Component of oligomeric golgi complex 5

Overview
NameComponent of oligomeric golgi complex 5
Smed IDSMED30030735
Length (bp)2564
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Component of oligomeric golgi complex 5 (SMED30030735) t-SNE clustered cells

Violin plots show distribution of expression levels for Component of oligomeric golgi complex 5 (SMED30030735) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Component of oligomeric golgi complex 5 (SMED30030735) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Component of oligomeric golgi complex 5 (SMED30030735) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030735

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30030735SMESG000034878.1 dd_Smed_v4_4852_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030735SMESG000034878.1 dd_Smed_v4_4852_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30030735SMESG000034878.1 dd_Smed_v4_4852_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Human
Match: COG5 (component of oligomeric golgi complex 5 [Source:HGNC Symbol;Acc:HGNC:14857])

HSP 1 Score: 409.838 bits (1052), Expect = 2.912e-129
Identity = 264/830 (31.81%), Postives = 422/830 (50.84%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKDDVNRN-----YVELDNMKFN--------------QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLS-----NIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESAL 2478
            +F ++D D  +  +  + Q  + + L ++   I+ L+ +L   V+A+H+DL++ A GIE LEGVL+MM  R   L+   D+I+ K+ EP+N +  R  QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L D++  +V      +C  L++ +N  L I+   + + + + G    PGR+ +PT    A+ RASFWT ++KL++ + +    V  L K L  KRD +S  C I                     E I   G     Y  W  ++  LS  F   +A++ S FLK+  E EYPKLL+L+ DL  +L  ++   + + N +     YV+L +M+ +              +K  K  L  +E A+LS SLS+LFD +   F    +  PS D+++  +K I++EL +A+VD++L     KN+ K I +   K EQ +ST  +++Q+IGP    Q+ N  ++N ++K   ++   +  Q     + +  +   L     L    +QPL+ ++   +E II T+H E F  S       +   SL M EL GFI R    YF      D +    + I  +  E+++ H +LIRP  + G  +L  D  Q E+A+  FC R   VS+   +  YR LR  + +L Q    +  +  + D     V+P S ++  LF+R+P+ELKSP     WS  R+  WL  HPSE DRL  I+GAL+AY   +R +E K +A +Y  M+ +L+ A+
Sbjct:   67 DFLNEDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDRELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQGAVDRIKAKIVEPYNKIVARTAQLARLQVACDLLRRIIRILNLSKRLQGQLQGGSREITKAAQSLNELDYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQGLETQNPTQVGTALQVFYNLGTLKDTITSVVDG----YCATLEENINSALDIKVLTQPSQSAVRGG---PGRSTMPTPGNTAALRASFWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVSHICFI---------------------EEIVKDGQPEIFYTFWNSVTQALSSQFH--MATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQHIQGNFNASGTTDLYVDLQHMEDDAQDIFIPKKPDYDPEKALKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSSDELDGIIKTIASELNVAAVDTNLTLAVSKNVAKTIQLYSVKSEQLLSTQGDASQVIGPLTEGQRRNVAVVNSLYKLHQSVTKVVSSQSSFPLAAEQTIISALKAIHALMENAVQPLLTSVGDAIEAIIITMHQEDFSGSLSSSGKPDVPCSLYMKELQGFIARVMSDYFKHFECLDFVFDNTEAIAQRAVELFIRHASLIRPLGEGGKMRLAADFAQMELAVGPFCRR---VSDLGKS--YRMLRSFRPLLFQASEHVASSPALGD-----VIPFSIIIQFLFTRAPAELKSPFQRAEWSHTRFSQWLDDHPSEKDRLLLIRGALEAYVQSVRSREGKEFAPVYPIMVQLLQKAM 856          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Human
Match: COG5 (component of oligomeric golgi complex 5 [Source:HGNC Symbol;Acc:HGNC:14857])

HSP 1 Score: 407.527 bits (1046), Expect = 2.047e-128
Identity = 263/830 (31.69%), Postives = 421/830 (50.72%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKDDVNRN-----YVELDNMKFN--------------QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLS-----NIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESAL 2478
            +F ++D D  +  +  + Q  + + L ++   I+ L+ +L   V+A+H+DL++ A GIE LEGVL+MM  R   L+   D+I+ K+ EP+N +  R  QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L D++  +V      +C  L++ +N  L I+   + + + + G    PGR+ +PT    A+ RAS WT ++KL++ + +    V  L K L  KRD +S  C I                     E I   G     Y  W  ++  LS  F   +A++ S FLK+  E EYPKLL+L+ DL  +L  ++   + + N +     YV+L +M+ +              +K  K  L  +E A+LS SLS+LFD +   F    +  PS D+++  +K I++EL +A+VD++L     KN+ K I +   K EQ +ST  +++Q+IGP    Q+ N  ++N ++K   ++   +  Q     + +  +   L     L    +QPL+ ++   +E II T+H E F  S       +   SL M EL GFI R    YF      D +    + I  +  E+++ H +LIRP  + G  +L  D  Q E+A+  FC R   VS+   +  YR LR  + +L Q    +  +  + D     V+P S ++  LF+R+P+ELKSP     WS  R+  WL  HPSE DRL  I+GAL+AY   +R +E K +A +Y  M+ +L+ A+
Sbjct:   67 DFLNEDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDRELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQGAVDRIKAKIVEPYNKIVARTAQLARLQVACDLLRRIIRILNLSKRLQGQLQGGSREITKAAQSLNELDYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQGLETQNPTQVGTALQVFYNLGTLKDTITSVVDG----YCATLEENINSALDIKVLTQPSQSAVRGG---PGRSTMPTPGNTAALRASLWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVSHICFI---------------------EEIVKDGQPEIFYTFWNSVTQALSSQFH--MATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQHIQGNFNASGTTDLYVDLQHMEDDAQDIFIPKKPDYDPEKALKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSSDELDGIIKTIASELNVAAVDTNLTLAVSKNVAKTIQLYSVKSEQLLSTQGDASQVIGPLTEGQRRNVAVVNSLYKLHQSVTKVVSSQSSFPLAAEQTIISALKAIHALMENAVQPLLTSVGDAIEAIIITMHQEDFSGSLSSSGKPDVPCSLYMKELQGFIARVMSDYFKHFECLDFVFDNTEAIAQRAVELFIRHASLIRPLGEGGKMRLAADFAQMELAVGPFCRR---VSDLGKS--YRMLRSFRPLLFQASEHVASSPALGD-----VIPFSIIIQFLFTRAPAELKSPFQRAEWSHTRFSQWLDDHPSEKDRLLLIRGALEAYVQSVRSREGKEFAPVYPIMVQLLQKAM 856          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Human
Match: COG5 (component of oligomeric golgi complex 5 [Source:HGNC Symbol;Acc:HGNC:14857])

HSP 1 Score: 403.675 bits (1036), Expect = 3.640e-127
Identity = 264/830 (31.81%), Postives = 419/830 (50.48%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKDDVNRN-----YVELDNMKFN--------------QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLS-----NIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESAL 2478
            +F ++D D  +  +  + Q  + + L ++   I+ L+ +L   V+A+H+DL++ A GIE LEGVL+MM  R   L+   D+I+ K+ EP+N +  R  QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L D++  +V      +C  L++ +N  L I+   + + + + G    PGR+ +PT    A+ RASFWT ++KL++ + +    V  L K L  KRD +S  C I                     E I   G     Y  W  ++  LS  F   +A++ S FLK+  E EYPKLL+L+ DL  +L  ++   + + N +     YV+L +M+ +              +K  K  L  +E A+LS SLS+LFD +   F    +  PS D+++  +K I++EL +A+VD++L     KN+ K I +   K EQ +ST  +++Q+IGP    Q+ N  ++N ++K   ++  +I                   H   L    +QPL+ ++   +E II T+H E F  S       +   SL M EL GFI R    YF      D +    + I  +  E+++ H +LIRP  + G  +L  D  Q E+A+  FC R   VS+   +  YR LR  + +L Q    +  +  + D     V+P S ++  LF+R+P+ELKSP     WS  R+  WL  HPSE DRL  I+GAL+AY   +R +E K +A +Y  M+ +L+ A+
Sbjct:   67 DFLNEDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDRELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQGAVDRIKAKIVEPYNKIVARTAQLARLQVACDLLRRIIRILNLSKRLQGQLQGGSREITKAAQSLNELDYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQGLETQNPTQVGTALQVFYNLGTLKDTITSVVDG----YCATLEENINSALDIKVLTQPSQSAVRGG---PGRSTMPTPGNTAALRASFWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVSHICFI---------------------EEIVKDGQPEIFYTFWNSVTQALSSQFH--MATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQHIQGNFNASGTTDLYVDLQHMEDDAQDIFIPKKPDYDPEKALKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSSDELDGIIKTIASELNVAAVDTNLTLAVSKNVAKTIQLYSVKSEQLLSTQGDASQVIGPLTEGQRRNVAVVNSLYKLHQSVTKAI-------------------HA--LMENAVQPLLTSVGDAIEAIIITMHQEDFSGSLSSSGKPDVPCSLYMKELQGFIARVMSDYFKHFECLDFVFDNTEAIAQRAVELFIRHASLIRPLGEGGKMRLAADFAQMELAVGPFCRR---VSDLGKS--YRMLRSFRPLLFQASEHVASSPALGD-----VIPFSIIIQFLFTRAPAELKSPFQRAEWSHTRFSQWLDDHPSEKDRLLLIRGALEAYVQSVRSREGKEFAPVYPIMVQLLQKAM 835          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Human
Match: COG5 (component of oligomeric golgi complex 5 [Source:HGNC Symbol;Acc:HGNC:14857])

HSP 1 Score: 401.364 bits (1030), Expect = 2.965e-126
Identity = 263/830 (31.69%), Postives = 418/830 (50.36%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKDDVNRN-----YVELDNMKFN--------------QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLS-----NIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESAL 2478
            +F ++D D  +  +  + Q  + + L ++   I+ L+ +L   V+A+H+DL++ A GIE LEGVL+MM  R   L+   D+I+ K+ EP+N +  R  QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L D++  +V      +C  L++ +N  L I+   + + + + G    PGR+ +PT    A+ RAS WT ++KL++ + +    V  L K L  KRD +S  C I                     E I   G     Y  W  ++  LS  F   +A++ S FLK+  E EYPKLL+L+ DL  +L  ++   + + N +     YV+L +M+ +              +K  K  L  +E A+LS SLS+LFD +   F    +  PS D+++  +K I++EL +A+VD++L     KN+ K I +   K EQ +ST  +++Q+IGP    Q+ N  ++N ++K   ++  +I                   H   L    +QPL+ ++   +E II T+H E F  S       +   SL M EL GFI R    YF      D +    + I  +  E+++ H +LIRP  + G  +L  D  Q E+A+  FC R   VS+   +  YR LR  + +L Q    +  +  + D     V+P S ++  LF+R+P+ELKSP     WS  R+  WL  HPSE DRL  I+GAL+AY   +R +E K +A +Y  M+ +L+ A+
Sbjct:   67 DFLNEDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDRELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQGAVDRIKAKIVEPYNKIVARTAQLARLQVACDLLRRIIRILNLSKRLQGQLQGGSREITKAAQSLNELDYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQGLETQNPTQVGTALQVFYNLGTLKDTITSVVDG----YCATLEENINSALDIKVLTQPSQSAVRGG---PGRSTMPTPGNTAALRASLWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVSHICFI---------------------EEIVKDGQPEIFYTFWNSVTQALSSQFH--MATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQHIQGNFNASGTTDLYVDLQHMEDDAQDIFIPKKPDYDPEKALKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSSDELDGIIKTIASELNVAAVDTNLTLAVSKNVAKTIQLYSVKSEQLLSTQGDASQVIGPLTEGQRRNVAVVNSLYKLHQSVTKAI-------------------HA--LMENAVQPLLTSVGDAIEAIIITMHQEDFSGSLSSSGKPDVPCSLYMKELQGFIARVMSDYFKHFECLDFVFDNTEAIAQRAVELFIRHASLIRPLGEGGKMRLAADFAQMELAVGPFCRR---VSDLGKS--YRMLRSFRPLLFQASEHVASSPALGD-----VIPFSIIIQFLFTRAPAELKSPFQRAEWSHTRFSQWLDDHPSEKDRLLLIRGALEAYVQSVRSREGKEFAPVYPIMVQLLQKAM 835          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Human
Match: COG5 (component of oligomeric golgi complex 5 [Source:HGNC Symbol;Acc:HGNC:14857])

HSP 1 Score: 380.948 bits (977), Expect = 1.055e-118
Identity = 251/797 (31.49%), Postives = 400/797 (50.19%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKDDVNRN-----YVELDNMKFN--------------QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLS-----NIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIK 2379
            +F ++D D  +  +  + Q  + + L ++   I+ L+ +L   V+A+H+DL++ A GIE LEGVL+MM  R   L+   D+I+ K+ EP+N +  R  QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L D++  +V      +C  L++ +N  L I+   + + + + G    PGR+ +PT    A+ RASFWT ++KL++ + +    V  L K L  KRD +S  C I                     E I   G     Y  W  ++  LS  F   +A++ S FLK+  E EYPKLL+L+ DL  +L  ++   + + N +     YV+L +M+ +              +K  K  L  +E A+LS SLS+LFD +   F    +  PS D+++  +K I++EL +A+VD++L     KN+ K I +   K EQ +ST  +++Q+IGP    Q+ N  ++N ++K   ++   +  Q     + +  +   L     L    +QPL+ ++   +E II T+H E F  S       +   SL M EL GFI R    YF      D +    + I  +  E+++ H +LIRP  + G  +L  D  Q E+A+  FC R   VS+   +  YR LR  + +L Q    +  +  + D     V+P S ++  LF+R+P+ELKSP     WS  R+  WL  HPSE DRL  I+
Sbjct:   67 DFLNEDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDRELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQGAVDRIKAKIVEPYNKIVARTAQLARLQVACDLLRRIIRILNLSKRLQGQLQGGSREITKAAQSLNELDYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQGLETQNPTQVGTALQVFYNLGTLKDTITSVVDG----YCATLEENINSALDIKVLTQPSQSAVRGG---PGRSTMPTPGNTAALRASFWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVSHICFI---------------------EEIVKDGQPEIFYTFWNSVTQALSSQFH--MATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQHIQGNFNASGTTDLYVDLQHMEDDAQDIFIPKKPDYDPEKALKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSSDELDGIIKTIASELNVAAVDTNLTLAVSKNVAKTIQLYSVKSEQLLSTQGDASQVIGPLTEGQRRNVAVVNSLYKLHQSVTKVVSSQSSFPLAAEQTIISALKAIHALMENAVQPLLTSVGDAIEAIIITMHQEDFSGSLSSSGKPDVPCSLYMKELQGFIARVMSDYFKHFECLDFVFDNTEAIAQRAVELFIRHASLIRPLGEGGKMRLAADFAQMELAVGPFCRR---VSDLGKS--YRMLRSFRPLLFQASEHVASSPALGD-----VIPFSIIIQFLFTRAPAELKSPFQRAEWSHTRFSQWLDDHPSEKDRLLLIR 823          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Celegans
Match: cogc-5 (Conserved Oligomeric Golgi (COG) Component [Source:UniProtKB/TrEMBL;Acc:P91151])

