Protein numb

Overview
NameProtein numb
Smed IDSMED30030724
Length (bp)2371
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein numb (SMED30030724) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein numb (SMED30030724) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein numb (SMED30030724) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein numb (SMED30030724) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030724

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 27

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30030724SMESG000033358.1 Contig4439newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030724SMESG000033358.1 Contig4439uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030724SMESG000055438.1 Contig4439newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030724SMESG000055438.1 Contig4439uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030724SMESG000033358.1 dd_Smed_v4_8303_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v6_507_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v6_507_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v6_507_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neural progenitor cellSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v6_507_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30030724SMESG000016237.1 SMESG000033358.1 dd_Smed_v6_507_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030724SMESG000033358.1 dd_Smed_v4_8303_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30030724SMESG000033358.1 SMED30030724smed_20140614PMID:28807895
Sasidharan et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein numb vs. Ensembl Human
Match: NUMB (NUMB endocytic adaptor protein [Source:HGNC Symbol;Acc:HGNC:8060])

HSP 1 Score: 250.751 bits (639), Expect = 6.999e-73
Identity = 153/357 (42.86%), Postives = 207/357 (57.98%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------------RRLDPQSVIIAEPXXXXXXX------------XXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFS--DDPFSAAPINPAVHI 1095
            ++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L     K    +A+L+VS D LRV +E +K LIVDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE              ++ +   +++   V+  N A             +T+  +  P +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK  +      IK  V E + E +++++    I                        TN FS  +DPFS+AP+   V +
Sbjct:   20 SRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKATGKKAV--KAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFP-----IKNAVPEVEGEAESISSLCSQI------------------------TNAFSTPEDPFSSAPMTKPVTV 345          
BLAST of Protein numb vs. Ensembl Human
Match: NUMB (NUMB endocytic adaptor protein [Source:HGNC Symbol;Acc:HGNC:8060])

HSP 1 Score: 250.751 bits (639), Expect = 1.966e-72
Identity = 153/357 (42.86%), Postives = 207/357 (57.98%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------------RRLDPQSVIIAEPXXXXXXX------------XXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFS--DDPFSAAPINPAVHI 1095
            ++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L     K    +A+L+VS D LRV +E +K LIVDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE              ++ +   +++   V+  N A             +T+  +  P +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK  +      IK  V E + E +++++    I                        TN FS  +DPFS+AP+   V +
Sbjct:   20 SRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKATGKKAV--KAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFP-----IKNAVPEVEGEAESISSLCSQI------------------------TNAFSTPEDPFSSAPMTKPVTV 345          
BLAST of Protein numb vs. Ensembl Human
Match: NUMB (NUMB endocytic adaptor protein [Source:HGNC Symbol;Acc:HGNC:8060])

HSP 1 Score: 250.751 bits (639), Expect = 1.966e-72
Identity = 153/357 (42.86%), Postives = 207/357 (57.98%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------------RRLDPQSVIIAEPXXXXXXX------------XXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFS--DDPFSAAPINPAVHI 1095
            ++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L     K    +A+L+VS D LRV +E +K LIVDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE              ++ +   +++   V+  N A             +T+  +  P +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK  +      IK  V E + E +++++    I                        TN FS  +DPFS+AP+   V +
Sbjct:   20 SRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKATGKKAV--KAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFP-----IKNAVPEVEGEAESISSLCSQI------------------------TNAFSTPEDPFSSAPMTKPVTV 345          
BLAST of Protein numb vs. Ensembl Human
Match: NUMB (NUMB endocytic adaptor protein [Source:HGNC Symbol;Acc:HGNC:8060])

HSP 1 Score: 246.899 bits (629), Expect = 2.289e-71
Identity = 155/366 (42.35%), Postives = 211/366 (57.65%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------------RRLDPQSVIIAEPXXXXXXX------------XXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFS--DDPFSAAPINPAVHI 1095
            ++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ +A+L+VS D LRV +E +K LIVDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE              ++ +   +++   V+  N A             +T+  +  P +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK  +      IK  V E + E +++++    I                        TN FS  +DPFS+AP+   V +
Sbjct:   20 SRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFP-----IKNAVPEVEGEAESISSLCSQI------------------------TNAFSTPEDPFSSAPMTKPVTV 356          
BLAST of Protein numb vs. Ensembl Human
Match: NUMB (NUMB endocytic adaptor protein [Source:HGNC Symbol;Acc:HGNC:8060])

HSP 1 Score: 246.899 bits (629), Expect = 2.289e-71
Identity = 155/366 (42.35%), Postives = 211/366 (57.65%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------------RRLDPQSVIIAEPXXXXXXX------------XXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFS--DDPFSAAPINPAVHI 1095
            ++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ +A+L+VS D LRV +E +K LIVDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE              ++ +   +++   V+  N A             +T+  +  P +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK  +      IK  V E + E +++++    I                        TN FS  +DPFS+AP+   V +
Sbjct:   20 SRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFP-----IKNAVPEVEGEAESISSLCSQI------------------------TNAFSTPEDPFSSAPMTKPVTV 356          
BLAST of Protein numb vs. Ensembl Celegans
Match: num-1 (Numb-related protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTY6])

HSP 1 Score: 219.55 bits (558), Expect = 1.647e-62
Identity = 131/322 (40.68%), Postives = 177/322 (54.97%), Query Frame = 1
Query:  106 SNTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEI-SKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKDSVDVT----------------FNENKTSFTRLG----------------SF-KQATITERRLDPQSVIIAEPXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINK 969
              +K  QW  DE  VR G C F VKYLGS+EV+ESRGM VCE A+K L   + K    +A+LYVSGD LRV ++  S+GL+VDQ IEKVSFCAPDR   +GFAYICRD  +RRW+CHGF A KE+GERLSHAVGCAF++CLEKK++R++++  V                 F+ N    T  G                SF K  +I +R LDPQSVII E         S +       S PRP  + ++  RQ S++  P +   ++ FKR+ S+R    +  +      +    +  E + E  ++P  +  T   + K
Sbjct:   29 GGSKTEQWQPDEGAVRTGTCCFNVKYLGSVEVYESRGMQVCEGALKSLKASRRKPV--KAVLYVSGDGLRVVDQGNSRGLLVDQTIEKVSFCAPDRQTDKGFAYICRDGASRRWMCHGFLATKETGERLSHAVGCAFSICLEKKKRRDEETAQVNVQSAQESTSSTPPKDIFHPNWEDNTSEGTSTQNPSNSRSNLAYQSFRKHVSIEDRYLDPQSVIINE------VPASNHMDEIRRISKPRPTGNPALFLRQGSLRAPPDMPSSSDQFKRNMSLRTVSNNPTERSPEKKSFGTQLYNEPIYEGDEDPLGLGITPPVVTK 342          
BLAST of Protein numb vs. Ensembl Celegans
Match: num-1 (Numb-related protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTY6])

HSP 1 Score: 219.935 bits (559), Expect = 1.860e-62
Identity = 131/322 (40.68%), Postives = 177/322 (54.97%), Query Frame = 1
Query:  106 SNTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEI-SKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKDSVDVT----------------FNENKTSFTRLG----------------SF-KQATITERRLDPQSVIIAEPXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINK 969
              +K  QW  DE  VR G C F VKYLGS+EV+ESRGM VCE A+K L   + K    +A+LYVSGD LRV ++  S+GL+VDQ IEKVSFCAPDR   +GFAYICRD  +RRW+CHGF A KE+GERLSHAVGCAF++CLEKK++R++++  V                 F+ N    T  G                SF K  +I +R LDPQSVII E         S +       S PRP  + ++  RQ S++  P +   ++ FKR+ S+R    +  +      +    +  E + E  ++P  +  T   + K
Sbjct:   43 GGSKTEQWQPDEGAVRTGTCCFNVKYLGSVEVYESRGMQVCEGALKSLKASRRKPV--KAVLYVSGDGLRVVDQGNSRGLLVDQTIEKVSFCAPDRQTDKGFAYICRDGASRRWMCHGFLATKETGERLSHAVGCAFSICLEKKKRRDEETAQVNVQSAQESTSSTPPKDIFHPNWEDNTSEGTSTQNPSNSRSNLAYQSFRKHVSIEDRYLDPQSVIINE------VPASNHMDEIRRISKPRPTGNPALFLRQGSLRAPPDMPSSSDQFKRNMSLRTVSNNPTERSPEKKSFGTQLYNEPIYEGDEDPLGLGITPPVVTK 356          
BLAST of Protein numb vs. Ensembl Celegans
Match: num-1 (Numb-related protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTY6])

HSP 1 Score: 220.32 bits (560), Expect = 3.645e-62
Identity = 131/324 (40.43%), Postives = 178/324 (54.94%), Query Frame = 1
Query:  100 LDSNTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEI-SKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKDSVDVT----------------FNENKTSFTRLG----------------SF-KQATITERRLDPQSVIIAEPXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINK 969
            +   +K  QW  DE  VR G C F VKYLGS+EV+ESRGM VCE A+K L   + K    +A+LYVSGD LRV ++  S+GL+VDQ IEKVSFCAPDR   +GFAYICRD  +RRW+CHGF A KE+GERLSHAVGCAF++CLEKK++R++++  V                 F+ N    T  G                SF K  +I +R LDPQSVII E         S +       S PRP  + ++  RQ S++  P +   ++ FKR+ S+R    +  +      +    +  E + E  ++P  +  T   + K
Sbjct:   85 VTGGSKTEQWQPDEGAVRTGTCCFNVKYLGSVEVYESRGMQVCEGALKSLKASRRKPV--KAVLYVSGDGLRVVDQGNSRGLLVDQTIEKVSFCAPDRQTDKGFAYICRDGASRRWMCHGFLATKETGERLSHAVGCAFSICLEKKKRRDEETAQVNVQSAQESTSSTPPKDIFHPNWEDNTSEGTSTQNPSNSRSNLAYQSFRKHVSIEDRYLDPQSVIINE------VPASNHMDEIRRISKPRPTGNPALFLRQGSLRAPPDMPSSSDQFKRNMSLRTVSNNPTERSPEKKSFGTQLYNEPIYEGDEDPLGLGITPPVVTK 400          
BLAST of Protein numb vs. Ensembl Celegans
Match: num-1 (Numb-related protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTY6])

