846.105e-636.54Actin-binding protein; involved in bundling of act... [more]
back to top
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO426892.499e-7130.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419402.601e-5533.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438725.753e-1321.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348086.684e-1320.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387101.623e-739.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pacsin1b1.132e-9435.14protein kinase C and casein kinase substrate in ne... [more]
pacsin1b1.132e-9435.14protein kinase C and casein kinase substrate in ne... [more]
pacsin28.944e-8832.09protein kinase C and casein kinase substrate in ne... [more]
pacsin27.387e-8531.79protein kinase C and casein kinase substrate in ne... [more]
pacsin21.808e-8232.30protein kinase C and casein kinase substrate in ne... [more]
back to top
BLAST of Protein kinase C and casein kinase substrate in neurons protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054559.10.000e+099.60SMESG000054559.1[more]
SMESG000054559.10.000e+090.69SMESG000054559.1[more]
SMESG000056577.17.407e-12744.07SMESG000056577.1[more]
SMESG000056577.11.650e-12443.71SMESG000056577.1[more]
SMESG000004952.13.206e-641.18SMESG000004952.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030763 ID=SMED30030763|Name=Protein kinase C and casein kinase substrate in neurons protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1730bp
CATCAATTCAACTTCGAATTTATGTTAAAATTGTATAATCTAATTTACTA
TATATTCAAAATTTTCTTTTTCTTATAATCCAAATTATAATATGATTTGT
AGTTCTATCAAAAATGTCGAATAGTTTTGAATTTGAAGGCGAAACAAGTA
ATTCAGCTGGCGTCAATACGTTTTGGGATCTCAAGCAATATGTTAAAACA
ATAAGACGATTAGAAAATGCCAATAAGTTATGCACAGATATTTGTAACAT
GATTCAAGATCGAGTTGAAATTGAAAAAAGCTATTCATCAAGTTTACACA
AATGGAGCACAAAATGGACATCGTATTTGGAAAGTGGGATAGAATATGGA
AGCACTAAGCAATGCTGGTTAGGGTTCTGTCGGGAAGCCGAAGAAATATC
TGACTTGCATAAAGACATGCGTACACGGTTGATTGATGACATTCAGACAG
ATGTGAGAAACTGGCAAAGGGAACATTTTCATAAATCGACATTACCGCCA
CAAAATTTGAAAGAAGCAAAATCCCTGGAATCTGAATTTGATATAGCTCA
AAAGCCTTGGGCAAAAAAATTAAAGAAAATGAACCAATGCAAAAAAGAGT
ATCACCAACAATGCAAAATGGTTCGATCGTATGATGTACAGAATAAAAAC
GCAGTTAATGATACCAGTATTTCTCAGGAACAGTTGAAAAAAATGGAAGA
AAAGTTGAGAAAATCAGAAAAGGATTCGGAAAAATTAAAGAATTTGTATG
ATTCTTCTTTGAACGAACTCAACGGCGATTGCAATCGATATGTAGAAGAA
ATGACAAAAGTATTTAACAAATCCCAGGCGATGGAGAAAGAAAGAATGGC
GTTTTTCAAATCAATGTTTTCCAGAATACAAAAAATTCTCAATTTATCAG
AAAATAAAAATCTTACAGATATATATCAAAATTTTGAAAATACTATTCAA
ACCCTTGATCCAGATTCAGATATTGCGCAATGGTCACAGCTATATGGGGC
CGATTTTCCATTTTCAACCCCTCAATTTGAAGAATATACTCAAGAACTTC
ATAGTATTTCAAAAAAGAAGCTCAATTTAACAAATGATTCTGGTGTGACA
TTAACGGCAGTTAATATGAATTCCCGGCAAGCTAGTATTCGATCTGGAGA
TACTGGTCGTGATTCTATGGGTAAATCCATGGCTAGCCCATCGACTGGCA