HSP 1 Score: 49.6766 bits (117), Expect = 8.813e-6
Identity = 26/79 (32.91%), Postives = 48/79 (60.76%), Query Frame = 1
Query: 2239 SYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESA 2475
            S ++  L S SPSEL  P+ S+ W+   YV W  +H +E + L F+ G + +Y + +  + Q+HY + Y +++ +L++A
Sbjct:  578 SILIQLLVSDSPSELPLPNQSVKWTPEEYVKWYEEH-TELEVLAFLNGLVSSYNSSVISRGQQHYVDHYPRIVKLLQNA 655          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Celegans
Match: cogc-5 (Conserved Oligomeric Golgi (COG) Component [Source:UniProtKB/TrEMBL;Acc:P91151])

HSP 1 Score: 49.6766 bits (117), Expect = 8.813e-6
Identity = 26/79 (32.91%), Postives = 48/79 (60.76%), Query Frame = 1
Query: 2239 SYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESA 2475
            S ++  L S SPSEL  P+ S+ W+   YV W  +H +E + L F+ G + +Y + +  + Q+HY + Y +++ +L++A
Sbjct:  578 SILIQLLVSDSPSELPLPNQSVKWTPEEYVKWYEEH-TELEVLAFLNGLVSSYNSSVISRGQQHYVDHYPRIVKLLQNA 655          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Fly
Match: fws (gene:FBgn0024689 transcript:FBtr0346626)

HSP 1 Score: 121.709 bits (304), Expect = 4.554e-28
Identity = 96/362 (26.52%), Postives = 177/362 (48.90%), Query Frame = 1
Query: 1417 LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSI----IRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLSN--IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMD-NAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALK 2481
            LP ++ ++NF++  STEL+ A +DS L              +CTK E  I   ++S Q++   N  Q+ N  + N++  +K ++   +    +   +   + + I+   L+    L  T++Q +M++I  T+  I+ ++H E    S     T  S+ M EL  F+ R+   +    +D+ +      E+  +  E++L ++ ++RP +  G Q+L  D +  E A++  C       N  +     R LR +  +++Q    +V+  Q I +   +++P+  VL  LF  + ++L+SPH +  WS  R + WL  H +E ++L  I GAL  Y +  R K  + Y E+Y  M+   E ALK
Sbjct:  397 LPGNETVDNFIRVASTELSAALIDSRLTNAIANVFAACGKELCTKLEAQIKLGADSKQVVDLPNLQQQQNTQLANVLFYYKDSVRRMLSDLHVHFEKTPGTAREIISRSLEQADLLIGTILQQIMESIITTISIIVLSMHREPGLNSERMSTTGPSMYMKELQEFVNRSWSHHIALFDDKQMTKKCGHELAKRCIELFLHNVCILRPLSSCGRQRLKQDCQHMEQALKPLC------PNLAELGKPSRLLRAMSLLIVQTAEELVK--QTIGED--SLVPSYIVLLLLFGHAGADLQSPHTTANWSNERLIEWLDGHTAEREKLELISGALQRYRDNARRKNIQQYDEVYPMMVDYFEQALK 748          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Fly
Match: fws (gene:FBgn0024689 transcript:FBtr0080999)

HSP 1 Score: 121.709 bits (304), Expect = 4.554e-28
Identity = 96/362 (26.52%), Postives = 177/362 (48.90%), Query Frame = 1
Query: 1417 LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSI----IRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLSN--IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMD-NAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALK 2481
            LP ++ ++NF++  STEL+ A +DS L              +CTK E  I   ++S Q++   N  Q+ N  + N++  +K ++   +    +   +   + + I+   L+    L  T++Q +M++I  T+  I+ ++H E    S     T  S+ M EL  F+ R+   +    +D+ +      E+  +  E++L ++ ++RP +  G Q+L  D +  E A++  C       N  +     R LR +  +++Q    +V+  Q I +   +++P+  VL  LF  + ++L+SPH +  WS  R + WL  H +E ++L  I GAL  Y +  R K  + Y E+Y  M+   E ALK
Sbjct:  397 LPGNETVDNFIRVASTELSAALIDSRLTNAIANVFAACGKELCTKLEAQIKLGADSKQVVDLPNLQQQQNTQLANVLFYYKDSVRRMLSDLHVHFEKTPGTAREIISRSLEQADLLIGTILQQIMESIITTISIIVLSMHREPGLNSERMSTTGPSMYMKELQEFVNRSWSHHIALFDDKQMTKKCGHELAKRCIELFLHNVCILRPLSSCGRQRLKQDCQHMEQALKPLC------PNLAELGKPSRLLRAMSLLIVQTAEELVK--QTIGED--SLVPSYIVLLLLFGHAGADLQSPHTTANWSNERLIEWLDGHTAEREKLELISGALQRYRDNARRKNIQQYDEVYPMMVDYFEQALK 748          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Fly
Match: fws (gene:FBgn0024689 transcript:FBtr0081000)

HSP 1 Score: 121.709 bits (304), Expect = 4.554e-28
Identity = 96/362 (26.52%), Postives = 177/362 (48.90%), Query Frame = 1
Query: 1417 LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSI----IRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLSN--IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMD-NAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALK 2481
            LP ++ ++NF++  STEL+ A +DS L              +CTK E  I   ++S Q++   N  Q+ N  + N++  +K ++   +    +   +   + + I+   L+    L  T++Q +M++I  T+  I+ ++H E    S     T  S+ M EL  F+ R+   +    +D+ +      E+  +  E++L ++ ++RP +  G Q+L  D +  E A++  C       N  +     R LR +  +++Q    +V+  Q I +   +++P+  VL  LF  + ++L+SPH +  WS  R + WL  H +E ++L  I GAL  Y +  R K  + Y E+Y  M+   E ALK
Sbjct:  397 LPGNETVDNFIRVASTELSAALIDSRLTNAIANVFAACGKELCTKLEAQIKLGADSKQVVDLPNLQQQQNTQLANVLFYYKDSVRRMLSDLHVHFEKTPGTAREIISRSLEQADLLIGTILQQIMESIITTISIIVLSMHREPGLNSERMSTTGPSMYMKELQEFVNRSWSHHIALFDDKQMTKKCGHELAKRCIELFLHNVCILRPLSSCGRQRLKQDCQHMEQALKPLC------PNLAELGKPSRLLRAMSLLIVQTAEELVK--QTIGED--SLVPSYIVLLLLFGHAGADLQSPHTTANWSNERLIEWLDGHTAEREKLELISGALQRYRDNARRKNIQQYDEVYPMMVDYFEQALK 748          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Fly
Match: fws (gene:FBgn0024689 transcript:FBtr0305685)

HSP 1 Score: 121.709 bits (304), Expect = 4.554e-28
Identity = 96/362 (26.52%), Postives = 177/362 (48.90%), Query Frame = 1
Query: 1417 LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSI----IRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLSN--IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMD-NAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALK 2481
            LP ++ ++NF++  STEL+ A +DS L              +CTK E  I   ++S Q++   N  Q+ N  + N++  +K ++   +    +   +   + + I+   L+    L  T++Q +M++I  T+  I+ ++H E    S     T  S+ M EL  F+ R+   +    +D+ +      E+  +  E++L ++ ++RP +  G Q+L  D +  E A++  C       N  +     R LR +  +++Q    +V+  Q I +   +++P+  VL  LF  + ++L+SPH +  WS  R + WL  H +E ++L  I GAL  Y +  R K  + Y E+Y  M+   E ALK
Sbjct:  397 LPGNETVDNFIRVASTELSAALIDSRLTNAIANVFAACGKELCTKLEAQIKLGADSKQVVDLPNLQQQQNTQLANVLFYYKDSVRRMLSDLHVHFEKTPGTAREIISRSLEQADLLIGTILQQIMESIITTISIIVLSMHREPGLNSERMSTTGPSMYMKELQEFVNRSWSHHIALFDDKQMTKKCGHELAKRCIELFLHNVCILRPLSSCGRQRLKQDCQHMEQALKPLC------PNLAELGKPSRLLRAMSLLIVQTAEELVK--QTIGED--SLVPSYIVLLLLFGHAGADLQSPHTTANWSNERLIEWLDGHTAEREKLELISGALQRYRDNARRKNIQQYDEVYPMMVDYFEQALK 748          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Fly
Match: fws (gene:FBgn0024689 transcript:FBtr0346627)

HSP 1 Score: 121.709 bits (304), Expect = 4.554e-28
Identity = 96/362 (26.52%), Postives = 177/362 (48.90%), Query Frame = 1
Query: 1417 LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSI----IRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLSN--IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMD-NAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALK 2481
            LP ++ ++NF++  STEL+ A +DS L              +CTK E  I   ++S Q++   N  Q+ N  + N++  +K ++   +    +   +   + + I+   L+    L  T++Q +M++I  T+  I+ ++H E    S     T  S+ M EL  F+ R+   +    +D+ +      E+  +  E++L ++ ++RP +  G Q+L  D +  E A++  C       N  +     R LR +  +++Q    +V+  Q I +   +++P+  VL  LF  + ++L+SPH +  WS  R + WL  H +E ++L  I GAL  Y +  R K  + Y E+Y  M+   E ALK
Sbjct:  397 LPGNETVDNFIRVASTELSAALIDSRLTNAIANVFAACGKELCTKLEAQIKLGADSKQVVDLPNLQQQQNTQLANVLFYYKDSVRRMLSDLHVHFEKTPGTAREIISRSLEQADLLIGTILQQIMESIITTISIIVLSMHREPGLNSERMSTTGPSMYMKELQEFVNRSWSHHIALFDDKQMTKKCGHELAKRCIELFLHNVCILRPLSSCGRQRLKQDCQHMEQALKPLC------PNLAELGKPSRLLRAMSLLIVQTAEELVK--QTIGED--SLVPSYIVLLLLFGHAGADLQSPHTTANWSNERLIEWLDGHTAEREKLELISGALQRYRDNARRKNIQQYDEVYPMMVDYFEQALK 748          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Zebrafish
Match: cog5 (component of oligomeric golgi complex 5 [Source:ZFIN;Acc:ZDB-GENE-041210-47])

HSP 1 Score: 409.453 bits (1051), Expect = 6.836e-130
Identity = 256/823 (31.11%), Postives = 421/823 (51.15%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQYQLWISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNH-AVIQKDDVNRNY---VELDNMKFN--------------QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESF-----CLSNIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESA 2475
            +F  +D D  +     +    + + L  +   I+ L+++L   V+A+H+DL++ A GIE LEGVL+MM  R S L++  D+IR K+ +P+N +  R  QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E      +     + ++A  LL+   E  N + +G ALQ+F NL  L +++  +V  ++    EN+   ++I         K   Q S  +  PGRA +PT    A+FRA+ WT ++KL++ + ++   V  L K L  KRD ++  C I                  +  +   +  + +   ++  LS+  + A A+  S FLK+ LE EYPKLL+L+ +L  +L  + A IQ   V+      VEL   + +              +K  K  L  +E A+LS SLS+LFD +   F +  +  PS+D++++ +K I++EL +ASVDS L     KN  K + + C K EQ + T  +++Q+IGP    Q+ N  ++N + + +  +   I        + +  +   L+    L  + +QPL++++T ++E I+ T+H E F          +   SL M EL GFI R    YF  +   D L    ++I  +   +++ H +L+RP  + G  +L  D  Q E+A+   C R   VS+      YR LR  + +L Q    I  +  + D     ++P S +LH +F+R+P+ELKSPH    WS+ RY  WL  H SE DRL  I+GAL+AY   +R ++ K +A +Y  M+ +L+ A
Sbjct:   20 DFLQEDFDVKTYTAQAIHHAVIAEQLARLAEGISQLDKELHCQVVARHEDLLAQATGIESLEGVLQMMQTRISALQSAVDRIRTKIVDPYNKIVARTAQLARLQVACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLNELDYLSQGVDLSGIDVIENDLLFISRARLEVENQAKRLLEQGMEIQNPSQVGTALQVFYNLGNLRETIRSVVDGYRTSVQENVVNALDI---------KVLTQPSNTRGAPGRAVMPTPGNTAAFRAALWTNLEKLMDQICAACGQVQHLQKVLTKKRDPVTHVCFI----------------DEIIKDGQPDILHTFWSSVTQTLSEELQKATAA--STFLKQALEGEYPKLLRLYNELWKRLQQYSASIQGALVSSGAGLDVELPATENDTEDLFTHAKPDYDPEKDLKDSLQPYEAAYLSKSLSRLFDPINLVFPQGGRNPPSNDELDSIIKTIASELNVASVDSGLTIAVAKNAAKTVQLFCVKSEQLLCTQGDASQVIGPLTEGQRRNIAVVNSLFRLQQAVAKVISGLGSFPLAAEQSLTASLEAVQALMSSAVQPLLNSVTDSVEAILITMHQEDFSSPLPAGGRPDVPCSLYMRELQGFIARVMNDYFRPLQCLDFLYDSTEKIAQRAITLFIRHASLLRPLGEGGKMRLAADFAQMELAVAPLCRR---VSDL--GKAYRLLRSFRPLLFQTNEHIASSQALGD-----LIPYSTILHFMFTRAPAELKSPHQRAEWSISRYSQWLDDHSSEKDRLTLIRGALEAYVQSVRARQGKEFAPVYPIMLQMLQKA 805          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Zebrafish
Match: cog5 (component of oligomeric golgi complex 5 [Source:ZFIN;Acc:ZDB-GENE-041210-47])