HSP 1 Score: 219.55 bits (558), Expect = 3.365e-61
Identity = 131/324 (40.43%), Postives = 178/324 (54.94%), Query Frame = 1
Query:  100 LDSNTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEI-SKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKDSVDVT----------------FNENKTSFTRLG----------------SF-KQATITERRLDPQSVIIAEPXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINK 969
            +   +K  QW  DE  VR G C F VKYLGS+EV+ESRGM VCE A+K L   + K    +A+LYVSGD LRV ++  S+GL+VDQ IEKVSFCAPDR   +GFAYICRD  +RRW+CHGF A KE+GERLSHAVGCAF++CLEKK++R++++  V                 F+ N    T  G                SF K  +I +R LDPQSVII E         S +       S PRP  + ++  RQ S++  P +   ++ FKR+ S+R    +  +      +    +  E + E  ++P  +  T   + K
Sbjct:  174 VTGGSKTEQWQPDEGAVRTGTCCFNVKYLGSVEVYESRGMQVCEGALKSLKASRRKPV--KAVLYVSGDGLRVVDQGNSRGLLVDQTIEKVSFCAPDRQTDKGFAYICRDGASRRWMCHGFLATKETGERLSHAVGCAFSICLEKKKRRDEETAQVNVQSAQESTSSTPPKDIFHPNWEDNTSEGTSTQNPSNSRSNLAYQSFRKHVSIEDRYLDPQSVIINE------VPASNHMDEIRRISKPRPTGNPALFLRQGSLRAPPDMPSSSDQFKRNMSLRTVSNNPTERSPEKKSFGTQLYNEPIYEGDEDPLGLGITPPVVTK 489          
BLAST of Protein numb vs. Ensembl Fly
Match: numb (gene:FBgn0002973 transcript:FBtr0079821)

HSP 1 Score: 275.404 bits (703), Expect = 3.097e-83
Identity = 146/268 (54.48%), Postives = 188/268 (70.15%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITERRLDPQSVIIAE-----PXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAA 894
            ++KP QW  DE+ VR   CSF VKYLG +EVFESRGM VCEEA+K L + + +    R +L+VSGD LRV ++ +KGLIVDQ IEKVSFCAPDRNH+RGF+YICRD TTRRW+CHGF A K+SGERLSHAVGCAFAVCLE+KQ+R+K+  V +TF+   ++FTR GSF+Q T+TE RL   +V   E     P S      +       P +I RPHA+ ++L+RQ+S ++        +PFKR  S+RI DL SN +R+  + TAAA
Sbjct:   22 SSKPHQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSRRRPV--RGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGFLACKDSGERLSHAVGCAFAVCLERKQRRDKECGVTMTFDTKNSTFTRTGSFRQQTLTE-RLAMATVGTNERSVDGPGSAMPGPPAATVKPFNPFAIERPHATPNMLERQSSFRL--STIGSQSPFKRQMSLRINDLPSNADRQRAFLTAAA 284          
BLAST of Protein numb vs. Ensembl Fly
Match: numb (gene:FBgn0002973 transcript:FBtr0079822)

HSP 1 Score: 275.404 bits (703), Expect = 8.112e-83
Identity = 146/268 (54.48%), Postives = 188/268 (70.15%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITERRLDPQSVIIAE-----PXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAA 894
            ++KP QW  DE+ VR   CSF VKYLG +EVFESRGM VCEEA+K L + + +    R +L+VSGD LRV ++ +KGLIVDQ IEKVSFCAPDRNH+RGF+YICRD TTRRW+CHGF A K+SGERLSHAVGCAFAVCLE+KQ+R+K+  V +TF+   ++FTR GSF+Q T+TE RL   +V   E     P S      +       P +I RPHA+ ++L+RQ+S ++        +PFKR  S+RI DL SN +R+  + TAAA
Sbjct:   63 SSKPHQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSRRRPV--RGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGFLACKDSGERLSHAVGCAFAVCLERKQRRDKECGVTMTFDTKNSTFTRTGSFRQQTLTE-RLAMATVGTNERSVDGPGSAMPGPPAATVKPFNPFAIERPHATPNMLERQSSFRL--STIGSQSPFKRQMSLRINDLPSNADRQRAFLTAAA 325          
BLAST of Protein numb vs. Ensembl Fly
Match: numb (gene:FBgn0002973 transcript:FBtr0339526)

HSP 1 Score: 275.404 bits (703), Expect = 8.112e-83
Identity = 146/268 (54.48%), Postives = 188/268 (70.15%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITERRLDPQSVIIAE-----PXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAA 894
            ++KP QW  DE+ VR   CSF VKYLG +EVFESRGM VCEEA+K L + + +    R +L+VSGD LRV ++ +KGLIVDQ IEKVSFCAPDRNH+RGF+YICRD TTRRW+CHGF A K+SGERLSHAVGCAFAVCLE+KQ+R+K+  V +TF+   ++FTR GSF+Q T+TE RL   +V   E     P S      +       P +I RPHA+ ++L+RQ+S ++        +PFKR  S+RI DL SN +R+  + TAAA
Sbjct:   63 SSKPHQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSRRRPV--RGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGFLACKDSGERLSHAVGCAFAVCLERKQRRDKECGVTMTFDTKNSTFTRTGSFRQQTLTE-RLAMATVGTNERSVDGPGSAMPGPPAATVKPFNPFAIERPHATPNMLERQSSFRL--STIGSQSPFKRQMSLRINDLPSNADRQRAFLTAAA 325          
BLAST of Protein numb vs. Ensembl Fly
Match: Dab (gene:FBgn0000414 transcript:FBtr0330190)

HSP 1 Score: 54.299 bits (129), Expect = 5.445e-7
Identity = 39/151 (25.83%), Postives = 72/151 (47.68%), Query Frame = 1
Query:  100 LDSNTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXX--XXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVK--ESGERLSHAVGCAFAVCLEKKQQ 540
            L   T P ++ +D  +       F+ K +G +EV E+RG  +C+EA++ L      + +  +R  ++V+ D LR+ +E +   +    + K+SF A D    R F YI     +     H F  +K  ++  ++  A+   F V  E K++
Sbjct:    4 LRKKTSPCKYRNDPGRFFGDGVQFKAKLIGILEVGEARGDRMCQEALQDLKMAIRAAGEHKQRITIHVTIDGLRLRDEKTGDSLYHHPVHKISFIAQDMTDSRAFGYIFGSPDS----GHRFFGIKTDKAASQVVLAMRDLFQVVFELKKK 150          
BLAST of Protein numb vs. Ensembl Fly
Match: Dab (gene:FBgn0000414 transcript:FBtr0305085)

HSP 1 Score: 53.9138 bits (128), Expect = 6.303e-7
Identity = 39/151 (25.83%), Postives = 72/151 (47.68%), Query Frame = 1
Query:  100 LDSNTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXX--XXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVK--ESGERLSHAVGCAFAVCLEKKQQ 540
            L   T P ++ +D  +       F+ K +G +EV E+RG  +C+EA++ L      + +  +R  ++V+ D LR+ +E +   +    + K+SF A D    R F YI     +     H F  +K  ++  ++  A+   F V  E K++
Sbjct:    4 LRKKTSPCKYRNDPGRFFGDGVQFKAKLIGILEVGEARGDRMCQEALQDLKMAIRAAGEHKQRITIHVTIDGLRLRDEKTGDSLYHHPVHKISFIAQDMTDSRAFGYIFGSPDS----GHRFFGIKTDKAASQVVLAMRDLFQVVFELKKK 150          
BLAST of Protein numb vs. Ensembl Zebrafish
Match: numb (NUMB endocytic adaptor protein [Source:ZFIN;Acc:ZDB-GENE-060422-1])

HSP 1 Score: 251.521 bits (641), Expect = 1.257e-72
Identity = 156/359 (43.45%), Postives = 205/359 (57.10%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------RRL-------------------DPQSVIIAEPXXXXXXXXXXXXXXXXXX---XIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFS-AAPINPAV 1089
            +++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L     K    RA+L+VS D LRV ++ +K LI+DQ IEKVSFCAPDRN +  F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  TF+ N+T+FTR GSF+  T TE        R+L                   +P  V +A P   S+                 IPR HA    L RQ S + FP L ++ +PFKR  S+R+ +L S  +RK+ +      IK  V E + E  ++++    I      S  P DP  S    +P      +  P S AAP+N AV
Sbjct:   19 SSRPHQWQTDEEAVRGGKCSFAVKYLGHVEVEESRGMHICEDAVKKLKTAGKKAV--RAVLWVSADGLRVVDDKTKDLILDQTIEKVSFCAPDRNFEHAFSYICRDGTTRRWICHCFMAIKDSGERLSHAVGCAFAACLERKQKREKECGVTATFDANRTTFTREGSFRVTTATEQAEREEVMRQLQDNKKDSDLVISSSSGGSCNPVVVTLAGPNGSSSPPLPMAPLGLQDGNPHVIPRRHAPVEALARQGSFRGFPALSQKTSPFKRQMSLRMNELPSTMQRKSDFP-----IKNTVPEVEGEVDSISSLCTQITS--TFSGPPEDPFSSAPMPKP------ASSPQSPAAPVNGAV 362          
BLAST of Protein numb vs. Ensembl Zebrafish
Match: numb (NUMB endocytic adaptor protein [Source:ZFIN;Acc:ZDB-GENE-060422-1])