CTGAGGCATCAACTCCTTCTTTTAATATGGAAACGTCCTCTCCACTTTCA
ACATCAGCTCTAAGGAGGCTTGAACCTGATTTAGAGGATTCTGCACCACC
GATGAAGCCTTGTCGTTCTATCAGTAGTAATAAAAGTGTTACACGTAATG
ATCATCGCCAAAATTCCATTTCTGCTGAAACAGAAACCCCCATCAAAGAA
TCTCCCGTGTTTTCCGATGAAGACTATGTGCAAGTTCGAGCACTTTATGA
CTATATCGGTGTTGAAGAAGACGAATTGACTTTGAAACAAGGTGATCTAT
TCTATAAGCTTGAAGATGAAGACGAGCAAGGTTGGTGCAAAGGCAAAAAA
GACGGTAGGGTCGGTCTATATCCAGCGAATTATGCGGAAATAGTTTAAAT
TCTTGTTAAACAAGTCATTATTTTTTAGTTTTTGTTATTTAACACATTTT
TGTTGAACTTCTATTACTGAATTGACTCTATCTCTCTTGTATATATATAA
AATAGAGTAGTAAGACGTGTATTATTTAGC
back to top

protein sequence of SMED30030763-orf-1

>SMED30030763-orf-1 ID=SMED30030763-orf-1|Name=SMED30030763-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=495bp
MSNSFEFEGETSNSAGVNTFWDLKQYVKTIRRLENANKLCTDICNMIQDR
VEIEKSYSSSLHKWSTKWTSYLESGIEYGSTKQCWLGFCREAEEISDLHK
DMRTRLIDDIQTDVRNWQREHFHKSTLPPQNLKEAKSLESEFDIAQKPWA
KKLKKMNQCKKEYHQQCKMVRSYDVQNKNAVNDTSISQEQLKKMEEKLRK
SEKDSEKLKNLYDSSLNELNGDCNRYVEEMTKVFNKSQAMEKERMAFFKS
MFSRIQKILNLSENKNLTDIYQNFENTIQTLDPDSDIAQWSQLYGADFPF
STPQFEEYTQELHSISKKKLNLTNDSGVTLTAVNMNSRQASIRSGDTGRD
SMGKSMASPSTGTEASTPSFNMETSSPLSTSALRRLEPDLEDSAPPMKPC
RSISSNKSVTRNDHRQNSISAETETPIKESPVFSDEDYVQVRALYDYIGV
EEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR027267AH/BAR_dom_sf
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
IPR001060FCH_dom
IPR031160F_BAR
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 184..218
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 437..494
e-value: 7.8E-19
score: 69.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 334..382
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 334..429
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 399..427
NoneNo IPR availablePANTHERPTHR23065:SF11SYNDAPIN, ISOFORM Ccoord: 14..492
NoneNo IPR availablePANTHERPTHR23065PROLINE-SERINE-THREONINE PHOSPHATASE INTERACTING PROTEIN 1coord: 14..492
NoneNo IPR availableCDDcd11843SH3_PACSINcoord: 441..492
e-value: 2.90647E-28
score: 104.424
IPR001452SH3 domainPRINTSPR00452SH3DOMAINcoord: 453..468
score: 31.74
coord: 482..494
score: 37.02
coord: 439..449
score: 43.62
IPR001452SH3 domainSMARTSM00326SH3_2coord: 439..494
e-value: 5.1E-15
score: 65.9
IPR001452SH3 domainPFAMPF14604SH3_9coord: 443..492
e-value: 3.3E-14
score: 52.5
IPR001452SH3 domainPROSITEPS50002SH3coord: 436..494
score: 25.446
IPR001060FCH domainSMARTSM00055fch_2coord: 18..106
e-value: 1.5E-10
score: 51.1
IPR001060FCH domainPFAMPF00611FCHcoord: 26..100
e-value: 5.4E-12
score: 45.8
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 8..296
e-value: 2.3E-68
score: 232.6
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 18..308
IPR031160F-BAR domainPROSITEPS51741F_BARcoord: 11..286
score: 30.589
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 433..493