HSP 1 Score: 405.986 bits (1042), Expect = 1.652e-128
Identity = 256/824 (31.07%), Postives = 421/824 (51.09%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQYQLWISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNH-AVIQKDDVNRNY---VELDNMKFN--------------QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESF-----CLSNIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMG-WSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESA 2475
            +F  +D D  +     +    + + L  +   I+ L+++L   V+A+H+DL++ A GIE LEGVL+MM  R S L++  D+IR K+ +P+N +  R  QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E      +     + ++A  LL+   E  N + +G ALQ+F NL  L +++  +V  ++    EN+   ++I         K   Q S  +  PGRA +PT    A+FRA+ WT ++KL++ + ++   V  L K L  KRD ++  C I                  +  +   +  + +   ++  LS+  + A A+  S FLK+ LE EYPKLL+L+ +L  +L  + A IQ   V+      VEL   + +              +K  K  L  +E A+LS SLS+LFD +   F +  +  PS+D++++ +K I++EL +ASVDS L     KN  K + + C K EQ + T  +++Q+IGP    Q+ N  ++N + + +  +   I        + +  +   L+    L  + +QPL++++T ++E I+ T+H E F          +   SL M EL GFI R    YF  +   D L    ++I  +   +++ H +L+RP  + G  +L  D  Q E+A+   C R   VS+      YR LR  + +L Q    I  +  + D     ++P S +LH +F+R+P+ELKSPH     WS+ RY  WL  H SE DRL  I+GAL+AY   +R ++ K +A +Y  M+ +L+ A
Sbjct:   20 DFLQEDFDVKTYTAQAIHHAVIAEQLARLAEGISQLDKELHCQVVARHEDLLAQATGIESLEGVLQMMQTRISALQSAVDRIRTKIVDPYNKIVARTAQLARLQVACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLNELDYLSQGVDLSGIDVIENDLLFISRARLEVENQAKRLLEQGMEIQNPSQVGTALQVFYNLGNLRETIRSVVDGYRTSVQENVVNALDI---------KVLTQPSNTRGAPGRAVMPTPGNTAAFRAALWTNLEKLMDQICAACGQVQHLQKVLTKKRDPVTHVCFI----------------DEIIKDGQPDILHTFWSSVTQTLSEELQKATAA--STFLKQALEGEYPKLLRLYNELWKRLQQYSASIQGALVSSGAGLDVELPATENDTEDLFTHAKPDYDPEKDLKDSLQPYEAAYLSKSLSRLFDPINLVFPQGGRNPPSNDELDSIIKTIASELNVASVDSGLTIAVAKNAAKTVQLFCVKSEQLLCTQGDASQVIGPLTEGQRRNIAVVNSLFRLQQAVAKVISGLGSFPLAAEQSLTASLEAVQALMSSAVQPLLNSVTDSVEAILITMHQEDFSSPLPAGGRPDVPCSLYMRELQGFIARVMNDYFRPLQCLDFLYDSTEKIAQRAITLFIRHASLLRPLGEGGKMRLAADFAQMELAVAPLCRR---VSDL--GKAYRLLRSFRPLLFQTNEHIASSQALGD-----LIPYSTILHFMFTRAPAELKSPHQQRAEWSISRYSQWLDDHSSEKDRLTLIRGALEAYVQSVRARQGKEFAPVYPIMLQMLQKA 806          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Zebrafish
Match: cog5 (component of oligomeric golgi complex 5 [Source:ZFIN;Acc:ZDB-GENE-041210-47])

HSP 1 Score: 104.76 bits (260), Expect = 1.364e-25
Identity = 53/144 (36.81%), Postives = 86/144 (59.72%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINEL 510
            +F  +D D  +     +    + + L  +   I+ L+++L   V+A+H+DL++ A GIE LEGVL+MM  R S L++  D+IR K+ +P+N +  R  QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL
Sbjct:   20 DFLQEDFDVKTYTAQAIHHAVIAEQLARLAEGISQLDKELHCQVVARHEDLLAQATGIESLEGVLQMMQTRISALQSAVDRIRTKIVDPYNKIVARTAQLARLQVACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLNEL 163          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Xenopus
Match: kcnip1 (Kv channel interacting protein 1 [Source:Xenbase;Acc:XB-GENE-973728])

HSP 1 Score: 390.193 bits (1001), Expect = 1.484e-122
Identity = 256/832 (30.77%), Postives = 421/832 (50.60%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDL-------------------NAKLLNHAVIQKDDVNRNYVELDNMKFNQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFC--LSN---IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALKN 2484
            +F  DD D     +  + Q  + + L ++   I+ L+++L   V+A+H+DL++ A GIE LEGVL+MM  R   L++  D+IR K+ +P+N +  R  QL  +Q  C+ LR+IIRI  L KRL+       R+ TK + +++EL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L D +  +V  +     EN+   ++I +       +T+  +   +  PGRAA+P+    A+FRA+ WT ++KL++ + +S + V  L K L  KRD +S  C I                     + I+  G+    Y+ W  ++  LS  F    A++ S FLK+  E EYPKLL+L+ DL                   N+ L++     +DD    ++        +K  K  L  +E A+LS SLS+LFD +   F    +  PS D++++ +K I++E+ +A+VD  L +   KN+ K I +   K EQ +ST  +++Q+IGP    Q+ N  ++N +++   +I+  I  Q  LS + + ++   L     L    +QPL++++  ++E II T+H E F   LSN    +   SL M EL GFI R    YF      D +    + I  +  E+++ + +L+RP  + G  +L  D  Q         +R  + +N +++  Y KL     +L Q    I  +  V D     ++P S +L  LF+R+P +LKSP+    WS+ RY  WL  HP E DRL  IKGAL+AY   ++ ++ K +A +Y  M+ +L+ A+ +
Sbjct:   14 DFLRDDFDVKIYTSQSIHQAVIAEQLAKLAQGISQLDKELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQSAIDRIRTKIVDPYNKIVSRTAQLARLQSACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLSELDYLSQGMDLSGIEVIENDLLFIARARLEVENQAKRLLEQGVETQNPTQVGTALQVFYNLGALKDIITSVVDGYSTALNENISSALDIKI-----LTQTSQAV--QRGAPGRAAMPSPGNTAAFRAALWTNMEKLMDQIYASCVQVQHLQKVLTKKRDPVSHVCFI---------------------DEIAKDGHSDILYKFWSSVTQILSSQFEK--ATNCSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQNLQGSFSNSGNSDLVSDLQPTEDDAQDIFITKKQDVDAEKMLKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSADELDSIIKTIASEMNVAAVDPSLSSAVSKNIAKTIQLYGVKSEQLLSTQGDASQVIGPLTEGQRRNVAVVNSLYRLHQSIQKVISGQSSLSAAAEQVISSALKVIFYLMGNAVQPLLNSVADSIEAIIITMHQEDFAGNLSNSGKPDVPCSLYMKELQGFIARVMSDYFRHFECLDFVYDNTEAIAQRAIEVFIRNASLLRPLGEGGKMRLAADFAQ---------VRE-TTANDVESKSY-KLLFTGPLLFQTSEHIASSSSVGD-----LIPYSVILQFLFTRAPPDLKSPYQRAEWSIARYSQWLDDHPLEKDRLALIKGALEAYVQSVKARDGKEFAPVYPIMVQLLQKAMSS 799          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Xenopus
Match: kcnip1 (Kv channel interacting protein 1 [Source:Xenbase;Acc:XB-GENE-973728])

HSP 1 Score: 387.882 bits (995), Expect = 1.064e-121
Identity = 252/832 (30.29%), Postives = 418/832 (50.24%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDL-------------------NAKLLNHAVIQKDDVNRNYVELDNMKFNQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFC--LSN---IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALKN 2484
            +F  DD D     +  + Q  + + L ++   I+ L+++L   V+A+H+DL++ A GIE LEGVL+MM  R   L++  D+IR K+ +P+N +  R  QL  +Q  C+ LR+IIRI  L KRL+       R+ TK + +++EL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L D +  +V  +     EN+   ++I +       +T+  +   +  PGRAA+P+    A+FRA+ WT ++KL++ + +S + V  L K L  KRD +S  C I                     + I+  G+    Y+ W  ++  LS  F    A++ S FLK+  E EYPKLL+L+ DL                   N+ L++     +DD    ++        +K  K  L  +E A+LS SLS+LFD +   F    +  PS D++++ +K I++E+ +A+VD  L +   KN+ K I +   K EQ +ST  +++Q+IGP    Q+ N  ++N +++   +I+  I  Q  LS + + ++   L     L    +QPL++++  ++E II T+H E F   LSN    +   SL M EL GFI R    YF      D +    + I  +  E+++ + +L+RP  + G  +L  D  Q         +R  + ++         +  ++ +L Q    I  +  V D     ++P S +L  LF+R+P +LKSP+    WS+ RY  WL  HP E DRL  IKGAL+AY   ++ ++ K +A +Y  M+ +L+ A+ +
Sbjct:    9 DFLRDDFDVKIYTSQSIHQAVIAEQLAKLAQGISQLDKELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQSAIDRIRTKIVDPYNKIVSRTAQLARLQSACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLSELDYLSQGMDLSGIEVIENDLLFIARARLEVENQAKRLLEQGVETQNPTQVGTALQVFYNLGALKDIITSVVDGYSTALNENISSALDIKI-----LTQTSQAV--QRGAPGRAAMPSPGNTAAFRAALWTNMEKLMDQIYASCVQVQHLQKVLTKKRDPVSHVCFI---------------------DEIAKDGHSDILYKFWSSVTQILSSQFEK--ATNCSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQNLQGSFSNSGNSDLVSDLQPTEDDAQDIFITKKQDVDAEKMLKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSADELDSIIKTIASEMNVAAVDPSLSSAVSKNIAKTIQLYGVKSEQLLSTQGDASQVIGPLTEGQRRNVAVVNSLYRLHQSIQKVISGQSSLSAAAEQVISSALKVIFYLMGNAVQPLLNSVADSIEAIIITMHQEDFAGNLSNSGKPDVPCSLYMKELQGFIARVMSDYFRHFECLDFVYDNTEAIAQRAIEVFIRNASLLRPLGEGGKMRLAADFAQ---------VRETTAND---------VECIEPLLFQTSEHIASSSSVGD-----LIPYSVILQFLFTRAPPDLKSPYQRAEWSIARYSQWLDDHPLEKDRLALIKGALEAYVQSVKARDGKEFAPVYPIMVQLLQKAMSS 787          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Xenopus
Match: kcnip1 (Kv channel interacting protein 1 [Source:Xenbase;Acc:XB-GENE-973728])

HSP 1 Score: 387.497 bits (994), Expect = 1.344e-120
Identity = 252/832 (30.29%), Postives = 418/832 (50.24%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDL-------------------NAKLLNHAVIQKDDVNRNYVELDNMKFNQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFC--LSN---IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALKN 2484
            +F  DD D     +  + Q  + + L ++   I+ L+++L   V+A+H+DL++ A GIE LEGVL+MM  R   L++  D+IR K+ +P+N +  R  QL  +Q  C+ LR+IIRI  L KRL+       R+ TK + +++EL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L D +  +V  +     EN+   ++I +       +T+  +   +  PGRAA+P+    A+FRA+ WT ++KL++ + +S + V  L K L  KRD +S  C I                     + I+  G+    Y+ W  ++  LS  F    A++ S FLK+  E EYPKLL+L+ DL                   N+ L++     +DD    ++        +K  K  L  +E A+LS SLS+LFD +   F    +  PS D++++ +K I++E+ +A+VD  L +   KN+ K I +   K EQ +ST  +++Q+IGP    Q+ N  ++N +++   +I+  I  Q  LS + + ++   L     L    +QPL++++  ++E II T+H E F   LSN    +   SL M EL GFI R    YF      D +    + I  +  E+++ + +L+RP  + G  +L  D  Q         +R  + ++         +  ++ +L Q    I  +  V D     ++P S +L  LF+R+P +LKSP+    WS+ RY  WL  HP E DRL  IKGAL+AY   ++ ++ K +A +Y  M+ +L+ A+ +
Sbjct:  108 DFLRDDFDVKIYTSQSIHQAVIAEQLAKLAQGISQLDKELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQSAIDRIRTKIVDPYNKIVSRTAQLARLQSACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLSELDYLSQGMDLSGIEVIENDLLFIARARLEVENQAKRLLEQGVETQNPTQVGTALQVFYNLGALKDIITSVVDGYSTALNENISSALDIKI-----LTQTSQAV--QRGAPGRAAMPSPGNTAAFRAALWTNMEKLMDQIYASCVQVQHLQKVLTKKRDPVSHVCFI---------------------DEIAKDGHSDILYKFWSSVTQILSSQFEK--ATNCSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQNLQGSFSNSGNSDLVSDLQPTEDDAQDIFITKKQDVDAEKMLKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSADELDSIIKTIASEMNVAAVDPSLSSAVSKNIAKTIQLYGVKSEQLLSTQGDASQVIGPLTEGQRRNVAVVNSLYRLHQSIQKVISGQSSLSAAAEQVISSALKVIFYLMGNAVQPLLNSVADSIEAIIITMHQEDFAGNLSNSGKPDVPCSLYMKELQGFIARVMSDYFRHFECLDFVYDNTEAIAQRAIEVFIRNASLLRPLGEGGKMRLAADFAQ---------VRETTAND---------VECIEPLLFQTSEHIASSSSVGD-----LIPYSVILQFLFTRAPPDLKSPYQRAEWSIARYSQWLDDHPLEKDRLALIKGALEAYVQSVKARDGKEFAPVYPIMVQLLQKAMSS 886          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Xenopus
Match: kcnip1 (Kv channel interacting protein 1 [Source:Xenbase;Acc:XB-GENE-973728])