HSP 1 Score: 246.899 bits (629), Expect = 6.277e-71
Identity = 159/368 (43.21%), Postives = 210/368 (57.07%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------RRL-------------------DPQSVIIAEPXXXXXXXXXXXXXXXX---XXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFS-AAPINPAV 1089
            +++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ RA+L+VS D LRV ++ +K LI+DQ IEKVSFCAPDRN +  F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  TF+ N+T+FTR GSF+  T TE        R+L                   +P  V +A P   S+              P  IPR HA    L RQ S + FP L ++ +PFKR  S+R+ +L S  +RK+ +      IK  V E + E  ++++    I      S  P DP  S    +P      +  P S AAP+N AV
Sbjct:   19 SSRPHQWQTDEEAVRGGKCSFAVKYLGHVEVEESRGMHICEDAVKKLKTDRKVFKGFFKKAGKKAVRAVLWVSADGLRVVDDKTKDLILDQTIEKVSFCAPDRNFEHAFSYICRDGTTRRWICHCFMAIKDSGERLSHAVGCAFAACLERKQKREKECGVTATFDANRTTFTREGSFRVTTATEQAEREEVMRQLQDNKKDSDLVISSSSGGSCNPVVVTLAGPNGSSSPPLPMAPLGLQDGNPHVIPRRHAPVEALARQGSFRGFPALSQKTSPFKRQMSLRMNELPSTMQRKSDFP-----IKNTVPEVEGEVDSISSLCTQITS--TFSGPPEDPFSSAPMPKP------ASSPQSPAAPVNGAV 373          
BLAST of Protein numb vs. Ensembl Zebrafish
Match: numbl (NUMB like endocytic adaptor protein [Source:ZFIN;Acc:ZDB-GENE-051113-340])

HSP 1 Score: 241.506 bits (615), Expect = 1.664e-69
Identity = 136/305 (44.59%), Postives = 191/305 (62.62%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQAT-------------ITERRLDPQSVIIAEPXXXX----XXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKI 972
            ++P QW  DE+ VR+G C+F V+YLG +EV ESRGM VCEEA+K+L     K    +A+L+VS D LRV ++ +K LIVDQ IEKVSFCAPDRN+ + F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  +F+ ++TSF R GSF+ ++             I +++ +   +    P + S      +         P +IPR HA    L RQ S + FP+L ++N+PFKR  S+R+ DL S  +RK  + T   V + ++        T+   ++SIN +
Sbjct:   20 SRPHQWQADEEAVRKGKCNFPVRYLGLVEVDESRGMHVCEEAVKKLKVSGKKTV--KAVLWVSADGLRVVDDKTKDLIVDQTIEKVSFCAPDRNYDKAFSYICRDGTTRRWMCHCFMALKDSGERLSHAVGCAFAACLERKQRREKECGVTASFDASRTSFVREGSFRVSSAAQQSDREDIMKQIQDKKKEMCGISALPPGNASPPEGAGSPGERAEPGGPHAIPRRHAPIEQLVRQGSFRGFPQLSQKNSPFKRQLSLRLNDLPSTLQRKTDFQTKNPVPEMDL--------TVAGEADSINAL 314          
BLAST of Protein numb vs. Ensembl Zebrafish
Match: numbl (NUMB like endocytic adaptor protein [Source:ZFIN;Acc:ZDB-GENE-051113-340])

HSP 1 Score: 241.506 bits (615), Expect = 1.879e-69
Identity = 136/305 (44.59%), Postives = 191/305 (62.62%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQAT-------------ITERRLDPQSVIIAEPXXXX----XXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKI 972
            ++P QW  DE+ VR+G C+F V+YLG +EV ESRGM VCEEA+K+L     K    +A+L+VS D LRV ++ +K LIVDQ IEKVSFCAPDRN+ + F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  +F+ ++TSF R GSF+ ++             I +++ +   +    P + S      +         P +IPR HA    L RQ S + FP+L ++N+PFKR  S+R+ DL S  +RK  + T   V + ++        T+   ++SIN +
Sbjct:   20 SRPHQWQADEEAVRKGKCNFPVRYLGLVEVDESRGMHVCEEAVKKLKVSGKKTV--KAVLWVSADGLRVVDDKTKDLIVDQTIEKVSFCAPDRNYDKAFSYICRDGTTRRWMCHCFMALKDSGERLSHAVGCAFAACLERKQRREKECGVTASFDASRTSFVREGSFRVSSAAQQSDREDIMKQIQDKKKEMCGISALPPGNASPPEGAGSPGERAEPGGPHAIPRRHAPIEQLVRQGSFRGFPQLSQKNSPFKRQLSLRLNDLPSTLQRKTDFQTKNPVPEMDL--------TVAGEADSINAL 314          
BLAST of Protein numb vs. Ensembl Zebrafish
Match: numbl (NUMB like endocytic adaptor protein [Source:ZFIN;Acc:ZDB-GENE-051113-340])

HSP 1 Score: 241.506 bits (615), Expect = 1.879e-69
Identity = 136/305 (44.59%), Postives = 191/305 (62.62%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQAT-------------ITERRLDPQSVIIAEPXXXX----XXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKI 972
            ++P QW  DE+ VR+G C+F V+YLG +EV ESRGM VCEEA+K+L     K    +A+L+VS D LRV ++ +K LIVDQ IEKVSFCAPDRN+ + F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  +F+ ++TSF R GSF+ ++             I +++ +   +    P + S      +         P +IPR HA    L RQ S + FP+L ++N+PFKR  S+R+ DL S  +RK  + T   V + ++        T+   ++SIN +
Sbjct:   20 SRPHQWQADEEAVRKGKCNFPVRYLGLVEVDESRGMHVCEEAVKKLKVSGKKTV--KAVLWVSADGLRVVDDKTKDLIVDQTIEKVSFCAPDRNYDKAFSYICRDGTTRRWMCHCFMALKDSGERLSHAVGCAFAACLERKQRREKECGVTASFDASRTSFVREGSFRVSSAAQQSDREDIMKQIQDKKKEMCGISALPPGNASPPEGAGSPGERAEPGGPHAIPRRHAPIEQLVRQGSFRGFPQLSQKNSPFKRQLSLRLNDLPSTLQRKTDFQTKNPVPEMDL--------TVAGEADSINAL 314          
BLAST of Protein numb vs. Ensembl Xenopus
Match: numb (numb homolog [Source:NCBI gene;Acc:100038147])

HSP 1 Score: 250.366 bits (638), Expect = 5.505e-73
Identity = 149/350 (42.57%), Postives = 204/350 (58.29%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE---------------RRLDPQS-VIIAEPXXXXXXXXXXXXXXXXXX---------------XIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMW------------NTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVD-PVPSNGNKE 1026
            ++P QW  DE+ VR G CSFQVKYLG +EV ESRGM +CEEA+K+L     K    +A+L+VS D LRV +E +K L+VDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE               + L+ ++ V+ A P +  ++  +        S               +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK+ +            N + + +  +++ T   P     TS  + K     + P + PVPS+G  +
Sbjct:   20 SRPHQWQTDEESVRNGKCSFQVKYLGHVEVEESRGMHICEEAVKRLKSSGKKAI--KAVLWVSADGLRVVDEKTKDLLVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEVMKQIQESRKELEVKAPVVPAAPSTTVSSTPTPVLQSSPTSEVFVVQDSKDLNYPHAIPRRHAPVEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTVQRKSDFQATNPVAEMEGENDSISALCSQITNTFSMPPEDPFTSAPMTKATTPQSPPFEGPVPSSGTHQ 367          
BLAST of Protein numb vs. Ensembl Xenopus
Match: numb (numb homolog [Source:NCBI gene;Acc:100038147])

HSP 1 Score: 250.366 bits (638), Expect = 7.375e-73
Identity = 149/350 (42.57%), Postives = 204/350 (58.29%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE---------------RRLDPQS-VIIAEPXXXXXXXXXXXXXXXXXX---------------XIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMW------------NTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVD-PVPSNGNKE 1026
            ++P QW  DE+ VR G CSFQVKYLG +EV ESRGM +CEEA+K+L     K    +A+L+VS D LRV +E +K L+VDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE               + L+ ++ V+ A P +  ++  +        S               +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK+ +            N + + +  +++ T   P     TS  + K     + P + PVPS+G  +
Sbjct:   20 SRPHQWQTDEESVRNGKCSFQVKYLGHVEVEESRGMHICEEAVKRLKSSGKKAI--KAVLWVSADGLRVVDEKTKDLLVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEVMKQIQESRKELEVKAPVVPAAPSTTVSSTPTPVLQSSPTSEVFVVQDSKDLNYPHAIPRRHAPVEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTVQRKSDFQATNPVAEMEGENDSISALCSQITNTFSMPPEDPFTSAPMTKATTPQSPPFEGPVPSSGTHQ 367          
BLAST of Protein numb vs. Ensembl Xenopus
Match: numb (numb homolog [Source:NCBI gene;Acc:100038147])

HSP 1 Score: 246.128 bits (627), Expect = 1.192e-70
Identity = 142/307 (46.25%), Postives = 188/307 (61.24%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE---------------RRLDPQS-VIIAEPXXXXXXXXXXXXXXXXXX---------------XIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEE 909
            ++P QW  DE+ VR G CSFQVKYLG +EV ESRGM +CEEA+K+L            KS KK+ +A+L+VS D LRV +E +K L+VDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE               + L+ ++ V+ A P +  ++  +        S               +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK+ +     V + E
Sbjct:   20 SRPHQWQTDEESVRNGKCSFQVKYLGHVEVEESRGMHICEEAVKRLKSERKYFKGFFAKSGKKAIKAVLWVSADGLRVVDEKTKDLLVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEVMKQIQESRKELEVKAPVVPAAPSTTVSSTPTPVLQSSPTSEVFVVQDSKDLNYPHAIPRRHAPVEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTVQRKSDFQATNPVAEME 326          
BLAST of Protein numb vs. Ensembl Xenopus
Match: NUMBL (numb homolog-like [Source:NCBI gene;Acc:100488844])