HSP 1 Score: 376.326 bits (965), Expect = 7.621e-118
Identity = 243/789 (30.80%), Postives = 398/789 (50.44%), Query Frame = 1
Query:  220 VIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDL-------------------NAKLLNHAVIQKDDVNRNYVELDNMKFNQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFC--LSN---IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALKN 2484
            V+A+H+DL++ A GIE LEGVL+MM  R   L++  D+IR K+ +P+N +  R  QL  +Q  C+ LR+IIRI  L KRL+       R+ TK + +++EL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L D +  +V  +     EN+   ++I +       +T+  +   +  PGRAA+P+    A+FRA+ WT ++KL++ + +S + V  L K L  KRD +S  C I                     + I+  G+    Y+ W  ++  LS  F  A  ++ S FLK+  E EYPKLL+L+ DL                   N+ L++     +DD    ++        +K  K  L  +E A+LS SLS+LFD +   F    +  PS D++++ +K I++E+ +A+VD  L +   KN+ K I +   K EQ +ST  +++Q+IGP    Q+ N  ++N +++   +I+  I  Q  LS + + ++   L     L    +QPL++++  ++E II T+H E F   LSN    +   SL M EL GFI R    YF      D +    + I  +  E+++ + +L+RP  + G  +L  D  Q         +R  + ++         +  ++ +L Q    I  +  V D     ++P S +L  LF+R+P +LKSP+    WS+ RY  WL  HP E DRL  IKGAL+AY   ++ ++ K +A +Y  M+ +L+ A+ +
Sbjct:    7 VVARHEDLLAQATGIESLEGVLQMMQTRIGALQSAIDRIRTKIVDPYNKIVSRTAQLARLQSACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLSELDYLSQGMDLSGIEVIENDLLFIARARLEVENQAKRLLEQGVETQNPTQVGTALQVFYNLGALKDIITSVVDGYSTALNENISSALDIKI-----LTQTSQAV--QRGAPGRAAMPSPGNTAAFRAALWTNMEKLMDQIYASCVQVQHLQKVLTKKRDPVSHVCFI---------------------DEIAKDGHSDILYKFWSSVTQILSSQFEKA--TNCSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQNLQGSFSNSGNSDLVSDLQPTEDDAQDIFITKKQDVDAEKMLKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSADELDSIIKTIASEMNVAAVDPSLSSAVSKNIAKTIQLYGVKSEQLLSTQGDASQVIGPLTEGQRRNVAVVNSLYRLHQSIQKVISGQSSLSAAAEQVISSALKVIFYLMGNAVQPLLNSVADSIEAIIITMHQEDFAGNLSNSGKPDVPCSLYMKELQGFIARVMSDYFRHFECLDFVYDNTEAIAQRAIEVFIRNASLLRPLGEGGKMRLAADFAQ---------VRETTAND---------VECIEPLLFQTSEHIASSSSVGD-----LIPYSVILQFLFTRAPPDLKSPYQRAEWSIARYSQWLDDHPLEKDRLALIKGALEAYVQSVKARDGKEFAPVYPIMVQLLQKAMSS 742          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Xenopus
Match: kcnip1 (Kv channel interacting protein 1 [Source:Xenbase;Acc:XB-GENE-973728])

HSP 1 Score: 372.474 bits (955), Expect = 6.837e-116
Identity = 248/832 (29.81%), Postives = 410/832 (49.28%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDL-------------------NAKLLNHAVIQKDDVNRNYVELDNMKFNQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFC--LSN---IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALKN 2484
            +F  DD D     +  + Q  + + L ++   I+ L+++L   V+A+H+DL++ A GIE LEGVL+MM  R   L++  D+IR K+ +P+N +  R  QL  +Q  C+ LR+IIRI  L KRL+       R+ TK + +++EL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L D +  +V  +     EN+   ++I +       +T+  +   +  PGRAA+P+    A+FRA+ WT ++KL++ + +S + V  L K L  KRD +S  C I                     + I+  G+    Y+ W  ++  LS  F    A++ S FLK+  E EYPKLL+L+ DL                   N+ L++     +DD    ++        +K  K  L  +E A+LS SLS+LFD +   F    +  PS D++++ +K I++E+ +A+VD  L +   KN+ K I +   K EQ +ST  +++Q+IGP    Q+ N  ++N +++   +I+  I                       L    +QPL++++  ++E II T+H E F   LSN    +   SL M EL GFI R    YF      D +    + I  +  E+++ + +L+RP  + G  +L  D  Q         +R  + ++         +  ++ +L Q    I  +  V D     ++P S +L  LF+R+P +LKSP+    WS+ RY  WL  HP E DRL  IKGAL+AY   ++ ++ K +A +Y  M+ +L+ A+ +
Sbjct:   30 DFLRDDFDVKIYTSQSIHQAVIAEQLAKLAQGISQLDKELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQSAIDRIRTKIVDPYNKIVSRTAQLARLQSACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLSELDYLSQGMDLSGIEVIENDLLFIARARLEVENQAKRLLEQGVETQNPTQVGTALQVFYNLGALKDIITSVVDGYSTALNENISSALDIKI-----LTQTSQAV--QRGAPGRAAMPSPGNTAAFRAALWTNMEKLMDQIYASCVQVQHLQKVLTKKRDPVSHVCFI---------------------DEIAKDGHSDILYKFWSSVTQILSSQFEK--ATNCSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQNLQGSFSNSGNSDLVSDLQPTEDDAQDIFITKKQDVDAEKMLKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSADELDSIIKTIASEMNVAAVDPSLSSAVSKNIAKTIQLYGVKSEQLLSTQGDASQVIGPLTEGQRRNVAVVNSLYRLHQSIQKVI---------------------FYLMGNAVQPLLNSVADSIEAIIITMHQEDFAGNLSNSGKPDVPCSLYMKELQGFIARVMSDYFRHFECLDFVYDNTEAIAQRAIEVFIRNASLLRPLGEGGKMRLAADFAQ---------VRETTAND---------VECIEPLLFQTSEHIASSSSVGD-----LIPYSVILQFLFTRAPPDLKSPYQRAEWSIARYSQWLDDHPLEKDRLALIKGALEAYVQSVKARDGKEFAPVYPIMVQLLQKAMSS 787          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Mouse
Match: Cog5 (component of oligomeric golgi complex 5 [Source:MGI Symbol;Acc:MGI:2145130])

HSP 1 Score: 397.897 bits (1021), Expect = 3.122e-125
Identity = 260/834 (31.18%), Postives = 418/834 (50.12%), Query Frame = 1
Query:   79 DILINFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHA------------------VIQKDDVNRNYVELDNMKFN-QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLSN-----IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESAL 2478
            D    F ++D D  +  +  + Q  + + L ++   I+ L+++L   V+A+H+DL++ A GIE LEGVL+MM  R   L+   D+++ K+ EP+N +  R  QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L ++V  +V    + +C  L+  +N  L ++   + + + + G    PGRAA+PT    A FRAS WT ++KL++ + ++   V  L K L  KRD +S  C I                     E I   G     Y  W  ++  LS  F    A++ S FLK+  E EYPKLL+L+ DL  +L   +                  +   +D  ++   L    ++ +K  K  L  +E A+LS SLS+LFD +   F    +  PS D+++   K I++EL +A+VD++L     KN+ K I +   K EQ +ST  +++Q+IGP    QK N  ++N + K   ++   +  Q   S + +  +   L     L    IQPL+ ++   +E II T+H E F  ++      +   SL M EL GFI R    YF      D +    + I  +  E+++ + +LIRP  + G  +L  D  Q E+A+   C R   VS+   +  YR LR  + +L Q    + ++  V D     ++P S ++  LF+R+P+ELKSP     WS  R+  WL  HPSE DRL  ++GAL+AY   +R ++ K +A +Y  M+ +L+ A+
Sbjct:   32 DCYSEFLNEDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDKELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQGAVDRMKSKIVEPYNKIVARTAQLARLQVACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLNELDYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQGVETQNPTQVGTALQVFHNLGTLKETVTSVV----DGYCAALEDSINNALDVKVLTQPSQSAVRGG---PGRAAMPTPGSTAGFRASLWTNMEKLMDHICAACGQVQHLQKVLTKKRDPVSHICFI---------------------EEIIKDGQPEILYMFWNAVTLALSSHFHS--ATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQSSQNTQGTFSPSGTPDLCVDLPHMEDDTQDMFRLKRPDYDPEKALKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSSDELDGITKTITSELNVAAVDANLTLAVSKNVAKTIQLYAVKSEQLLSTQGDASQVIGPLTEGQKRNVGVVNSLFKLHQSVTKVVASQSSFSATAEQTIMSALKTIHDLMGNAIQPLLTSVADAIEAIIITMHQEDFSGASSSSGKPDVPCSLYMKELQGFIARVMNDYFKHFECLDFVFDNTEAIAQRAIELFIRNASLIRPLGEGGKLRLAADFAQMELAVGPLCRR---VSDLGKS--YRMLRSFRPLLFQTSEHVADSPAVGD-----IIPFSIIIQFLFTRAPAELKSPFQRAEWSHARFSQWLDDHPSEKDRLLLLRGALEAYVQSVRSRDGKEFAPVYPIMVQLLQKAM 825          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Mouse
Match: Cog5 (component of oligomeric golgi complex 5 [Source:MGI Symbol;Acc:MGI:2145130])

HSP 1 Score: 82.8037 bits (203), Expect = 1.417e-18
Identity = 36/87 (41.38%), Postives = 57/87 (65.52%), Query Frame = 1
Query: 2218 VFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESAL 2478
            V +++P S ++  LF+R+P+ELKSP     WS  R+  WL  HPSE DRL  ++GAL+AY   +R ++ K +A +Y  M+ +L+ A+
Sbjct:    9 VGDIIPFSIIIQFLFTRAPAELKSPFQRAEWSHARFSQWLDDHPSEKDRLLLLRGALEAYVQSVRSRDGKEFAPVYPIMVQLLQKAM 95          
BLAST of Component of oligomeric golgi complex 5 vs. UniProt/SwissProt
Match: sp|Q9UP83|COG5_HUMAN (Conserved oligomeric Golgi complex subunit 5 OS=Homo sapiens OX=9606 GN=COG5 PE=1 SV=3)

HSP 1 Score: 403.675 bits (1036), Expect = 1.748e-126
Identity = 264/830 (31.81%), Postives = 419/830 (50.48%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKDDVNRN-----YVELDNMKFN--------------QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLS-----NIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESAL 2478
            +F ++D D  +  +  + Q  + + L ++   I+ L+ +L   V+A+H+DL++ A GIE LEGVL+MM  R   L+   D+I+ K+ EP+N +  R  QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L D++  +V      +C  L++ +N  L I+   + + + + G    PGR+ +PT    A+ RASFWT ++KL++ + +    V  L K L  KRD +S  C I                     E I   G     Y  W  ++  LS  F   +A++ S FLK+  E EYPKLL+L+ DL  +L  ++   + + N +     YV+L +M+ +              +K  K  L  +E A+LS SLS+LFD +   F    +  PS D+++  +K I++EL +A+VD++L     KN+ K I +   K EQ +ST  +++Q+IGP    Q+ N  ++N ++K   ++  +I                   H   L    +QPL+ ++   +E II T+H E F  S       +   SL M EL GFI R    YF      D +    + I  +  E+++ H +LIRP  + G  +L  D  Q E+A+  FC R   VS+   +  YR LR  + +L Q    +  +  + D     V+P S ++  LF+R+P+ELKSP     WS  R+  WL  HPSE DRL  I+GAL+AY   +R +E K +A +Y  M+ +L+ A+
Sbjct:   67 DFLNEDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDRELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQGAVDRIKAKIVEPYNKIVARTAQLARLQVACDLLRRIIRILNLSKRLQGQLQGGSREITKAAQSLNELDYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQGLETQNPTQVGTALQVFYNLGTLKDTITSVVDG----YCATLEENINSALDIKVLTQPSQSAVRGG---PGRSTMPTPGNTAALRASFWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVSHICFI---------------------EEIVKDGQPEIFYTFWNSVTQALSSQFH--MATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQHIQGNFNASGTTDLYVDLQHMEDDAQDIFIPKKPDYDPEKALKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSSDELDGIIKTIASELNVAAVDTNLTLAVSKNVAKTIQLYSVKSEQLLSTQGDASQVIGPLTEGQRRNVAVVNSLYKLHQSVTKAI-------------------HA--LMENAVQPLLTSVGDAIEAIIITMHQEDFSGSLSSSGKPDVPCSLYMKELQGFIARVMSDYFKHFECLDFVFDNTEAIAQRAVELFIRHASLIRPLGEGGKMRLAADFAQMELAVGPFCRR---VSDLGKS--YRMLRSFRPLLFQASEHVASSPALGD-----VIPFSIIIQFLFTRAPAELKSPFQRAEWSHTRFSQWLDDHPSEKDRLLLIRGALEAYVQSVRSREGKEFAPVYPIMVQLLQKAM 835          
BLAST of Component of oligomeric golgi complex 5 vs. UniProt/SwissProt
Match: sp|Q8C0L8|COG5_MOUSE (Conserved oligomeric Golgi complex subunit 5 OS=Mus musculus OX=10090 GN=Cog5 PE=1 SV=3)