HSP 1 Score: 240.736 bits (613), Expect = 2.568e-69
Identity = 146/351 (41.60%), Postives = 199/351 (56.70%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------RRLDPQS---------------------VIIAEPXXXX---XXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFS 1065
            ++P QW  DE+ VR G CSF V+YLG +EV ESRGM VCE+A+K+L     K    +AIL+VS D LRV ++ +K LIVDQ IEKVSFCAPDRN  + F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  +F+ ++TSF R GSF+  + ++        R+L  +                      V+ A+P           S  +      +IPR HA    L RQ S + FP L ++N+PFKR  S+R+ +L S  +RK  +   + VI+ E S        M   S+ IN +  + ++              F N  S+DPF+
Sbjct:   20 SRPHQWGADEEAVRRGKCSFPVRYLGHVEVEESRGMHVCEDAVKKLKTLGKKSV--KAILWVSADGLRVVDDKTKDLIVDQTIEKVSFCAPDRNFDKAFSYICRDGTTRRWICHCFMALKDSGERLSHAVGCAFAACLERKQKREKECGVTASFDASRTSFAREGSFRVTSASQQAEREEVMRQLQDKKKAEAAPSLTSSIPAVGAPSNPVLPAQPDQSPPQCATVPSEKSETGGQHAIPRRHAPLEQLVRQGSFRGFPALSQKNSPFKRQLSLRLNELPSTLQRKTNFQDKSQVIELESS--------MHPDSDGINDLCNQISS-------------SFANKPSEDPFA 347          
BLAST of Protein numb vs. Ensembl Xenopus
Match: numb (numb homolog [Source:NCBI gene;Acc:100038147])

HSP 1 Score: 241.121 bits (614), Expect = 3.236e-69
Identity = 152/375 (40.53%), Postives = 208/375 (55.47%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX-------------------------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE---------------RRLDPQS-VIIAEPXXXXXXXXXXXXXXXXXX---------------XIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMW------------NTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVD-PVPSNGNKE 1026
            ++P QW  DE+ VR G CSFQVKYLG +EV ESRGM +CEEA+K+L                            KS KK+ +A+L+VS D LRV +E +K L+VDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE               + L+ ++ V+ A P +  ++  +        S               +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK+ +            N + + +  +++ T   P     TS  + K     + P + PVPS+G  +
Sbjct:   20 SRPHQWQTDEESVRNGKCSFQVKYLGHVEVEESRGMHICEEAVKRLKSLLAIIVLDLSLPLFLQERKYFKGFFAKSGKKAIKAVLWVSADGLRVVDEKTKDLLVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEVMKQIQESRKELEVKAPVVPAAPSTTVSSTPTPVLQSSPTSEVFVVQDSKDLNYPHAIPRRHAPVEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTVQRKSDFQATNPVAEMEGENDSISALCSQITNTFSMPPEDPFTSAPMTKATTPQSPPFEGPVPSSGTHQ 394          
BLAST of Protein numb vs. Ensembl Mouse
Match: Numb (NUMB endocytic adaptor protein [Source:MGI Symbol;Acc:MGI:107423])

HSP 1 Score: 246.899 bits (629), Expect = 1.093e-71
Identity = 151/355 (42.54%), Postives = 206/355 (58.03%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------------RRLDPQSVIIAEPXXXXXXX------------XXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPINPAVHI 1095
            ++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L     K    +A+L+VS D LRV +E +K LIVDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE              ++ +    ++   V+  N A             + ++ +  P +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK  +      IK  V E + E +++++    I       +TP                  S+DPFS+AP+   V +
Sbjct:   20 SRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKATGKKAV--KAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQLQDAKKAETDKTVVGPSVAPGNTAPSPSSPTSPTPDGTASSEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFP-----IKNTVPEVEGEAESISSLCSQITSA---FSTP------------------SEDPFSSAPMTKPVTL 346          
BLAST of Protein numb vs. Ensembl Mouse
Match: Numb (NUMB endocytic adaptor protein [Source:MGI Symbol;Acc:MGI:107423])

HSP 1 Score: 247.669 bits (631), Expect = 1.661e-71
Identity = 151/355 (42.54%), Postives = 206/355 (58.03%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------------RRLDPQSVIIAEPXXXXXXX------------XXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPINPAVHI 1095
            ++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L     K    +A+L+VS D LRV +E +K LIVDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE              ++ +    ++   V+  N A             + ++ +  P +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK  +      IK  V E + E +++++    I       +TP                  S+DPFS+AP+   V +
Sbjct:   20 SRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKATGKKAV--KAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQLQDAKKAETDKTVVGPSVAPGNTAPSPSSPTSPTPDGTASSEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFP-----IKNTVPEVEGEAESISSLCSQITSA---FSTP------------------SEDPFSSAPMTKPVTL 346          
BLAST of Protein numb vs. Ensembl Mouse
Match: Numb (NUMB endocytic adaptor protein [Source:MGI Symbol;Acc:MGI:107423])

HSP 1 Score: 236.498 bits (602), Expect = 7.969e-71
Identity = 134/290 (46.21%), Postives = 179/290 (61.72%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXX---------XXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------------RRLDPQSVIIA------------EPXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKN 873
            ++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ +A+L+VS D LRV +E +K LIVDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE              ++ +    ++                +      + ++ +  P +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK 
Sbjct:   20 SRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQLQDAKKAETDKTVVGPSVAPGNTAPSPSSPTSPTPDGTASSEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKT 309          
BLAST of Protein numb vs. Ensembl Mouse
Match: Numb (NUMB endocytic adaptor protein [Source:MGI Symbol;Acc:MGI:107423])

HSP 1 Score: 243.432 bits (620), Expect = 2.452e-70
Identity = 153/364 (42.03%), Postives = 210/364 (57.69%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------------RRLDPQSVIIAEPXXXXXXX------------XXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPINPAVHI 1095
            ++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ +A+L+VS D LRV +E +K LIVDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE              ++ +    ++   V+  N A             + ++ +  P +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK  +      IK  V E + E +++++    I       +TP                  S+DPFS+AP+   V +
Sbjct:   20 SRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQLQDAKKAETDKTVVGPSVAPGNTAPSPSSPTSPTPDGTASSEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFP-----IKNTVPEVEGEAESISSLCSQITSA---FSTP------------------SEDPFSSAPMTKPVTL 357          
BLAST of Protein numb vs. Ensembl Mouse
Match: Numb (NUMB endocytic adaptor protein [Source:MGI Symbol;Acc:MGI:107423])

HSP 1 Score: 244.202 bits (622), Expect = 4.699e-70
Identity = 153/364 (42.03%), Postives = 210/364 (57.69%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------------RRLDPQSVIIAEPXXXXXXX------------XXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPINPAVHI 1095
            ++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ +A+L+VS D LRV +E +K LIVDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE              ++ +    ++   V+  N A             + ++ +  P +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK  +      IK  V E + E +++++    I       +TP                  S+DPFS+AP+   V +
Sbjct:   20 SRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQLQDAKKAETDKTVVGPSVAPGNTAPSPSSPTSPTPDGTASSEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFP-----IKNTVPEVEGEAESISSLCSQITSA---FSTP------------------SEDPFSSAPMTKPVTL 357          
BLAST of Protein numb vs. UniProt/SwissProt
Match: sp|P16554|NUMB_DROME (Protein numb OS=Drosophila melanogaster OX=7227 GN=numb PE=1 SV=2)

HSP 1 Score: 275.404 bits (703), Expect = 8.131e-82
Identity = 146/268 (54.48%), Postives = 188/268 (70.15%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITERRLDPQSVIIAE-----PXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAA 894
            ++KP QW  DE+ VR   CSF VKYLG +EVFESRGM VCEEA+K L + + +    R +L+VSGD LRV ++ +KGLIVDQ IEKVSFCAPDRNH+RGF+YICRD TTRRW+CHGF A K+SGERLSHAVGCAFAVCLE+KQ+R+K+  V +TF+   ++FTR GSF+Q T+TE RL   +V   E     P S      +       P +I RPHA+ ++L+RQ+S ++        +PFKR  S+RI DL SN +R+  + TAAA
Sbjct:   63 SSKPHQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSRRRPV--RGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGFLACKDSGERLSHAVGCAFAVCLERKQRRDKECGVTMTFDTKNSTFTRTGSFRQQTLTE-RLAMATVGTNERSVDGPGSAMPGPPAATVKPFNPFAIERPHATPNMLERQSSFRL--STIGSQSPFKRQMSLRINDLPSNADRQRAFLTAAA 325          
BLAST of Protein numb vs. UniProt/SwissProt
Match: sp|P49757|NUMB_HUMAN (Protein numb homolog OS=Homo sapiens OX=9606 GN=NUMB PE=1 SV=2)

HSP 1 Score: 247.284 bits (630), Expect = 1.799e-70
Identity = 155/366 (42.35%), Postives = 211/366 (57.65%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------------RRLDPQSVIIAEPXXXXXXX------------XXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFS--DDPFSAAPINPAVHI 1095
            ++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ +A+L+VS D LRV +E +K LIVDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE              ++ +   +++   V+  N A             +T+  +  P +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK  +      IK  V E + E +++++    I                        TN FS  +DPFS+AP+   V +
Sbjct:   20 SRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFP-----IKNAVPEVEGEAESISSLCSQI------------------------TNAFSTPEDPFSSAPMTKPVTV 356          
BLAST of Protein numb vs. UniProt/SwissProt
Match: sp|Q9QZS3|NUMB_MOUSE (Protein numb homolog OS=Mus musculus OX=10090 GN=Numb PE=1 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 3.287e-69
Identity = 153/364 (42.03%), Postives = 210/364 (57.69%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------------RRLDPQSVIIAEPXXXXXXX------------XXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPINPAVHI 1095
            ++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ +A+L+VS D LRV +E +K LIVDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE              ++ +    ++   V+  N A             + ++ +  P +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK  +      IK  V E + E +++++    I       +TP                  S+DPFS+AP+   V +
Sbjct:   20 SRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQLQDAKKAETDKTVVGPSVAPGNTAPSPSSPTSPTPDGTASSEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFP-----IKNTVPEVEGEAESISSLCSQITSA---FSTP------------------SEDPFSSAPMTKPVTL 357          
BLAST of Protein numb vs. UniProt/SwissProt
Match: sp|Q2LC84|NUMB_RAT (Protein numb homolog OS=Rattus norvegicus OX=10116 GN=Numb PE=1 SV=2)