HSP 1 Score: 397.897 bits (1021), Expect = 2.184e-124
Identity = 260/834 (31.18%), Postives = 418/834 (50.12%), Query Frame = 1
Query:   79 DILINFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHA------------------VIQKDDVNRNYVELDNMKFN-QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLSN-----IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESAL 2478
            D    F ++D D  +  +  + Q  + + L ++   I+ L+++L   V+A+H+DL++ A GIE LEGVL+MM  R   L+   D+++ K+ EP+N +  R  QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L ++V  +V    + +C  L+  +N  L ++   + + + + G    PGRAA+PT    A FRAS WT ++KL++ + ++   V  L K L  KRD +S  C I                     E I   G     Y  W  ++  LS  F    A++ S FLK+  E EYPKLL+L+ DL  +L   +                  +   +D  ++   L    ++ +K  K  L  +E A+LS SLS+LFD +   F    +  PS D+++   K I++EL +A+VD++L     KN+ K I +   K EQ +ST  +++Q+IGP    QK N  ++N + K   ++   +  Q   S + +  +   L     L    IQPL+ ++   +E II T+H E F  ++      +   SL M EL GFI R    YF      D +    + I  +  E+++ + +LIRP  + G  +L  D  Q E+A+   C R   VS+   +  YR LR  + +L Q    + ++  V D     ++P S ++  LF+R+P+ELKSP     WS  R+  WL  HPSE DRL  ++GAL+AY   +R ++ K +A +Y  M+ +L+ A+
Sbjct:   32 DCYSEFLNEDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDKELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQGAVDRMKSKIVEPYNKIVARTAQLARLQVACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLNELDYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQGVETQNPTQVGTALQVFHNLGTLKETVTSVV----DGYCAALEDSINNALDVKVLTQPSQSAVRGG---PGRAAMPTPGSTAGFRASLWTNMEKLMDHICAACGQVQHLQKVLTKKRDPVSHICFI---------------------EEIIKDGQPEILYMFWNAVTLALSSHFHS--ATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQSSQNTQGTFSPSGTPDLCVDLPHMEDDTQDMFRLKRPDYDPEKALKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSSDELDGITKTITSELNVAAVDANLTLAVSKNVAKTIQLYAVKSEQLLSTQGDASQVIGPLTEGQKRNVGVVNSLFKLHQSVTKVVASQSSFSATAEQTIMSALKTIHDLMGNAIQPLLTSVADAIEAIIITMHQEDFSGASSSSGKPDVPCSLYMKELQGFIARVMNDYFKHFECLDFVFDNTEAIAQRAIELFIRNASLIRPLGEGGKLRLAADFAQMELAVGPLCRR---VSDLGKS--YRMLRSFRPLLFQTSEHVADSPAVGD-----IIPFSIIIQFLFTRAPAELKSPFQRAEWSHARFSQWLDDHPSEKDRLLLLRGALEAYVQSVRSRDGKEFAPVYPIMVQLLQKAM 825          
BLAST of Component of oligomeric golgi complex 5 vs. UniProt/SwissProt
Match: sp|Q9C9V9|COG5_ARATH (Conserved oligomeric Golgi complex subunit 5 OS=Arabidopsis thaliana OX=3702 GN=COG5 PE=1 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 8.054e-46
Identity = 187/793 (23.58%), Postives = 344/793 (43.38%), Query Frame = 1
Query:  187 INNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDHQ--RDPTKVSVAINELRYHFSTT------DWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQYQLWISDKLSQAFRDAIAS--DESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKDDVNRNYVELDNMKFNQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK--LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCL--SNIETESSLMMCELDGFIKRTRVQYFDEI----------NDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQH--FCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALKNN 2487
            I  L+ QL+  VI++H +L++    +   +  L  +    S+L++   ++R  L EP  ++  +  QL N+    E L   +R   L K+L+D     DP K+ +     ++HF         D  GI ++++  +        L  EA  +L+   E  NQA +G  LQ+F NL  L  +V+++V+ ++    +++   +++  I   S          +  +P    +  G +V   R + W  +   +  + S ++ V  L + L  KRD  +   L+                     E I          + D L +AF   + S    S F+K+     YPKL+ +  +L  +      I +D   +  +   N++  ++      + F+ AFLS+   +L D+V   F  S +  LPS + I+  + +I  E+     D+ L     + +GK +  +  + E  IST  E+ QI GPA + Q  NFT+   +    ++I +S++  L    ++  ++   L          + PL   +   LE  I  +H ++F    ++++  +S  M EL   I   R ++   +            E +     +++ +++   Y+ H +L+RP +++G  ++  D+ + E+A+    F +  L        A YR LR  + ++       +E  Q+    + N LP S VLHHL++R P EL+SP      S  +Y  W L +  E      IK  LD YA  IR +  K ++ +Y  M+ I  S  + N
Sbjct:   90 IRLLDSQLRNDVISRHPELLAQLSSLSHADVSLSSLRSSVSSLQSSIRRVRSDLSEPIKSIRSKSVQLSNLHTATELLSHSVRTLRLSKKLRDLADFPDPDKIDLT-KAAQFHFEILTMCKEYDLFGIDVIDEEIKFVTEIGEKLRSEAMKVLERGMEGLNQAEVGTGLQVFYNLGELKSTVDQLVNKYKGMAVKSVSVAMDMKAITSGSGGGFGPGGIRSSGSP---HIGGGAKV---REALWQRMASCMEQLCSLVVAVWHLQRVLSKKRDPFTHVLLL--------------------DEVIKEGDSMLTDRVWDALVKAFTSQMKSAYTASSFVKEIFTMGYPKLVSMIENLLER------ISRDTDVKGVLPAINLERKEQMVACIAI-FQTAFLSLCFGRLSDLVNSIFPMSSRGSLPSKEQISQVLSHIQDEIEAVHPDARLTLLVLREIGKALSNLAQRAECQISTGPETRQISGPATSTQIRNFTLCQHLQGIHTHI-SSMVADLPSIATD--VLSPYLAAIYDAACEPVTPLFKAMRDKLESCILQIHDQNFGADDADMDNNASSYMEELQRSILHFRKEFLSRLLPSAANANTAGTESICTRLTRQMASRVLIFYIRHASLVRPLSEWGKLRMAKDMAELELAVGQNLFPVEQL-------GAPYRALRAFRPLVF------LETSQMGSSPLINDLPPSIVLHHLYTRGPDELESPMQKNRLSPKQYSLW-LDNQREDQIWKGIKATLDDYAVKIRSRGDKEFSPVYPLMLQIGSSLTQEN 831          
BLAST of Component of oligomeric golgi complex 5 vs. UniProt/SwissProt
Match: sp|Q9VJD3|COG5_DROME (Conserved oligomeric Golgi complex subunit 5 OS=Drosophila melanogaster OX=7227 GN=fws PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 5.250e-27
Identity = 96/362 (26.52%), Postives = 177/362 (48.90%), Query Frame = 1
Query: 1417 LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSI----IRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLSN--IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMD-NAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALK 2481
            LP ++ ++NF++  STEL+ A +DS L              +CTK E  I   ++S Q++   N  Q+ N  + N++  +K ++   +    +   +   + + I+   L+    L  T++Q +M++I  T+  I+ ++H E    S     T  S+ M EL  F+ R+   +    +D+ +      E+  +  E++L ++ ++RP +  G Q+L  D +  E A++  C       N  +     R LR +  +++Q    +V+  Q I +   +++P+  VL  LF  + ++L+SPH +  WS  R + WL  H +E ++L  I GAL  Y +  R K  + Y E+Y  M+   E ALK
Sbjct:  397 LPGNETVDNFIRVASTELSAALIDSRLTNAIANVFAACGKELCTKLEAQIKLGADSKQVVDLPNLQQQQNTQLANVLFYYKDSVRRMLSDLHVHFEKTPGTAREIISRSLEQADLLIGTILQQIMESIITTISIIVLSMHREPGLNSERMSTTGPSMYMKELQEFVNRSWSHHIALFDDKQMTKKCGHELAKRCIELFLHNVCILRPLSSCGRQRLKQDCQHMEQALKPLC------PNLAELGKPSRLLRAMSLLIVQTAEELVK--QTIGED--SLVPSYIVLLLLFGHAGADLQSPHTTANWSNERLIEWLDGHTAEREKLELISGALQRYRDNARRKNIQQYDEVYPMMVDYFEQALK 748          
BLAST of Component of oligomeric golgi complex 5 vs. UniProt/SwissProt
Match: sp|Q54HE0|COG5_DICDI (Conserved oligomeric Golgi complex subunit 5 OS=Dictyostelium discoideum OX=44689 GN=cog5 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.666e-16
Identity = 63/220 (28.64%), Postives = 110/220 (50.00%), Query Frame = 1
Query:   73 NSDILINFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIV 720
            NS I   F  +D +     +  L+   +   L  +T+    L ++L  ++   +DDL   A  I++L+ + + +    SNL+    +++  + EP+N +   I QL  +Q +CE LRK+IR   LVK+LK+H     RD +K +  INE+      +D  GI+I++          + +I  + +LL    E  NQ  +  +LQ+F N+ +L + V  IV
Sbjct:   58 NSHIYNQFLGEDFNVVHYTSNALKVSSISLSLNTLTSCTRELGQELTENITTNYDDLFKLANNIKELDQLTDTLKLGVSNLEESIQRMKNDISEPYNKVKSHIGQLKRVQDSCELLRKLIRYIQLVKKLKNHLQAGSRDLSKSAQCINEINLLKKDSDLTGINIIDSQVVWIKTCSDQIITISSTLLYQGMENQNQTDVANSLQVFHNMTILNEKVYSIV 277          
BLAST of Component of oligomeric golgi complex 5 vs. TrEMBL
Match: H2TKW0 (Component of oligomeric golgi complex 5 OS=Takifugu rubripes OX=31033 GN=COG5 PE=4 SV=2)