HSP 1 Score: 243.047 bits (619), Expect = 8.676e-69
Identity = 152/366 (41.53%), Postives = 205/366 (56.01%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------------------RRLDPQ-----SVIIAEPXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFS---DDPFSAAPINPAVHI 1095
            ++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ +A+L+VS D LRV +E +K LIVDQ IEKVSFCAPDRN  R F+YICRD TTRRW+CH F AVK++GERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++T+FTR GSF+  T TE                    + + P      S       +      + +  +  P +IPR HA    L RQ S + FP L ++ +PFKR  S+RI +L S  +RK  +      IK  V E + E +++++    I                        T+ FS   +DPFS+AP+   V +
Sbjct:   20 SRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQLQDAKKAETDKTVGPSVAPGNSAPSPSSPTSPTLDPTASLEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFP-----IKNTVPEVEGEAESISSLCSQI------------------------TSAFSTPCEDPFSSAPMTKPVTL 356          
BLAST of Protein numb vs. UniProt/SwissProt
Match: sp|Q9XTY6|NUMB1_CAEEL (Numb-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 4.637e-61
Identity = 131/324 (40.43%), Postives = 178/324 (54.94%), Query Frame = 1
Query:  100 LDSNTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEI-SKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKDSVDVT----------------FNENKTSFTRLG----------------SF-KQATITERRLDPQSVIIAEPXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINK 969
            +   +K  QW  DE  VR G C F VKYLGS+EV+ESRGM VCE A+K L   + K    +A+LYVSGD LRV ++  S+GL+VDQ IEKVSFCAPDR   +GFAYICRD  +RRW+CHGF A KE+GERLSHAVGCAF++CLEKK++R++++  V                 F+ N    T  G                SF K  +I +R LDPQSVII E         S +       S PRP  + ++  RQ S++  P +   ++ FKR+ S+R    +  +      +    +  E + E  ++P  +  T   + K
Sbjct:   85 VTGGSKTEQWQPDEGAVRTGTCCFNVKYLGSVEVYESRGMQVCEGALKSLKASRRKPV--KAVLYVSGDGLRVVDQGNSRGLLVDQTIEKVSFCAPDRQTDKGFAYICRDGASRRWMCHGFLATKETGERLSHAVGCAFSICLEKKKRRDEETAQVNVQSAQESTSSTPPKDIFHPNWEDNTSEGTSTQNPSNSRSNLAYQSFRKHVSIEDRYLDPQSVIINE------VPASNHMDEIRRISKPRPTGNPALFLRQGSLRAPPDMPSSSDQFKRNMSLRTVSNNPTERSPEKKSFGTQLYNEPIYEGDEDPLGLGITPPVVTK 400          
BLAST of Protein numb vs. TrEMBL
Match: A0A0B7BNJ9 (PID domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF204228 PE=4 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 1.183e-102
Identity = 181/348 (52.01%), Postives = 237/348 (68.10%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKDS-VDVTFNENKTSFTRLGSFKQATITERRLDPQSVIIAEPXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPINPAVHIKHNFVNESNNQTPFSSTSA 1152
            +KP QW +DEKKVREG CSFQV+YLG IEVF+SRGM +CEEA+K L      K   RA+LYVSGDALRV +EISK +IVDQ IEKVSFCAPDRNH++GFAYICRD TTRRW+CHGF AVKESGERLSHAVGCAFA+CLEKKQ+R+K++ V VT+N+++TSF R GSF+Q T+TER +DPQS I+A+P            +   P ++ RPHA+ ++L+RQ S + F KLQE ++PFKR  S+R++DL S  +R+N      AV++   S T++    +  T   + +   +S   +    + G      T L S+DPFS  P N      H   ++++  TPF S  A
Sbjct:   21 SKPHQWQEDEKKVREGTCSFQVRYLGYIEVFDSRGMHICEEAVKTLKSQCKGKYQ-RAVLYVSGDALRVVDEISKSMIVDQTIEKVSFCAPDRNHEKGFAYICRDGTTRRWMCHGFLAVKESGERLSHAVGCAFAICLEKKQKRDKETGVTVTYNQSRTSFERTGSFRQTTLTERIVDPQSAILADP--------VPVRTSNNPFAVQRPHATANLLERQGSFRGFEKLQETSSPFKRTLSLRLSDLPSTLQRQN------AVLE---SPTQNGNGAVGGTIPEVTQEQEDSIAQMCQQLTQG-----LTALTSEDPFSGVP-NQGAGRSHALTHQASLPTPFHSNHA 344          
BLAST of Protein numb vs. TrEMBL
Match: A0A2C9JZJ9 (PID domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106074180 PE=4 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 5.307e-100
Identity = 184/367 (50.14%), Postives = 244/367 (66.49%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKDS-VDVTFNENKTSFTRLGSFKQATITERRLDPQSVIIAEPXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPI-------------NPAVHIKHNFVNESNNQT--PFSSTSAYQYS 1164
            +KP QW +DEKKVREG CSFQV+YLG IEVF+SRGM +CEEA+K L      K   RA+LYVSGDALRV +EISK +IVDQ IEKVSFCAPDRNH++GFAYICRD TTRRW+CHGF AVKESGERLSHAVGCAFA+CLEKKQ+R+K++ V VT+N+++T F R GSF+Q T+TER +DPQS I+AEP            +   P ++ RPHA+ ++L+RQ S + F KLQE ++PFKR  S+R+ +L S  +R+N      AV++   S T++    +  T   +++   +S   +    + G      T L SDDPFS+AP+             N A   + + +  S N +  P+ +TS  QY+
Sbjct:   38 SKPHQWQEDEKKVREGTCSFQVRYLGYIEVFDSRGMHICEEAVKALKSQCKGKYQ-RAVLYVSGDALRVVDEISKSMIVDQTIEKVSFCAPDRNHEKGFAYICRDGTTRRWMCHGFLAVKESGERLSHAVGCAFAICLEKKQKRDKETGVTVTYNQSRTCFERTGSFRQTTLTERIVDPQSAILAEP--------VPLRAASNPYAVQRPHATPNLLERQGSFRGFEKLQEVSSPFKRTLSLRLNELPSTLQRQN------AVME---SPTQNGNGAVGGTIPEVSQEQEDSIAQMCQQLTQG-----LTALTSDDPFSSAPVALTHQTSLPTYFQNHAPLTRQHTLPASQNASINPWGATSTSQYA 381          
BLAST of Protein numb vs. TrEMBL
Match: A0A0B7BR89 (PID domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF204239 PE=4 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 5.905e-100
Identity = 181/354 (51.13%), Postives = 237/354 (66.95%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKES------GERLSHAVGCAFAVCLEKKQQREKDS-VDVTFNENKTSFTRLGSFKQATITERRLDPQSVIIAEPXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPINPAVHIKHNFVNESNNQTPFSSTSA 1152
            +KP QW +DEKKVREG CSFQV+YLG IEVF+SRGM +CEEA+K L      K   RA+LYVSGDALRV +EISK +IVDQ IEKVSFCAPDRNH++GFAYICRD TTRRW+CHGF AVKES      GERLSHAVGCAFA+CLEKKQ+R+K++ V VT+N+++TSF R GSF+Q T+TER +DPQS I+A+P            +   P ++ RPHA+ ++L+RQ S + F KLQE ++PFKR  S+R++DL S  +R+N      AV++   S T++    +  T   + +   +S   +    + G      T L S+DPFS  P N      H   ++++  TPF S  A
Sbjct:   21 SKPHQWQEDEKKVREGTCSFQVRYLGYIEVFDSRGMHICEEAVKTLKSQCKGKYQ-RAVLYVSGDALRVVDEISKSMIVDQTIEKVSFCAPDRNHEKGFAYICRDGTTRRWMCHGFLAVKESMNDNCMGERLSHAVGCAFAICLEKKQKRDKETGVTVTYNQSRTSFERTGSFRQTTLTERIVDPQSAILADP--------VPVRTSNNPFAVQRPHATANLLERQGSFRGFEKLQETSSPFKRTLSLRLSDLPSTLQRQN------AVLE---SPTQNGNGAVGGTIPEVTQEQEDSIAQMCQQLTQG-----LTALTSEDPFSGVP-NQGAGRSHALTHQASLPTPFHSNHA 350          
BLAST of Protein numb vs. TrEMBL
Match: A0A0B7BNK4 (PID domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF204256 PE=4 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 6.370e-100
Identity = 159/255 (62.35%), Postives = 200/255 (78.43%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKDS-VDVTFNENKTSFTRLGSFKQATITERRLDPQSVIIAEPXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKN 873
            +KP QW +DEKKVREG CSFQV+YLG IEVF+SRGM +CEEA+K L      K   RA+LYVSGDALRV +EISK +IVDQ IEKVSFCAPDRNH++GFAYICRD TTRRW+CHGF AVKESGERLSHAVGCAFA+CLEKKQ+R+K++ V VT+N+++TSF R GSF+Q T+TER +DPQS I+A+P            +   P ++ RPHA+ ++L+RQ S + F KLQE ++PFKR  S+R++DL S  +R+N
Sbjct:   21 SKPHQWQEDEKKVREGTCSFQVRYLGYIEVFDSRGMHICEEAVKTLKSQCKGKYQ-RAVLYVSGDALRVVDEISKSMIVDQTIEKVSFCAPDRNHEKGFAYICRDGTTRRWMCHGFLAVKESGERLSHAVGCAFAICLEKKQKRDKETGVTVTYNQSRTSFERTGSFRQTTLTERIVDPQSAILADP--------VPVRTSNNPFAVQRPHATANLLERQGSFRGFEKLQETSSPFKRTLSLRLSDLPSTLQRQN 266          
BLAST of Protein numb vs. TrEMBL
Match: A0A182ZN86 (PID domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106074180 PE=4 SV=2)

HSP 1 Score: 329.331 bits (843), Expect = 7.232e-100
Identity = 185/367 (50.41%), Postives = 246/367 (67.03%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKDS-VDVTFNENKTSFTRLGSFKQATITERRLDPQSVIIAEPXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPI-------------NPAVHIKHNFVNESNNQT--PFSSTSAYQYS 1164
            +KP QW +DEKKVREG CSFQV+YLG IEVF+SRGM +CEEA+K L   K K +  RA+LYVSGDALRV +EISK +IVDQ IEKVSFCAPDRNH++GFAYICRD TTRRW+CHGF AVKESGERLSHAVGCAFA+CLEKKQ+R+K++ V VT+N+++T F R GSF+Q T+TER +DPQS I+AEP            +   P ++ RPHA+ ++L+RQ S + F KLQE ++PFKR  S+R+ +L S  +R+N      AV++   S T++    +  T   +++   +S   +    + G      T L SDDPFS+AP+             N A   + + +  S N +  P+ +TS  QY+
Sbjct:   38 SKPHQWQEDEKKVREGTCSFQVRYLGYIEVFDSRGMHICEEAVKALKSCKGKYQ--RAVLYVSGDALRVVDEISKSMIVDQTIEKVSFCAPDRNHEKGFAYICRDGTTRRWMCHGFLAVKESGERLSHAVGCAFAICLEKKQKRDKETGVTVTYNQSRTCFERTGSFRQTTLTERIVDPQSAILAEP--------VPLRAASNPYAVQRPHATPNLLERQGSFRGFEKLQEVSSPFKRTLSLRLNELPSTLQRQN------AVME---SPTQNGNGAVGGTIPEVSQEQEDSIAQMCQQLTQG-----LTALTSDDPFSSAPVALTHQTSLPTYFQNHAPLTRQHTLPASQNASINPWGATSTSQYA 380          
BLAST of Protein numb vs. Ensembl Cavefish
Match: numb (NUMB endocytic adaptor protein [Source:NCBI gene;Acc:103042920])

HSP 1 Score: 253.062 bits (645), Expect = 2.254e-73
Identity = 152/350 (43.43%), Postives = 203/350 (58.00%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------RRL-----DPQSVIIAE----------PXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFS---DDPFSAAPI 1077
            +++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L     K    RA+L+VS D LRV ++ +K LI+DQ IEKVSFCAPDRN +R F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  TF+ N+T+FTR GSF+  T TE        R+L     D + V +                S+   +       P +IPR HA    L RQ S + FP L ++ +PFKR  S+R+ DL S  +RK+ +      IK  V E + E  ++++    I                        T+ FS   +DPFS+AP+
Sbjct:   19 SSRPHQWQTDEEAVRSGKCSFAVKYLGHVEVEESRGMHICEDAVKRLKTAGKKAV--RAVLWVSADGLRVVDDKTKDLILDQTIEKVSFCAPDRNFERAFSYICRDGTTRRWICHCFMAIKDSGERLSHAVGCAFAACLERKQKREKECGVTATFDANRTTFTREGSFRVTTATEQAEREEVMRQLQDAKKDSEGVTVTPGNNTVIPATVSSPSSSPPLTMGPQESNPHAIPRRHAPVEALARQGSFRGFPALSQKTSPFKRQMSLRMNDLPSTMQRKSDFP-----IKNTVPEVEGEVDSISSLCTQI------------------------TSAFSGPPEDPFSSAPM 337          
BLAST of Protein numb vs. Ensembl Cavefish
Match: numb (NUMB endocytic adaptor protein [Source:NCBI gene;Acc:103042920])

HSP 1 Score: 248.825 bits (634), Expect = 3.409e-72
Identity = 154/359 (42.90%), Postives = 207/359 (57.66%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------RRL-----DPQSVIIAE----------PXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFS---DDPFSAAPI 1077
            +++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ RA+L+VS D LRV ++ +K LI+DQ IEKVSFCAPDRN +R F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  TF+ N+T+FTR GSF+  T TE        R+L     D + V +                S+   +       P +IPR HA    L RQ S + FP L ++ +PFKR  S+R+ DL S  +RK+ +      IK  V E + E  ++++    I                        T+ FS   +DPFS+AP+
Sbjct:   19 SSRPHQWQTDEEAVRSGKCSFAVKYLGHVEVEESRGMHICEDAVKRLKTDRKFFKGFFTKAGKKAVRAVLWVSADGLRVVDDKTKDLILDQTIEKVSFCAPDRNFERAFSYICRDGTTRRWICHCFMAIKDSGERLSHAVGCAFAACLERKQKREKECGVTATFDANRTTFTREGSFRVTTATEQAEREEVMRQLQDAKKDSEGVTVTPGNNTVIPATVSSPSSSPPLTMGPQESNPHAIPRRHAPVEALARQGSFRGFPALSQKTSPFKRQMSLRMNDLPSTMQRKSDFP-----IKNTVPEVEGEVDSISSLCTQI------------------------TSAFSGPPEDPFSSAPM 348          
BLAST of Protein numb vs. Ensembl Cavefish
Match: numb (NUMB endocytic adaptor protein [Source:NCBI gene;Acc:103042920])

HSP 1 Score: 249.595 bits (636), Expect = 4.921e-72
Identity = 154/359 (42.90%), Postives = 207/359 (57.66%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------RRL-----DPQSVIIAE----------PXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFS---DDPFSAAPI 1077
            +++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ RA+L+VS D LRV ++ +K LI+DQ IEKVSFCAPDRN +R F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  TF+ N+T+FTR GSF+  T TE        R+L     D + V +                S+   +       P +IPR HA    L RQ S + FP L ++ +PFKR  S+R+ DL S  +RK+ +      IK  V E + E  ++++    I                        T+ FS   +DPFS+AP+
Sbjct:   19 SSRPHQWQTDEEAVRSGKCSFAVKYLGHVEVEESRGMHICEDAVKRLKTDRKFFKGFFTKAGKKAVRAVLWVSADGLRVVDDKTKDLILDQTIEKVSFCAPDRNFERAFSYICRDGTTRRWICHCFMAIKDSGERLSHAVGCAFAACLERKQKREKECGVTATFDANRTTFTREGSFRVTTATEQAEREEVMRQLQDAKKDSEGVTVTPGNNTVIPATVSSPSSSPPLTMGPQESNPHAIPRRHAPVEALARQGSFRGFPALSQKTSPFKRQMSLRMNDLPSTMQRKSDFP-----IKNTVPEVEGEVDSISSLCTQI------------------------TSAFSGPPEDPFSSAPM 348          
BLAST of Protein numb vs. Ensembl Cavefish
Match: numb (NUMB endocytic adaptor protein [Source:NCBI gene;Acc:103042920])

HSP 1 Score: 249.595 bits (636), Expect = 4.921e-72
Identity = 154/359 (42.90%), Postives = 207/359 (57.66%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------RRL-----DPQSVIIAE----------PXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFS---DDPFSAAPI 1077
            +++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ RA+L+VS D LRV ++ +K LI+DQ IEKVSFCAPDRN +R F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  TF+ N+T+FTR GSF+  T TE        R+L     D + V +                S+   +       P +IPR HA    L RQ S + FP L ++ +PFKR  S+R+ DL S  +RK+ +      IK  V E + E  ++++    I                        T+ FS   +DPFS+AP+
Sbjct:   19 SSRPHQWQTDEEAVRSGKCSFAVKYLGHVEVEESRGMHICEDAVKRLKTDRKFFKGFFTKAGKKAVRAVLWVSADGLRVVDDKTKDLILDQTIEKVSFCAPDRNFERAFSYICRDGTTRRWICHCFMAIKDSGERLSHAVGCAFAACLERKQKREKECGVTATFDANRTTFTREGSFRVTTATEQAEREEVMRQLQDAKKDSEGVTVTPGNNTVIPATVSSPSSSPPLTMGPQESNPHAIPRRHAPVEALARQGSFRGFPALSQKTSPFKRQMSLRMNDLPSTMQRKSDFP-----IKNTVPEVEGEVDSISSLCTQI------------------------TSAFSGPPEDPFSSAPM 348          
BLAST of Protein numb vs. Ensembl Cavefish
Match: numbl (NUMB like endocytic adaptor protein [Source:NCBI gene;Acc:103028067])

HSP 1 Score: 242.662 bits (618), Expect = 2.057e-70
Identity = 138/307 (44.95%), Postives = 188/307 (61.24%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSF---------------KQATITERRLDPQSVIIAEPXXXX----XXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKI 972
            ++P QW  DE+ VR+G C+F V+YLG +EV ESRGM VCEEA+K+L     K    +A+L+VS D LRV ++ +K LIVDQ IEKVSFCAPDRN+ + F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  +F+ ++TSF R GSF               KQ    ++ ++P  +    P + S             +  P  IPR HA    L RQ S + FP L ++N+PFKR  S+R+ DL S  +RK  + T   V + ++        T+   ++SIN +
Sbjct:   20 SRPHQWQADEEAVRKGKCNFAVRYLGLVEVEESRGMHVCEEAVKKLKVSGKKTV--KAVLWVSADGLRVVDDKTKDLIVDQTIEKVSFCAPDRNYDKAFSYICRDGTTRRWICHCFMALKDSGERLSHAVGCAFAACLERKQRREKECGVTASFDASRTSFVREGSFRVSSAGQQGDREDLMKQLQDKKKAVEPCCIPAVPPGNASPPEGAATQVDRTEMGGPHVIPRRHAPLEQLVRQGSFRGFPALSQKNSPFKRQLSLRLNDLPSTLQRKTDFQTKNPVPEMDL--------TIAGEADSINAL 316          
BLAST of Protein numb vs. Ensembl Sea Lamprey
Match: numb (NUMB endocytic adaptor protein [Source:ZFIN;Acc:ZDB-GENE-060422-1])

HSP 1 Score: 246.128 bits (627), Expect = 1.688e-71
Identity = 150/365 (41.10%), Postives = 209/365 (57.26%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVK--YLGSIEVFESRGMPVCEEAMXXXXXXXX------------XXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------RRLDPQSVII--------------AEPX----XXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPIN 1080
            +++P QW  DE+ VR G CSF VK  YLG++EV ESRGM VCE+A+K+L                  +   RA+L+VS DALRV  +++K LIVDQ IEKVSFCAPDRN++R F+YICRD TTRRWLCH F AVK+SGERLSHAVGCAFA CLE+KQ+REK+  V  TF+ ++TSFTR GSF+  T TE        R+++ Q   +              A P     +      +  +   +  +IPR HA    L RQ S + FP L ++++PFKR+ S+R+ DL S  +RK  +     V + E   + + P     +++ I+ +  + T+   P               ++DPF A P++
Sbjct:   19 SSRPHQWQTDEEAVRHGQCSFPVKVQYLGAVEVDESRGMHVCEDAVKRLKSSTGNRRSISGFLDVVGRTKVRAVLWVSADALRVVADLTKDLIVDQTIEKVSFCAPDRNYERAFSYICRDGTTRRWLCHSFMAVKDSGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTSFTREGSFRVMTATEQAERQEALRQIEEQKRAVKIKITVKTSLTTPFATPSPPLPTTIKCMIAGPSDGGSVLAIPRRHAPIDELVRQGSFRGFPALLQKSSPFKRNLSLRLNDLPSTLQRKTDFQLLNKVPEVESPNSPEPP-----SADGIHALCSQITSSFPP---------------AEDPFCAVPMS 363          
BLAST of Protein numb vs. Ensembl Sea Lamprey
Match: numb (NUMB endocytic adaptor protein [Source:ZFIN;Acc:ZDB-GENE-060422-1])