HSP 1 Score: 426.402 bits (1095), Expect = 6.959e-133
Identity = 262/827 (31.68%), Postives = 426/827 (51.51%), Query Frame = 1
Query:   79 DILINFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQYQLWISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNH---------AVIQKDDVNRNYVELDNMKF---------NQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFN-KSEKLPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESF----CLSN-IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESA 2475
            D   +F  D+ D  +     +    + + L ++   I+ L+++L + V+A+HDDL+S A GIE LEGVL+MM  R S L+   D+IR K+ EP+N +  RI QLD +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E    L +     + ++A  LL+   E  N   +G ALQ+F NL +L +++N +V  +++   +++ K ++I         K   Q +  K  PGRA +PT    A+FRA+ WT ++KL++ + ++   V  L K L  KRD ++  C I+                 +F +  ++  Y +   ++  L + F    A++ S FLK+  E EYPKLL+L+ +L  +L  +         A      ++ +  ELD+             +K  K  L+ ++ A+LS SLS+LFD +   F       PS D+++  +K IS+EL +ASVD +L     KN  K + + C K EQ + T  +++Q+IGP    Q+ N  ++N +++ +  +   I        +   ++   L+    L  + + PL+ +++ ++E II T+H E F    C  +  +   SL M EL GFI R    YF      D +    + I  +  E+++ H +++RP  + G  +L  D  Q E+A+   C R   VS+      YR LR  + +L Q    IV N       V  V+P S +LH LF+R+P EL+SPH    WS+ RY  WL  HPSE DRL+ ++GAL+AY   +R ++ K +A IY  M+ +L+ A
Sbjct:   16 DCYRDFVPDNFDVKTYTAQAIHHAVIAEQLAKLAQGISQLDKELHSQVVARHDDLLSQATGIESLEGVLQMMQTRISALQAAVDRIRSKIVEPYNKIVARITQLDRLQVACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLNELDYLSQGVDLSGIQVIENDLLLISRARLEVENQAKRLLEQGMEIQNPNQVGTALQVFYNLGILRETINGVVGGYRSTIQDSISKALDI---------KGLTQPANPKGAPGRAMLPTPGNTAAFRAALWTNLEKLMDQICAACRQVQHLQKILMKKRDPVTHVCFIDD----------------IFKDGQADILYTFWNDVTRTLGEEFH--TATEASSFLKQAFEGEYPKLLRLYNELWRRLQQYSTSLQGALPATAIDSAIDISGAELDSQDLFTHGKQDYNPEKSLKDSLLPYQAAYLSKSLSRLFDPINLVFPLGGHNPPSSDELDAIIKTISSELNVASVDPNLTLAVAKNTAKTVQLFCVKSEQLLCTQGDASQVIGPLTEAQRRNVAVVNSLYRLQQAVTKIISGLGTCPAATADVLSSSLEALQALMDSSVHPLLQSVSDSIEAIIITLHQEDFSGPVCSPDKPDVPCSLYMKELQGFISRVMSDYFRHFQCMDFIFDSTERIAQRAVELFVRHSSILRPLGEGGKMRLAADFAQMELAVAPMCRR---VSDL--GRPYRMLRSFRPLLFQTSELIVNN-----AAVGEVIPYSTLLHFLFTRAPPELRSPHQRAEWSIARYSQWLDDHPSERDRLSLLRGALEAYVQSVRARQGKEFAPIYPIMLQLLQRA 805          
BLAST of Component of oligomeric golgi complex 5 vs. TrEMBL
Match: A0A3B4UNP2 (Component of oligomeric golgi complex 5 OS=Seriola dumerili OX=41447 GN=COG5 PE=4 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 7.300e-133
Identity = 268/833 (32.17%), Postives = 423/833 (50.78%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKL----------LNHAVIQKDDVNRNYVELDNMKF---------NQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFC--LSN---IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALKNN 2487
            +F + D D  +     +    + + L ++   I+ L+++L + V+A+H+DL+S A GIE LEGVL+MM  R S L+   D+IR K+ +P+N +  RI QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E    L +     + ++A  LL+   E  N   +G ALQ+F NL  L +++  +V  ++    +N+   ++I         K   Q +  +  PGRA +PT    A+FRA+ WT ++KL++ + ++   V  L K L  KRD ++  C I                     + IS  G     Y  W  +++ LS+ F    A++ S FLK+  E EYPKLL+L+ +L  +L          L  +V     ++    E D+             +K  K  L  +E A+LS SLS+LFD +   F    +  PS D++++ +K IS+EL +ASVD  L     KN  K + + C K EQ +ST  +++Q+IGP    Q+ N  +IN +++ +  +   I        +    +   L+    L  + +QPL+ +++ ++E II T+H E F   LS+    +   SL M EL GFI R    YF  I   D +    + I  +  E+++ H +L+RP  + G  +L  D  Q E+A+   C R   VS+      YR LR  + +L Q    I  +  V D     ++P S +LH LF+R+PSELKSPH    WS+ RY  WL  HPSE DRL  I+GAL+AY   +R ++ K +A IY  M+ +L+ A   +
Sbjct:   20 DFLAGDFDVKTYTAQAIHHAVIAEQLAKLAQGISQLDKELHSQVVARHEDLLSQATGIESLEGVLQMMQTRISALQAAVDRIRTKIVDPYNKIVARITQLARLQVACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLNELDYLSQGVDLSGIEVIENDLLLISRARLEVENQAKRLLEQGMEIQNPTQVGTALQVFYNLGSLRETIGSVVGGYRTSIQDNITSALDI---------KGLTQPANPRGAPGRAVLPTPGNTAAFRAALWTNLEKLMDQICAACRQVQHLQKVLMKKRDPVTHVCFI---------------------DEISKDGQPDILYTFWTDVTNTLSEEFHR--ATEASSFLKQAFEGEYPKLLRLYNELWRRLQQYSASLQGALTSSVGMDASLDITTTETDSQDLFTHGKQDYSPEKALKDSLQPYEAAYLSKSLSRLFDPINLVFPMGGRNPPSSDELDSIIKTISSELNVASVDPDLSLAVAKNAAKTVQLFCVKSEQLLSTQGDASQVIGPLTEGQRRNVAVINSLYRLQQAVTKIISGLGSCPPAAADALSSSLEGVQALMSSAVQPLLQSVSDSIEAIIITLHQEDFSGPLSSPDKPDVPCSLYMKELQGFISRVMSDYFRHIQCVDFIYESTESIAQRAIELFIRHASLLRPLGEGGKMRLAADFAQMEMAVGPLCRR---VSDL--GRPYRMLRSFRPLLFQTSELIANSPAVGD-----LIPYSTLLHFLFTRAPSELKSPHQRAEWSIARYSQWLDDHPSERDRLTLIRGALEAYVQSVRSRQGKEFASIYPIMLQLLQRATSGS 810          
BLAST of Component of oligomeric golgi complex 5 vs. TrEMBL
Match: A0A3B4XP02 (Component of oligomeric golgi complex 5 OS=Seriola lalandi dorsalis OX=1841481 GN=COG5 PE=4 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 9.514e-133
Identity = 268/833 (32.17%), Postives = 423/833 (50.78%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKL------LNHAVIQKDDVNRN----YVELDNMKF---------NQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFN-KSEKLPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFC--LSN---IETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALKNN 2487
            +F + D D  +     +    + + L ++   I+ L+++L + V+A+H+DL+S A GIE LEGVL+MM  R S L+   D+IR K+ +P+N +  RI QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E    L +     + ++A  LL+   E  N   +G ALQ+F NL  L +++  +V  ++    +N+   ++I         K   Q +  +  PGRA +PT    A+FRA+ WT ++KL++ + ++   V  L K L  KRD ++  C I                     + IS  G     Y  W  +++ LS+ F    A++ S FLK+  E EYPKLL+L+ +L  +L      L  A+     ++ +      E D+             +K  K  L  +E A+LS SLS+LFD +   F       PS D++++ +K IS+EL +ASVD  L     KN  K + + C K EQ +ST  +++Q+IGP    Q+ N  +IN +++ +  +   I        +    +   L+    L  + +QPL+ +++ ++E II T+H E F   LS+    +   SL M EL GFI R    YF  I   D +    + I  +  E+++ H +L+RP  + G  +L  D  Q E+A+   C R   VS+      YR LR  + +L Q    I  +  V D     ++P S +LH LF+R+PSELKSPH    WS+ RY  WL  HPSE DRL  I+GAL+AY   +R ++ K +A IY  M+ +L+ A   +
Sbjct:   20 DFLAGDFDVKTYTAQAIHHAVIAEQLAKLAQGISQLDKELHSQVVARHEDLLSQATGIESLEGVLQMMQTRISALQAAVDRIRTKIVDPYNKIVARITQLARLQVACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLNELDYLSQGVDLSGIEVIENDLLLISRARLEVENQAKRLLEQGMEIQNPTQVGTALQVFYNLGSLRETIGSVVGGYRTSIQDNITSALDI---------KGLTQPANPRGAPGRAVLPTPGNTAAFRAALWTNLEKLMDQICAACRQVQHLQKVLMKKRDPVTHVCFI---------------------DEISKDGQPDILYTFWTDVTNTLSEEFHR--ATEASSFLKQAFEGEYPKLLRLYNELWRRLQQYSASLQGALTSSAGIDASLDITATETDSQDLFTHGKQDYSPEKALKDSLQPYEAAYLSKSLSRLFDPINLVFPIGGRNPPSSDELDSIIKTISSELNVASVDPDLSLAVAKNAAKTVQLFCVKSEQLLSTQGDASQVIGPLTEGQRRNVAVINSLYRLQQAVTKIISGLGSCPPAAADALSSSLEGVQALMSSAVQPLLQSVSDSIEAIIITLHQEDFSGPLSSPDKPDVPCSLYMKELQGFISRVMSDYFRHIQCVDFIYESTESIAQRAIELFIRHASLLRPLGEGGKMRLAADFAQMEMAVGPLCRR---VSDL--GRPYRMLRSFRPLLFQTSELIANSPAVGD-----LIPYSTLLHFLFTRAPSELKSPHQRAEWSIARYSQWLDDHPSERDRLTLIRGALEAYVQSVRARQGKEFASIYPIMLQLLQRATSGS 810          
BLAST of Component of oligomeric golgi complex 5 vs. TrEMBL
Match: A0A1V4K022 (Conserved oligomeric Golgi complex subunit 5 OS=Patagioenas fasciata monilis OX=372326 GN=COG5 PE=4 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 4.918e-132
Identity = 267/829 (32.21%), Postives = 428/829 (51.63%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQYQLWISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKDDVNRN---------YVELDNMKFN--------------QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLS-----NIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESAL 2478
            +F  +D D  +  +  + Q  + + L ++   I+ L+++L   V+A+H+DL++ A GIE LEGVL+MM  R   L++  D+IRVK+ +P+N +  R  QL  +Q  C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L D++  +V  +     EN+K  ++I ++ Q S   T       +  PGRAA+PT    A+FRA+ WT ++KL++ + ++   V  L K L  KRD +S  C I                + +  +  S+  Y++   ++  LS  F+   A+D S FLK+  E EYPKLL+L+ DL  +L  ++     ++ RN         + EL  M+ +              +K  K  L ++E A+LS SLS+LFD +   F    +  PS D++++ +K I++EL +A+VD  L     KN+ K I +   K EQ +ST  +++Q+IGP    Q+ N  ++N ++K   ++   I  Q     + +  V   L     L  + +QPL++++  ++E II T+H E F  S       +   SL M EL GFI R    YF      D +    + +  +  E+++ H +LIRP  + G  +L  D  Q E+A+   C R   VS+   +  YR+LR  + +L Q    I  +       +  V+P S +L  LF+R+P ELKSP     WS+ RY  WL  HPSE DRL  I+GAL+AY   +R +E+K +A +Y  M+ +L+ A+
Sbjct:   22 DFFREDFDVKAYTSQSIHQAVIAEQLAKLAQGISQLDKELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQSTVDRIRVKIVDPYNKIVSRTAQLAKLQAACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLNELDYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQGVETQNPTQVGTALQVFHNLGTLKDTIANVVDGYCTGLEENIKSALDIKVLTQPSQTAT-------RGGPGRAAMPTPGNTAAFRAALWTNMEKLMDQICAACGQVQHLQKVLTKKRDPVSHVCFI----------------EEILKDGQSDILYKFWTAVTQTLSSQFQS--ATDSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYS----QNIQRNFNTSGTTDLFAELQQMEEDTQDIFMQKKQDYDPEKALKDSLQQYEAAYLSKSLSRLFDPINLVFPPGGRNPPSSDELDSIIKTIASELNVAAVDPDLSLAVAKNVAKTIQLYGVKSEQLLSTQGDASQVIGPLTEGQRRNVAVVNSLYKLHQSVLKVITNQSSFPAAAEQTVTTALKVVHDLMGSAVQPLLNSVGDSVEAIIITMHQEDFSGSLPSSGKPDVPCSLYMKELQGFIARVMSDYFRHFECFDFVFDNTEAMAQRAIELFIRHASLIRPLGEGGKMRLAADFAQMELAVAPLCRR---VSDLGKS--YRQLRSFRPLLFQTSEHIASS-----PALGEVIPFSIILQFLFARAPPELKSPFQRAEWSIARYSQWLDDHPSEKDRLALIRGALEAYVQSVRTREEKEFAPVYPIMVQLLQKAM 811          
BLAST of Component of oligomeric golgi complex 5 vs. TrEMBL
Match: A0A2I0MH78 (Component of oligomeric golgi complex 5 OS=Columba livia OX=8932 GN=COG5 PE=4 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 5.023e-132
Identity = 267/829 (32.21%), Postives = 428/829 (51.63%), Query Frame = 1
Query:   91 NFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQYQLWISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKDDVNRN---------YVELDNMKFN--------------QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLS-----NIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESAL 2478
            +F  +D D  +  +  + Q  + + L ++   I+ L+++L   V+A+H+DL++ A GIE LEGVL+MM  R   L++  D+IRVK+ +P+N +  R  QL  +Q  C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E            + ++A  LL+   ET N   +G ALQ+F NL  L D++  +V  +     EN+K  ++I ++ Q S   T       +  PGRAA+PT    A+FRA+ WT ++KL++ + ++   V  L K L  KRD +S  C I                + +  +  S+  Y++   ++  LS  F+   A+D S FLK+  E EYPKLL+L+ DL  +L  ++     ++ RN         + EL  M+ +              +K  K  L ++E A+LS SLS+LFD +   F    +  PS D++++ +K I++EL +A+VD  L     KN+ K I +   K EQ +ST  +++Q+IGP    Q+ N  ++N ++K   ++   I  Q     + +  V   L     L  + +QPL++++  ++E II T+H E F  S       +   SL M EL GFI R    YF      D +    + +  +  E+++ H +LIRP  + G  +L  D  Q E+A+   C R   VS+   +  YR+LR  + +L Q    I  +       +  V+P S +L  LF+R+P ELKSP     WS+ RY  WL  HPSE DRL  I+GAL+AY   +R +E+K +A +Y  M+ +L+ A+
Sbjct:   22 DFFREDFDVKAYTSQSIHQAVIAEQLAKLAQGISQLDKELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQSTVDRIRVKIVDPYNKIVSRTAQLAKLQAACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLNELDYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQGVETQNPTQVGTALQVFHNLGTLKDTIANVVDGYCTGLEENIKNALDIKVLTQPSQAAT-------RGGPGRAAMPTPGNTAAFRAALWTNMEKLMDQICAACGQVQHLQKVLTKKRDPVSHVCFI----------------EEILKDGQSDILYKFWTAVTQTLSSQFQS--ATDSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYS----QNIQRNFNTSGTTDLFAELQQMEEDTQDIFMQKKQDYDPEKALKDSLQQYEAAYLSKSLSRLFDPINLVFPPGGRNPPSSDELDSIIKTIASELNVAAVDPDLSLAVAKNVAKTIQLYGVKSEQLLSTQGDASQVIGPLTEGQRRNVAVVNSLYKLHQSVLKVITNQSSFPAAAEQTVTTALKVVHDLMGSAVQPLLNSVGDSVEAIIITMHQEDFSGSLPSSGKPDVPCSLYMKELQGFIARVMSDYFRHFECFDFVFDNTEAMAQRAIELFIRHASLIRPLGEGGKMRLAADFAQMELAVAPLCRR---VSDLGKS--YRQLRSFRPLLFQTSEHIASS-----PALGEVIPFSIILQFLFARAPPELKSPFQRAEWSIARYSQWLDDHPSEKDRLALIRGALEAYVQSVRTREEKEFAPVYPIMVQLLQKAM 811          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Cavefish
Match: COG5 (component of oligomeric golgi complex 5 [Source:HGNC Symbol;Acc:HGNC:14857])

HSP 1 Score: 406.371 bits (1043), Expect = 2.257e-128
Identity = 248/807 (30.73%), Postives = 414/807 (51.30%), Query Frame = 1
Query:  154 LGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKR----LKDHQRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAV------------------IQKDDVNRNYVELDNMKFNQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSE-KLPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESF-----CLSNIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESA 2475
            + + L ++   I+ L+ +L   V+A+H+DL++HA GIE LEGVLEMM  R + L++  D+IR K+ +P+N + +R  QL  +Q+ C+ LR+IIRI  L KR    L+   R+ TK + ++NEL Y     D  GI ++E    L +     + ++A  +L+   E  N + +G ALQ+F NL  L +++  +V  ++    E++   +++         K   Q +  +  PGRA +P     A+FRA+ WT ++KL++ + S+   V  L K L  KRD ++  C I                     + I   G+    Y  W  ++  LS   +   ++  S FLK+ LE EYPKLL+L+ +L  +L  ++                   + ++D+   +         +K  K  L  +E A+LS SLS+LFD +   F +     P+ D++++ +K I++EL +A VD  L     KN+ K + + C K EQ + T  +++Q+IGP    Q+ N  ++N +++ +  + + +I  L +    +  +   L+    L  + +QPL+ ++T ++E I+ T+H E F          +   SL M EL GF+ R    YF  +   D L    + +  +   +++ H  L+RP  + G  +L  D  Q E+A+  FC R   VS+     +YR LR  + +L Q    I  +  V D     ++P S +LH LF+R+P+ELKSPH    WSV RY  WL  HPSE DRL  I+GAL+AY   +R ++ K++A +Y  M+ +L+ A
Sbjct:   82 IAEQLAKLAQGISQLDRELHCQVVARHEDLLAHATGIESLEGVLEMMETRIAALQSAVDRIRTKIVDPYNKIVVRTSQLARLQVACDLLRRIIRILYLSKRLQVQLQGGSRELTKAAQSLNELDYLSQGVDLSGIDVIENDLLLISRVRLEVENQAKRILEQGMEIQNPSQVGTALQVFYNLGSLRETIISVVDGYKASVQESITSALDV---------KVLTQPANTRGAPGRAVIPIPGNTATFRAALWTNLEKLMDHICSACSQVQHLQKVLTKKRDPVTHVCFI---------------------DEIVKEGHPDILYIFWNSVTQMLSVELKK--STQASTFLKQALEGEYPKLLRLYNELWKRLQQYSAKIQVVPVGSGSGLEFDSTVTENDIQDLFTNTKQEYDPEKSLKESLQPYEAAYLSKSLSRLFDPINLVFPQGGYSPPASDEMDSIIKTIASELNVALVDPGLTVAVAKNVAKTVQLFCVKSEQLLCTQGDASQVIGPLTEGQRRNVAVVNSLYQLQQAV-SKVISALSIPVDAEQSLTASLESVQALMDSAVQPLLMSVTDSVEAILITMHQEDFSGPIPAGDKPDMPCSLYMRELQGFVTRVMNDYFRPLQCLDFLYDRTEGVAQRAITLFIRHACLLRPLGEGGKMRLAADFAQMELAIAPFCRR---VSDL--GKVYRLLRSFRPLLFQTSEHISSSQAVGD-----LIPYSTILHFLFTRAPAELKSPHQRAEWSVARYSQWLDDHPSEKDRLVLIRGALEAYVQSVRARQGKNFAPVYPVMLHLLQKA 845          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Cavefish
Match: COG5 (component of oligomeric golgi complex 5 [Source:HGNC Symbol;Acc:HGNC:14857])