HSP 1 Score: 186.422 bits (472), Expect = 1.117e-51
Identity = 98/174 (56.32%), Postives = 127/174 (72.99%), Query Frame = 1
Query:  115 KPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKES-GERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE 630
            +P+QW  DE  VR   C F VKYLG +EV +SRG+ VCEEA+K+L     K    RA+L+V  + LR+ +E +K LI+DQ IEKVSFCAPD  ++R F+YICR+ TT RWLCH F A ++S GERLSHAVGCAFA CLE+K+QRE   SV  TF+E++T+F+R GSF+  + TE
Sbjct:   23 RPAQWEIDENNVRTEGCHFFVKYLGCVEVQQSRGIHVCEEAVKKLKSSGKKV---RAVLFVCPEQLRLVDEDTKDLIMDQTIEKVSFCAPDPRNERAFSYICRECTTLRWLCHSFLARRDSQGERLSHAVGCAFAECLERKRQRELGCSVTATFDESRTTFSREGSFRVPSATE 193          
BLAST of Protein numb vs. Ensembl Sea Lamprey
Match: numbl (NUMB like endocytic adaptor protein [Source:ZFIN;Acc:ZDB-GENE-051113-340])

HSP 1 Score: 147.517 bits (371), Expect = 3.822e-38
Identity = 66/97 (68.04%), Postives = 79/97 (81.44%), Query Frame = 1
Query:  340 LIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATIT 627
            LIVDQ+IEKVSFCAPDRN +R F+YICRD TTRRW+CH F A ++SGERLSHAVGCAF VCLE+KQ+REK+  V  TF+ ++TSF R GSF+    T
Sbjct:    3 LIVDQLIEKVSFCAPDRNLERAFSYICRDGTTRRWMCHCFMAARDSGERLSHAVGCAFTVCLERKQRREKECGVTATFDVDRTSFMREGSFRGGRAT 99          
BLAST of Protein numb vs. Ensembl Sea Lamprey
Match: gulp1a (GULP PTB domain containing engulfment adaptor 1a [Source:NCBI gene;Acc:368404])

HSP 1 Score: 62.003 bits (149), Expect = 7.867e-11
Identity = 45/144 (31.25%), Postives = 74/144 (51.39%), Query Frame = 1
Query:  115 KPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXX-----XXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEK 531
            K   W    + +   C S+ VKYLGS EV + +G  V ++A+++L      K    +K  +  L VS   + + +  SK    +  + ++SFCA D+  KR  A+IC+DA T +  C  F + K S E ++ ++G AF +   K
Sbjct:    9 KDKSWIHTPEMLTMSCVSYSVKYLGSCEVSQPKGSEVVKDAVRKLKFACHLKKSEGQKLPKVELQVSIRGVEILDPKSKESQHNCPLHRISFCADDKTDKRILAFICKDAETDQHFCFAFDSEK-SAEEITLSIGQAFDLAYRK 151          
BLAST of Protein numb vs. Ensembl Nematostella
Match: EDO42937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S014])

HSP 1 Score: 156.762 bits (395), Expect = 1.397e-44
Identity = 77/142 (54.23%), Postives = 101/142 (71.13%), Query Frame = 1
Query:  115 KPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQ 540
            +P  W +D  KVR G  SF VKY+G+IEV ESRG  VC EA +++ +    KK  R  L V+ D +RV +E +K L +DQ IEKVSFC PD +  R F+YICR+ TTRRW+CH F A++++GERLSHAVGCAF  CL++KQ+
Sbjct:    7 RPQVWENDSYKVRNGGVSFPVKYVGAIEVTESRGTQVCAEAFRKMREAGVHKKK-RMNLLVTSDCIRVVDEETKSLTIDQTIEKVSFCTPDPSDDRVFSYICREGTTRRWMCHCFIAIRDTGERLSHAVGCAFTACLQRKQK 147          
BLAST of Protein numb vs. Ensembl Nematostella
Match: EDO45363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT00])

HSP 1 Score: 53.9138 bits (128), Expect = 2.632e-7
Identity = 37/117 (31.62%), Postives = 62/117 (52.99%), Query Frame = 1
Query:  136 DEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXX--XXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESG 480
            +E+K R     F+ K LG  EV   RG  +C +A+K+L +   ++ +  ++ I+ V+   +R+ +E SK L+ +  I KVSF   D   K+ F Y+C  AT    + +  K  K +G
Sbjct:   33 NEEKFRGDGVHFKCKLLGLKEVSGPRGDTICIDAIKKLKQQIKQTGEHKQKIIMAVNLRGIRILDEKSKALVYEHAINKVSFITHDPEDKKIFGYVCSQATGH--MLYAIKYDKVAG 147          
BLAST of Protein numb vs. Ensembl Nematostella
Match: EDO49371 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG70])

HSP 1 Score: 47.7506 bits (112), Expect = 1.194e-6
Identity = 34/131 (25.95%), Postives = 66/131 (50.38%), Query Frame = 1
Query:  181 YLGSIEVFESRGMPVCEEAMXX---------XXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQRE 546
            + G  EV E++G  V +EA+ +                 K ++  L ++ D + + +  SK ++    +  +S+CA D+ +KR FA+I +D T+ +  C+ F+A +   E L+  VG AF +   +  +R+
Sbjct:    1 FYGVTEVAEAKGTEVIKEAITKVQFANHIKKSEAGTKASKLRKVDLKINIDGVSIEDSKSKEVLHSYPLHHISYCADDKRNKRVFAFIAKDKTSPKHTCYVFEA-ERLAEELTLTVGQAFDLAYRRFLERK 130          
BLAST of Protein numb vs. Ensembl Nematostella
Match: EDO43144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZG4])

HSP 1 Score: 48.9062 bits (115), Expect = 6.020e-6
Identity = 35/138 (25.36%), Postives = 71/138 (51.45%), Query Frame = 1
Query:  124 QWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXX-RAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKA-VKESGERLSHAVGCAFAVCLEK 531
            +W+ + + + +G  ++  +YLGS  V E  G+    +A +++    +K +     IL +S + ++  +  S+ L+    ++ VS+   D   K  FAYI +DA   +  CH F+   KE  + ++ ++G AF +  E+
Sbjct:  242 RWHHEPEVLLKGSVNYTTQYLGSHMVKEISGVTSTIDACRKMRLSTAKLQKVPSVILSISVNGIKFIDARSRLLVSHHDMKNVSYITQDPEDKCVFAYIAKDAKIDKHYCHVFRVEKKELSDEVTMSIGQAFELAYEQ 379          
BLAST of Protein numb vs. Ensembl Medaka
Match: numb (NUMB endocytic adaptor protein [Source:NCBI gene;Acc:101171729])

HSP 1 Score: 254.218 bits (648), Expect = 8.191e-74
Identity = 154/370 (41.62%), Postives = 211/370 (57.03%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------RRL-----DPQSVIIAEPX--------------XXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPINPAVHIKHNFVNESNNQTP 1134
            +++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L     K    RA+L+VS D LRV ++ +K LI+DQ IEKVSFCAPDRN +R F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  TF+ N+T+FTR GSF+  T TE        R+L     +P +    +                +  +++   + S     +IPR HA    L RQ S + FP L ++ +PFKR  S+R+ +L S  +R++ +      IK  V E + E        +SI+ +  + TT     P              +DPFS+AP+  A     + V   N  TP
Sbjct:   19 SSRPHQWQTDEEAVRGGKCSFAVKYLGHVEVEESRGMHICEDAVKRLKTAGKKAV--RAVLWVSADGLRVVDDKTKDLILDQTIEKVSFCAPDRNFERAFSYICRDGTTRRWICHCFMAIKDSGERLSHAVGCAFAACLERKQKREKECGVTATFDANRTTFTREGSFRVTTATEAAEREEVMRQLQDVKKEPDATAAGDSANCVTNPLAQQSGSPASPSSSPPLSVSALGAQAIPRRHAPAEALARQGSFRGFPALSQKTSPFKRHMSLRMNELPSTMQRRSDFP-----IKNAVPEVEGE-------GDSISSLCSQITTTFSGAP--------------EDPFSSAPMPKAASSPQSPVAPVNGSTP 360          
BLAST of Protein numb vs. Ensembl Medaka
Match: numb (NUMB endocytic adaptor protein [Source:NCBI gene;Acc:101171729])

HSP 1 Score: 251.521 bits (641), Expect = 1.454e-73
Identity = 152/342 (44.44%), Postives = 208/342 (60.82%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------RRLDPQSVIIAE-PXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPI 1077
            +++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ RA+L+VS D LRV ++ +K LI+DQ IEKVSFCAPDRN +R F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  TF+ N+T+FTR GSF+  T TE        R+L  Q V   +   +  +++   + S     +IPR HA    L RQ S + FP L ++ +PFKR  S+R+ +L S  +R++ +      IK  V E + E        +SI+ +  + TT     P              +DPFS+AP+
Sbjct:   19 SSRPHQWQTDEEAVRGGKCSFAVKYLGHVEVEESRGMHICEDAVKRLKTDRKFFKGFFAKAGKKAVRAVLWVSADGLRVVDDKTKDLILDQTIEKVSFCAPDRNFERAFSYICRDGTTRRWICHCFMAIKDSGERLSHAVGCAFAACLERKQKREKECGVTATFDANRTTFTREGSFRVTTATEAAEREEVMRQL--QDVKKGQCVPASPSSSPPLSVSALGAQAIPRRHAPAEALARQGSFRGFPALSQKTSPFKRHMSLRMNELPSTMQRRSDFP-----IKNAVPEVEGE-------GDSISSLCSQITTTFSGAP--------------EDPFSSAPM 332          
BLAST of Protein numb vs. Ensembl Medaka
Match: numb (NUMB endocytic adaptor protein [Source:NCBI gene;Acc:101171729])