HSP 1 Score: 400.208 bits (1027), Expect = 5.807e-126
Identity = 245/787 (31.13%), Postives = 404/787 (51.33%), Query Frame = 1
Query:  214 THVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLK----DHQRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAV------------------IQKDDVNRNYVELDNMKFNQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSE-KLPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESF-----CLSNIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESA 2475
            T V+A+H+DL++HA GIE LEGVLEMM  R + L++  D+IR K+ +P+N + +R  QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + ++NEL Y     D  GI ++E    L +     + ++A  +L+   E  N + +G ALQ+F NL  L +++  +V  ++    E++   +++         K   Q +  +  PGRA +P     A+FRA+ WT ++KL++ + S+   V  L K L  KRD ++  C I                     + I   G+    Y  W  ++  LS   + +  +  S FLK+ LE EYPKLL+L+ +L  +L  ++                   + ++D+   +         +K  K  L  +E A+LS SLS+LFD +   F +     P+ D++++ +K I++EL +A VD  L     KN+ K + + C K EQ + T  +++Q+IGP    Q+ N  ++N +++ +  + + +I  L +    +  +   L+    L  + +QPL+ ++T ++E I+ T+H E F          +   SL M EL GF+ R    YF  +   D L    + +  +   +++ H  L+RP  + G  +L  D  Q E+A+  FC R   VS+     +YR LR  + +L Q    I  +  V D     ++P S +LH LF+R+P+ELKSPH    WSV RY  WL  HPSE DRL  I+GAL+AY   +R ++ K++A +Y  M+ +L+ A
Sbjct:  110 TQVVARHEDLLAHATGIESLEGVLEMMETRIAALQSAVDRIRTKIVDPYNKIVVRTSQLARLQVACDLLRRIIRILYLSKRLQVQLQGGSRELTKAAQSLNELDYLSQGVDLSGIDVIENDLLLISRVRLEVENQAKRILEQGMEIQNPSQVGTALQVFYNLGSLRETIISVVDGYKASVQESITSALDV---------KVLTQPANTRGAPGRAVIPIPGNTATFRAALWTNLEKLMDHICSACSQVQHLQKVLTKKRDPVTHVCFI---------------------DEIVKEGHPDILYIFWNSVTQMLSVELKKS--TQASTFLKQALEGEYPKLLRLYNELWKRLQQYSAKIQVVPVGSGSGLEFDSTVTENDIQDLFTNTKQEYDPEKSLKESLQPYEAAYLSKSLSRLFDPINLVFPQGGYSPPASDEMDSIIKTIASELNVALVDPGLTVAVAKNVAKTVQLFCVKSEQLLCTQGDASQVIGPLTEGQRRNVAVVNSLYQLQQAV-SKVISALSIPVDAEQSLTASLESVQALMDSAVQPLLMSVTDSVEAILITMHQEDFSGPIPAGDKPDMPCSLYMRELQGFVTRVMNDYFRPLQCLDFLYDRTEGVAQRAITLFIRHACLLRPLGEGGKMRLAADFAQMELAIAPFCRR---VSDL--GKVYRLLRSFRPLLFQTSEHISSSQAVGD-----LIPYSTILHFLFTRAPAELKSPHQRAEWSVARYSQWLDDHPSEKDRLVLIRGALEAYVQSVRARQGKNFAPVYPVMLHLLQKA 853          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Cavefish
Match: COG5 (component of oligomeric golgi complex 5 [Source:HGNC Symbol;Acc:HGNC:14857])

HSP 1 Score: 353.214 bits (905), Expect = 1.213e-109
Identity = 227/757 (29.99%), Postives = 377/757 (49.80%), Query Frame = 1
Query:  289 MMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKR----LKDHQRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQYQLWISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAV------------------IQKDDVNRNYVELDNMKFNQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSE-KLPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESF-----CLSNIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESA 2475
            MM  R + L++  D+IR K+ +P+N + +R  QL  +Q+ C+ LR+IIRI  L KR    L+   R+ TK + ++NEL Y     D  GI ++E    L +     + ++A  +L+   E  N + +G ALQ+F NL  L +++  +V  ++    E++   +++         K   Q +  +  PGRA +P     A+FRA+ WT ++KL++ + S+   V  L K L  KRD ++  C I                  +      N  Y + + IS   S  F        S FLK+ LE EYPKLL+L+ +L  +L  ++                   + ++D+   +         +K  K  L  +E A+LS SLS+LFD +   F +     P+ D++++ +K I++EL +A VD  L     KN+ K + + C K EQ + T  +++Q+IGP    Q+ N  ++N +++ +  + + +I  L +    +  +   +D       + +QPL+ ++T ++E I+ T+H E F          +   SL M EL GF+ R    YF  +   D L    + +  +   +++ H  L+RP  + G  +L  D  Q E+A+  FC R   VS+     +YR LR  + +L Q    I  +  V D     ++P S +LH LF+R+P+ELKSPH    WSV RY  WL  HPSE DRL  I+GAL+AY   +R ++ K++A +Y  M+ +L+ A
Sbjct:    1 MMETRIAALQSAVDRIRTKIVDPYNKIVVRTSQLARLQVACDLLRRIIRILYLSKRLQVQLQGGSRELTKAAQSLNELDYLSQGVDLSGIDVIENDLLLISRVRLEVENQAKRILEQGMEIQNPSQVGTALQVFYNLGSLRETIISVVDGYKASVQESITSALDV---------KVLTQPANTRGAPGRAVIPIPGNTATFRAALWTNLEKLMDHICSACSQVQHLQKVLTKKRDPVTHVCFI----------------DEIVKVKKKNIPYIFYMKIS-LFSVLF-------SSTFLKQALEGEYPKLLRLYNELWKRLQQYSAKIQVVPVGSGSGLEFDSTVTENDIQDLFTNTKQEYDPEKSLKESLQPYEAAYLSKSLSRLFDPINLVFPQGGYSPPASDEMDSIIKTIASELNVALVDPGLTVAVAKNVAKTVQLFCVKSEQLLCTQGDASQVIGPLTEGQRRNVAVVNSLYQLQQAV-SKVISALSIPVDAEQSLTALMD-------SAVQPLLMSVTDSVEAILITMHQEDFSGPIPAGDKPDMPCSLYMRELQGFVTRVMNDYFRPLQCLDFLYDRTEGVAQRAITLFIRHACLLRPLGEGGKMRLAADFAQMELAIAPFCRR---VSDL--GKVYRLLRSFRPLLFQTSEHISSSQAVGD-----LIPYSTILHFLFTRAPAELKSPHQRAEWSVARYSQWLDDHPSEKDRLVLIRGALEAYVQSVRARQGKNFAPVYPVMLHLLQKA 706          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Nematostella
Match: EDO43304 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYX8])

HSP 1 Score: 259.225 bits (661), Expect = 1.132e-75
Identity = 193/692 (27.89%), Postives = 324/692 (46.82%), Query Frame = 1
Query:  514 YHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQYQLWISDK--LSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKL----LNHAVIQK-----------DDVNRNYVELDNMKFN----------QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLSNI--ETESSLMMC-----ELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALKN 2484
            Y     D   I ++ +  ++      ++ ++A  +L    E  NQ  +  ALQ+F NL  L+ +V+ +V   ++       K      +  ++   + N   G    PGRA++P     A +RA+ WT ++KL++ + S+   V  L K L  KRD ++  C                + + L  E  ++       W S    LS+ F DA  +  S FLK+  E EYPKLL+L+ DL  +L     N AV Q+           D   R   ++   K            +   K  L  F+ A++S SLS+LFD +   F    +  P  +++ +  K I +EL++ASVD  L     KN+ K + +   K E  + +  E+ Q+     + Q      +N +++    +   +     L +   + ++  L   + L    + PL+D     L++++  +HSE F  +++   T SS   C     +++ FI+  + ++       DL++  L+ +  ++ EI++ H +L+RP  + G  KL  D+ Q E A+   C +   VS+      Y+ LR  + +L Q  P IV+N  + +      LP S VLH+LFSR+PSELKSPH   GW++  Y  WL  H SE +RL  I+G L+AYA  IR + +K YAE+Y  M+ IL+   K+
Sbjct:    2 YLVQGADLSEIQVISQDIKMIAEARKDVENQAKQMLSQGMEGQNQTQVATALQVFYNLGCLSTTVDGLVERLRDGL-----KTSLNEALDASTLSHSQNSGGG----PGRASMPMPGNSALWRAALWTRMEKLMDVIFSACAQVYHLLKVLAKKRDPVTHVC----------------FMEELIKEGNTSV---ITFWDSATSILSEEFADA--AQTSTFLKQAFEGEYPKLLRLYNDLWVRLQQFHTNTAVNQQEPAYGLFRKTEDSETRYCTKVKGTKTGFITTHSPWGAEDMLKQSLSPFQTAYISRSLSRLFDSINLVFPSGARNPPQREELTSIAKTIGSELSVASVDVGLTITVAKNVSKTLQMYTAKCETLLPSGKEAGQVQDHVTSGQLRGIATVNSLYQLHLAVTKILSGIKSLPDVAVVSIRSGLQGMVALMNAALDPLIDAFVGELDQLLYRMHSEDFSSTSLAKHTSSSDTPCSGYIKQVEDFIQGIQRRHLSMFECTDLVLERLEPVACRVLEIFVCHASLLRPIGEGGKLKLAADMAQIEFAVGPLCRK---VSDL--GKPYKLLRSFRPLLFQTSPKIVDNPALGES-----LPYSVVLHYLFSRAPSELKSPHEVAGWTLSFYSNWLDDHKSEGERLALIRGTLEAYAQSIRSRGEKEYAEVYPIMLCILQEGSKS 653          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Medaka
Match: COG5 (component of oligomeric golgi complex 5 [Source:NCBI gene;Acc:101156786])

HSP 1 Score: 422.165 bits (1084), Expect = 7.337e-135
Identity = 260/832 (31.25%), Postives = 419/832 (50.36%), Query Frame = 1
Query:   79 DILINFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQTHVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKD-----------DVNRNYVELDNMKFN-------QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESF-----CLSNIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESA 2475
            D    F  DD D  + A  ++Q   + + L  +   I+ L+++L   V+A+H+DL++ A GIE LEGVL+MM  R S L+   D+++ K+ +P+N +  RI QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + +++EL Y     D  GI ++E    L +     + ++A  LL+   E  N + +G ALQ+F NL  L +++  +V  +Q    +++   ++I         K     +  +  PGRAA+P     A+ RA+ WT ++KL++ + ++   V  L K L  KRD +S  C I                     E I   G     Y  W  ++  L+  F    A++ S FLK+ LE EYPKLL+L+ +L  +L  H+   +            D+     +   +  N       +K  K  L ++E A+LS SLS+LFD +   F   E+  PS+D+++  +K IS+EL +A+VD HL T   KN  K + + C K EQ + T  +++Q+IGP    Q+ N  ++N +++ +  +   +   +         +   L+    L  + + PL+ +++ ++E II T+H E F          +   SL M EL GFI R    YF      D +    + I  +  ++++ H +L+RP  + G  +L  D  Q E+A+   C R   VS+   +  YR LR  +  L Q    I  +  V D     ++P S +LH LFSR+P ELKSPH    WSV RY  WL  HPSE DRL+ I+GAL+AY   +R ++ K++A +Y  M+ +L+ A
Sbjct:   16 DCYTEFVGDDFDVKTYAAQVIQHAVIAEQLGGLAQGISRLDKELHGQVVARHEDLLAQATGIESLEGVLQMMQTRISALQAAVDRMKTKIVDPYNKIVARITQLARLQVACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLHELDYLSQGVDLSGIEVIENDLLLISRARLEVENQAKRLLEQGMEIQNPSQVGTALQVFYNLGSLGETIRSVVGGYQTAIKDHICSALDI---------KGLTVPANPRGAPGRAALPAPGNTAACRAALWTNLEKLMDHICAAWTQVQHLQKVLMKKRDPVSHVCFI---------------------EEIVKDGQPDILYTFWTDVTSTLNDEFHR--AAEASSFLKQALEGEYPKLLRLYNELWRRLQQHSTGPQGAPTSAAMDASLDIGTTETDASELFMNIKQDYNPEKALKDSLQDYESAYLSKSLSRLFDPINLVFPLGERSPPSNDELDGIIKTISSELNVAAVDPHLSTSVAKNAAKTVQLFCVKSEQLLCTQGDASQVIGPLTEGQRRNVGVVNSLYRLQQGVLKILSGLVSCPPPAVEALSSSLEAVHSLMGSALAPLLQSVSDSIEAIIFTLHQEDFSGPVSSPDRPDVPCSLYMKELQGFISRVMADYFRPFQCADFIYEKTEAIAQRAIQLFVRHASLLRPLGEGGKMRLAADFAQMEMAVAPLCRR---VSDLGKS--YRMLRSFRPFLFQTSELIAASPAVGD-----LIPFSTLLHFLFSRAPPELKSPHQRAEWSVARYSQWLDDHPSERDRLSLIRGALEAYVQSVRTRQGKNFAPVYPIMLQVLQKA 805          
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Medaka
Match: COG5 (component of oligomeric golgi complex 5 [Source:NCBI gene;Acc:101156786])

HSP 1 Score: 379.793 bits (974), Expect = 2.143e-119
Identity = 244/786 (31.04%), Postives = 392/786 (49.87%), Query Frame = 1
Query:  217 HVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDH----QRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQ---YQLW--ISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKD-----------DVNRNYVELDNMKFN-------QKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK-LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLS-----NIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESA 2475
             V+A+H+DL++ A GIE LEG  E +      +K        K+ +P+N +  RI QL  +Q+ C+ LR+IIRI  L KRL+       R+ TK + +++EL Y     D  GI ++E    L +     + ++A  LL+   E  N + +G ALQ+F NL  L +++  +V  +Q    +++   ++I         K     +  +  PGRAA+P     A+ RA+ WT ++KL++ + ++   V  L K L  KRD +S  C I                     E I   G     Y  W  ++  L+  F  A  ++ S FLK+ LE EYPKLL+L+ +L  +L  H+   +            D+     +   +  N       +K  K  L ++E A+LS SLS+LFD +   F   E+  PS+D+++  +K IS+EL +A+VD HL T   KN  K + + C K EQ + T  +++Q+IGP    Q+ N  ++N +++ +  +       L++++ +  I    +     L  + + PL+ +++ ++E II T+H E F          +   SL M EL GFI R    YF      D +    + I  +  ++++ H +L+RP  + G  +L  D  Q E+A+   C R   VS+   +  YR LR  +  L Q    I  +  V D     ++P S +LH LFSR+P ELKSPH    WSV RY  WL  HPSE DRL+ I+GAL+AY   +R ++ K++A +Y  M+ +L+ A
Sbjct:   14 QVVARHEDLLAQATGIESLEGDAEPLLFLDREMKT-------KIVDPYNKIVARITQLARLQVACDLLRRIIRILYLSKRLQGQLQGGSREITKAAQSLHELDYLSQGVDLSGIEVIENDLLLISRARLEVENQAKRLLEQGMEIQNPSQVGTALQVFYNLGSLGETIRSVVGGYQTAIKDHICSALDI---------KGLTVPANPRGAPGRAALPAPGNTAACRAALWTNLEKLMDHICAAWTQVQHLQKVLMKKRDPVSHVCFI---------------------EEIVKDGQPDILYTFWTDVTSTLNDEFHRA--AEASSFLKQALEGEYPKLLRLYNELWRRLQQHSTGPQGAPTSAAMDASLDIGTTETDASELFMNIKQDYNPEKALKDSLQDYESAYLSKSLSRLFDPINLVFPLGERSPPSNDELDGIIKTISSELNVAAVDPHLSTSVAKNAAKTVQLFCVKSEQLLCTQGDASQVIGPLTEGQRRNVGVVNSLYRLQQGV-------LKVTKHSSTI-SSNISAVHSLMGSALAPLLQSVSDSIEAIIFTLHQEDFSGPVSSPDRPDVPCSLYMKELQGFISRVMADYFRPFQCADFIYEKTEAIAQRAIQLFVRHASLLRPLGEGGKMRLAADFAQMEMAVAPLCRR---VSDLGKS--YRMLRSFRPFLFQTSELIAASPAVGD-----LIPFSTLLHFLFSRAPPELKSPHQRAEWSVARYSQWLDDHPSERDRLSLIRGALEAYVQSVRTRQGKNFAPVYPIMLQVLQKA 742          
BLAST of Component of oligomeric golgi complex 5 vs. Planmine SMEST
Match: SMESG000034878.1 (SMESG000034878.1)

HSP 1 Score: 1469.52 bits (3803), Expect = 0.000e+0
Identity = 748/748 (100.00%), Postives = 748/748 (100.00%), Query Frame = 1
Query:  244 MSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDHQRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCEXXXXXXXXXXXXXXSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIXXXXXXXXXXXXXXYCKRLFSESISNTGYQYQLWISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKDDVNRNYVELDNMKFNQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEKLPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLSNIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALKNN 2487
            MSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDHQRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCENLKKIVNINLIIQNSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIETLLDSDEKEELDEYCKRLFSESISNTGYQYQLWISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKDDVNRNYVELDNMKFNQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEKLPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLSNIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALKNN
Sbjct:    1 MSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNNLTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDHQRDPTKVSVAINELRYHFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIALQIFRNLHMLTDSVNRIVSNWQNEFCENLKKIVNINLIIQNSFKKTTNQISGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTLYIKRDMISQKCLIETLLDSDEKEELDEYCKRLFSESISNTGYQYQLWISDKLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKDDVNRNYVELDNMKFNQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEKLPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCISTDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQLIVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLSNIETESSLMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIRPTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVLLQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSVMRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAILESALKNN 748          
The following BLAST results are available for this feature:
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COG52.912e-12931.81component of oligomeric golgi complex 5 [Source:HG... [more]
COG52.047e-12831.69component of oligomeric golgi complex 5 [Source:HG... [more]
COG53.640e-12731.81component of oligomeric golgi complex 5 [Source:HG... [more]
COG52.965e-12631.69component of oligomeric golgi complex 5 [Source:HG... [more]
COG51.055e-11831.49component of oligomeric golgi complex 5 [Source:HG... [more]
back to top
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cogc-58.813e-632.91Conserved Oligomeric Golgi (COG) Component [Sourc... [more]
cogc-58.813e-632.91Conserved Oligomeric Golgi (COG) Component [Sourc... [more]
back to top
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fws4.554e-2826.52gene:FBgn0024689 transcript:FBtr0346626[more]
fws4.554e-2826.52gene:FBgn0024689 transcript:FBtr0080999[more]
fws4.554e-2826.52gene:FBgn0024689 transcript:FBtr0081000[more]
fws4.554e-2826.52gene:FBgn0024689 transcript:FBtr0305685[more]
fws4.554e-2826.52gene:FBgn0024689 transcript:FBtr0346627[more]
back to top
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cog56.836e-13031.11component of oligomeric golgi complex 5 [Source:ZF... [more]
cog51.652e-12831.07component of oligomeric golgi complex 5 [Source:ZF... [more]
cog51.364e-2536.81component of oligomeric golgi complex 5 [Source:ZF... [more]
back to top
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnip11.484e-12230.77Kv channel interacting protein 1 [Source:Xenbase;A... [more]
kcnip11.064e-12130.29Kv channel interacting protein 1 [Source:Xenbase;A... [more]
kcnip11.344e-12030.29Kv channel interacting protein 1 [Source:Xenbase;A... [more]
kcnip17.621e-11830.80Kv channel interacting protein 1 [Source:Xenbase;A... [more]
kcnip16.837e-11629.81Kv channel interacting protein 1 [Source:Xenbase;A... [more]
back to top
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cog53.122e-12531.18component of oligomeric golgi complex 5 [Source:MG... [more]
Cog51.417e-1841.38component of oligomeric golgi complex 5 [Source:MG... [more]
back to top
BLAST of Component of oligomeric golgi complex 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UP83|COG5_HUMAN1.748e-12631.81Conserved oligomeric Golgi complex subunit 5 OS=Ho... [more]
sp|Q8C0L8|COG5_MOUSE2.184e-12431.18Conserved oligomeric Golgi complex subunit 5 OS=Mu... [more]
sp|Q9C9V9|COG5_ARATH8.054e-4623.58Conserved oligomeric Golgi complex subunit 5 OS=Ar... [more]
sp|Q9VJD3|COG5_DROME5.250e-2726.52Conserved oligomeric Golgi complex subunit 5 OS=Dr... [more]
sp|Q54HE0|COG5_DICDI3.666e-1628.64Conserved oligomeric Golgi complex subunit 5 OS=Di... [more]
back to top
BLAST of Component of oligomeric golgi complex 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2TKW06.959e-13331.68Component of oligomeric golgi complex 5 OS=Takifug... [more]
A0A3B4UNP27.300e-13332.17Component of oligomeric golgi complex 5 OS=Seriola... [more]
A0A3B4XP029.514e-13332.17Component of oligomeric golgi complex 5 OS=Seriola... [more]
A0A1V4K0224.918e-13232.21Conserved oligomeric Golgi complex subunit 5 OS=Pa... [more]
A0A2I0MH785.023e-13232.21Component of oligomeric golgi complex 5 OS=Columba... [more]
back to top
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
COG52.257e-12830.73component of oligomeric golgi complex 5 [Source:HG... [more]
COG55.807e-12631.13component of oligomeric golgi complex 5 [Source:HG... [more]
COG51.213e-10929.99component of oligomeric golgi complex 5 [Source:HG... [more]
back to top
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO433041.132e-7527.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Component of oligomeric golgi complex 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
COG57.337e-13531.25component of oligomeric golgi complex 5 [Source:NC... [more]
COG52.143e-11931.04component of oligomeric golgi complex 5 [Source:NC... [more]
back to top
BLAST of Component of oligomeric golgi complex 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000034878.10.000e+0100.00SMESG000034878.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030735 ID=SMED30030735|Name=Component of oligomeric golgi complex 5|organism=Schmidtea mediterranea sexual|type=transcript|length=2564bp
CGACTATCAATTTAAATTTGTTTAGCCGGGCCTATAATAATTTATTTTAT
TGTAACAAATACGAATATGTCTAATTCAGATATTTTAATTAATTTTTCTT
CTGATGATATCGACCCAGCAAGTCTCGCCAATACAATCTTACAACAGAAA
GATTTGGGAAAGTATTTAAGAGAAATCACAAATGAAATCAACAATCTGAA
TGAGCAATTACAAACTCATGTCATAGCAAAACACGATGATTTAATGAGCC
ATGCAGTTGGAATAGAAAAACTGGAAGGAGTTTTGGAAATGATGTGCTGT
AGAACTTCTAATTTAAAAAATCACGCTGACAAAATTCGAGTTAAATTAGA
AGAACCGTTTAATAATCTGACATTGAGGATTCAACAGTTAGATAATATGC
AAATCACATGTGAACATCTTCGAAAAATTATTAGAATAAATTGTTTAGTT
AAAAGATTAAAAGACCATCAACGAGATCCTACTAAAGTATCGGTAGCAAT
TAATGAGTTGAGATACCATTTCAGCACCACCGACTGGAAAGGAATACACA
TTCTCGAAAAGCATTACGAATTAACAAATCTCACAGTTAACAACCTAATC
GATGAAGCTTGGTCATTATTAAAGCTCGTAAAAGAAACAAACAACCAAGC
CATGCTCGGAATTGCATTACAAATTTTCCGCAACCTCCACATGCTGACTG
ACAGCGTCAACAGAATCGTATCGAATTGGCAGAATGAATTCTGTGAAAAC
TTGAAGAAAATCGTCAATATAAATCTGATAATTCAAAATTCATTCAAGAA
AACTACAAACCAAATCAGTGGCAATAAAGCCACTCCAGGACGAGCGGCTG
TCCCAACTGGTGAACAGGTGGCATCATTTCGAGCTTCTTTCTGGACTGCC
GTTGATAAATTGGTAAATAGTGTCGAATCTAGCATGTTAAATGTTCTACT
TTTATCTAAAACCCTCTATATCAAACGTGACATGATATCCCAGAAATGTC
TAATTGAAACTTTGTTGGATTCCGATGAAAAAGAGGAACTTGACGAATAC
TGTAAAAGACTTTTCAGCGAAAGCATATCAAATACTGGCTATCAGTATCA
GCTTTGGATATCTGATAAACTGAGTCAAGCATTTCGTGATGCAATTGCCT
CAGACGAATCTGGTTTTCTAAAGAAAACATTGGAGAATGAGTATCCGAAA
TTGCTTAAACTATTTATGGATCTCAACGCAAAGCTACTGAACCACGCCGT
CATTCAAAAAGATGATGTCAATCGAAATTATGTCGAACTAGATAACATGA
AGTTCAATCAAAAATATTTCAAAACATTTCTGGTTGAGTTTGAGCAAGCA
TTTCTCTCTATATCATTGTCTAAACTATTTGACATTGTCCAATTCGCATT
CAATAAGTCTGAAAAATTACCGTCTGATGATGATATCAATAATTTTGTGA
AAAATATCTCGACAGAACTTACCTTAGCCTCTGTTGATTCCCATCTACTG
ACGCAGAGTTGTAAAAACCTGGGTAAAATGATTGATATTATCTGCACAAA
ATTCGAACAGTGCATATCAACCGATAGCGAATCCAACCAAATAATTGGAC
CGGCAAATGCCAATCAGAAATGCAATTTCACCATTATAAATCTCATCCAC
AAATTCAAAAGCAACATTGAAAATTCAATTATTCGTCAATTGAGACTATC
TGAGTCCAATCAATTAATTGTAAAAGAGAAACTTGATCATTGTCTGAAGT
TGCAAATAACGGTAATCCAACCTTTAATGGATAATATCACAGCGACATTG
GAGGAGATAATTACCACTGTGCATTCGGAGAGCTTTTGCTTGTCTAACAT
AGAAACTGAATCCTCACTGATGATGTGTGAGTTGGATGGCTTCATAAAGC
GCACTCGAGTTCAATATTTTGATGAAATAAATGATGAAGATCTTTTAATA
TCATTTCTGAAGGAAATCATCAACCAGATAACAGAAATATATCTCATTCA
TTTAACTTTGATTAGACCTACTAATGATTTTGGATCACAAAAATTAGTAC
TGGATATAGAACAATTCGAAATTGCTATGCAGCATTTTTGTATTCGAAAT
CTCTCTGTTTCTAATTTTATGGATAATGCAATCTATCGAAAACTGCGAGG
TTTGAAATCAGTTCTGCTACAACCGGTTCCAGGGATTGTTGAAAATTACC
AAGTTATCGATAAAAAAGTGTTCAACGTGTTACCGACAAGTTATGTGCTA
CACCATTTATTCAGCCGTTCTCCATCAGAACTGAAATCCCCTCATATTTC
AATGGGTTGGTCGGTAATGCGTTATGTTGCTTGGTTATTGAAACATCCTT
CTGAGTCAGATCGTTTGAATTTCATTAAAGGTGCTCTTGATGCATATGCT
AACATGATTCGCCTGAAAGAACAGAAACATTATGCCGAAATCTACGTTCA
GATGATGGCGATTCTGGAAAGTGCTTTAAAAAACAATTGATTCTTTTCAA
ATGACGTTTTATGTGATTTTTATTCTCAAATAAATCTTTTTGATTGTGGG
TTTTTCAAAAAAAA
back to top

protein sequence of SMED30030735-orf-1

>SMED30030735-orf-1 ID=SMED30030735-orf-1|Name=SMED30030735-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=808bp
MSNSDILINFSSDDIDPASLANTILQQKDLGKYLREITNEINNLNEQLQT
HVIAKHDDLMSHAVGIEKLEGVLEMMCCRTSNLKNHADKIRVKLEEPFNN
LTLRIQQLDNMQITCEHLRKIIRINCLVKRLKDHQRDPTKVSVAINELRY
HFSTTDWKGIHILEKHYELTNLTVNNLIDEAWSLLKLVKETNNQAMLGIA
LQIFRNLHMLTDSVNRIVSNWQNEFCENLKKIVNINLIIQNSFKKTTNQI
SGNKATPGRAAVPTGEQVASFRASFWTAVDKLVNSVESSMLNVLLLSKTL
YIKRDMISQKCLIETLLDSDEKEELDEYCKRLFSESISNTGYQYQLWISD
KLSQAFRDAIASDESGFLKKTLENEYPKLLKLFMDLNAKLLNHAVIQKDD
VNRNYVELDNMKFNQKYFKTFLVEFEQAFLSISLSKLFDIVQFAFNKSEK
LPSDDDINNFVKNISTELTLASVDSHLLTQSCKNLGKMIDIICTKFEQCI
STDSESNQIIGPANANQKCNFTIINLIHKFKSNIENSIIRQLRLSESNQL
IVKEKLDHCLKLQITVIQPLMDNITATLEEIITTVHSESFCLSNIETESS
LMMCELDGFIKRTRVQYFDEINDEDLLISFLKEIINQITEIYLIHLTLIR
PTNDFGSQKLVLDIEQFEIAMQHFCIRNLSVSNFMDNAIYRKLRGLKSVL
LQPVPGIVENYQVIDKKVFNVLPTSYVLHHLFSRSPSELKSPHISMGWSV
MRYVAWLLKHPSESDRLNFIKGALDAYANMIRLKEQKHYAEIYVQMMAIL
ESALKNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR019465Cog5
Vocabulary: cellular component
TermDefinition
GO:0017119Golgi transport complex
Vocabulary: biological process
TermDefinition
GO:0006891intra-Golgi vesicle-mediated transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 27..54
IPR019465Conserved oligomeric Golgi complex subunit 5PFAMPF10392COG5coord: 10..131
e-value: 1.2E-15
score: 57.9
IPR019465Conserved oligomeric Golgi complex subunit 5PANTHERPTHR13228CONSERVED OLIGOMERIC GOLGI COMPLEX COMPONENT 5coord: 5..804