HSP 1 Score: 251.136 bits (640), Expect = 1.270e-72
Identity = 156/379 (41.16%), Postives = 215/379 (56.73%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------RRL-----DPQSVIIAEPX--------------XXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPINPAVHIKHNFVNESNNQTP 1134
            +++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ RA+L+VS D LRV ++ +K LI+DQ IEKVSFCAPDRN +R F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  TF+ N+T+FTR GSF+  T TE        R+L     +P +    +                +  +++   + S     +IPR HA    L RQ S + FP L ++ +PFKR  S+R+ +L S  +R++ +      IK  V E + E        +SI+ +  + TT     P              +DPFS+AP+  A     + V   N  TP
Sbjct:   19 SSRPHQWQTDEEAVRGGKCSFAVKYLGHVEVEESRGMHICEDAVKRLKTDRKFFKGFFAKAGKKAVRAVLWVSADGLRVVDDKTKDLILDQTIEKVSFCAPDRNFERAFSYICRDGTTRRWICHCFMAIKDSGERLSHAVGCAFAACLERKQKREKECGVTATFDANRTTFTREGSFRVTTATEAAEREEVMRQLQDVKKEPDATAAGDSANCVTNPLAQQSGSPASPSSSPPLSVSALGAQAIPRRHAPAEALARQGSFRGFPALSQKTSPFKRHMSLRMNELPSTMQRRSDFP-----IKNAVPEVEGE-------GDSISSLCSQITTTFSGAP--------------EDPFSSAPMPKAASSPQSPVAPVNGSTP 371          
BLAST of Protein numb vs. Ensembl Medaka
Match: numb (NUMB endocytic adaptor protein [Source:NCBI gene;Acc:101171729])

HSP 1 Score: 247.284 bits (630), Expect = 1.390e-71
Identity = 151/360 (41.94%), Postives = 209/360 (58.06%), Query Frame = 1
Query:  109 NTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXX---------XXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSFKQATITE--------RRL-----DPQSVIIAEPX--------------XXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPI 1077
            +++P QW  DE+ VR G CSF VKYLG +EV ESRGM +CE+A+K+L            K+ KK+ RA+L+VS D LRV ++ +K LI+DQ IEKVSFCAPDRN +R F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  TF+ N+T+FTR GSF+  T TE        R+L     +P +    +                +  +++   + S     +IPR HA    L RQ S + FP L ++ +PFKR  S+R+ +L S  +R++ +      IK  V E + E        +SI+ +  + TT     P              +DPFS+AP+
Sbjct:   19 SSRPHQWQTDEEAVRGGKCSFAVKYLGHVEVEESRGMHICEDAVKRLKTDRKFFKGFFAKAGKKAVRAVLWVSADGLRVVDDKTKDLILDQTIEKVSFCAPDRNFERAFSYICRDGTTRRWICHCFMAIKDSGERLSHAVGCAFAACLERKQKREKECGVTATFDANRTTFTREGSFRVTTATEAAEREEVMRQLQDVKKEPDATAAGDSANCVTNPLAQQSGSPASPSSSPPLSVSALGAQAIPRRHAPAEALARQGSFRGFPALSQKTSPFKRHMSLRMNELPSTMQRRSDFP-----IKNAVPEVEGE-------GDSISSLCSQITTTFSGAP--------------EDPFSSAPM 352          
BLAST of Protein numb vs. Ensembl Medaka
Match: numbl (numb-like protein [Source:NCBI gene;Acc:101156908])

HSP 1 Score: 239.195 bits (609), Expect = 2.746e-69
Identity = 130/276 (47.10%), Postives = 173/276 (62.68%), Query Frame = 1
Query:  112 TKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKD-SVDVTFNENKTSFTRLGSF---------------KQATITERRLDPQSVII------AEPXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKN 873
            ++P QW  DE+ VR+G C+F V+YLG +EV ESRGM VCEEA+K+L     K    +A+L+VS D LRV ++ +K LIVDQ IEKVSFCAPDRN+ + F+YICRD TTRRW+CH F A+K+SGERLSHAVGCAFA CLE+KQ+REK+  V  +F+ ++TSF R GSF               +   + E++   Q  ++      A        +         P +IPR HA    L RQ S + FP L ++N+PFKR  S+R+ DL S  +RK 
Sbjct:   20 SRPHQWQADEEAVRKGKCNFAVRYLGLVEVEESRGMHVCEEAVKKLKISGKKTV--KAVLWVSADGLRVVDDKTKDLIVDQTIEKVSFCAPDRNYDKAFSYICRDGTTRRWMCHCFMALKDSGERLSHAVGCAFAACLERKQRREKECGVTASFDASRTSFVREGSFRVNSSSSHQGSSSSERDDKLQEKKKGNQPCVVPALPPGAASPPEGAASPMERPEPGGPHAIPRRHAPIEQLVRQGSFRGFPALSQKNSPFKRQLSLRLNDLPSTLQRKT 293          
BLAST of Protein numb vs. Planmine SMEST
Match: SMESG000033358.1 (SMESG000033358.1)

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 446/450 (99.11%), Postives = 448/450 (99.56%), Query Frame = 1
Query:   82 PTSKALLDSNTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKDSVDVTFNENKTSFTRLGSFKQATITERRLDPQSVIIAEPXXXXXXXXXXXXXXXXXXXIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPINPAVHIKHNFVNESNNQTPFSSTSAYQYSMRAPHSEKLYPGPXXXXXXXXXXXXXXXXXFWPTQNQYKSFNGKLSTTWSDDILRPTHVDHELNDKHFQLCANSVQKNPFDVTWVRSPP 1431
            PTSKALLDSNTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMKQLLKYKSKKKSKRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKDSVDVTFNENKTSFTRLGSFKQATITERRLDPQSVIIAEPVSGS+NANSTNNSVPTPSSIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIEST PVDPVPS GNKEPDFTNLFSDDPFSAAPINPAVHIKHNFVNESNNQTPFSSTSAYQYSMRAPHSEKLYPGP+TNLWNNTNGSNSTNNNFWPTQNQYKSFNGKLSTTWSDDILRPTHVDHELNDKHFQLCANSVQKNPFDVTWVRSPP
Sbjct:   15 PTSKALLDSNTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMKQLLKYKSKKKSKRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKDSVDVTFNENKTSFTRLGSFKQATITERRLDPQSVIIAEPVSGSSNANSTNNSVPTPSSIPRPHASQSVLDRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKTMTTTSESINKIPIESTIPVDPVPSKGNKEPDFTNLFSDDPFSAAPINPAVHIKHNFVNESNNQTPFSSTSAYQYSMRAPHSEKLYPGPSTNLWNNTNGSNSTNNNFWPTQNQYKSFNGKLSTTWSDDILRPTHVDHELNDKHFQLCANSVQKNPFDVTWVRSPP 464          
BLAST of Protein numb vs. Planmine SMEST
Match: SMESG000078082.1 (SMESG000078082.1)

HSP 1 Score: 313.538 bits (802), Expect = 1.818e-97
Identity = 160/260 (61.54%), Postives = 199/260 (76.54%), Query Frame = 1
Query:  103 DSNTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKDSVDVTFNENKTSFTRLGSFKQATITERRLDPQSVIIAEPXXXX----XXXXXXXXXXXXXXXIPRPHASQSVL-DRQNSMKIFPKLQEQNNPFKRDHSVRITDLSSNQER 867
            D N KP  W +DE+KVREGCCSFQVKYLG IEVF+SRGM VCEEA+K L + K K    RAILYVSGD +RV++EISKGLIVDQ IEKVSFC+PDRNHK+GFAYICRD TTRRW+CH F AVKE+GERLSHAVGCAFA+CLEKKQ+RE +    T  ENK    + GSF+QA++TER  DPQS IIAEP++ S       N+ + +    S +PRPHAS +   +RQ S+++FPKLQE ++PFKR+ S+R+ ++ S+  +
Sbjct:   21 DPNNKPVSWQEDERKVREGCCSFQVKYLGYIEVFDSRGMQVCEEALKALRRPKKKTI--RAILYVSGDTIRVSDEISKGLIVDQTIEKVSFCSPDRNHKKGFAYICRDGTTRRWMCHAFLAVKETGERLSHAVGCAFAICLEKKQKRESEVAQSTILENKALQGKSGSFRQASLTERLQDPQSAIIAEPLASSPPHPPAINAISPNHTRASVVPRPHASVTFFSERQTSLRMFPKLQE-SSPFKRELSLRLAEIPSSSSK 277          
BLAST of Protein numb vs. Planmine SMEST
Match: SMESG000078082.1 (SMESG000078082.1)

HSP 1 Score: 311.997 bits (798), Expect = 5.601e-97
Identity = 159/254 (62.60%), Postives = 196/254 (77.17%), Query Frame = 1
Query:  103 DSNTKPSQWNDDEKKVREGCCSFQVKYLGSIEVFESRGMPVCEEAMXXXXXXXXXXXXXRAILYVSGDALRVTEEISKGLIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERLSHAVGCAFAVCLEKKQQREKDSVDVTFNENKTSFTRLGSFKQATITERRLDPQSVIIAEPXXXX----XXXXXXXXXXXXXXXIPRPHASQSVL-DRQNSMKIFPKLQEQNNPFKRDHSVRITDL 849
            D N KP  W +DE+KVREGCCSFQVKYLG IEVF+SRGM VCEEA+K L + K K    RAILYVSGD +RV++EISKGLIVDQ IEKVSFC+PDRNHK+GFAYICRD TTRRW+CH F AVKE+GERLSHAVGCAFA+CLEKKQ+RE +    T  ENK    + GSF+QA++TER  DPQS IIAEP++ S       N+ + +    S +PRPHAS +   +RQ S+++FPKLQE ++PFKR+ S+R+ ++
Sbjct:   21 DPNNKPVSWQEDERKVREGCCSFQVKYLGYIEVFDSRGMQVCEEALKALRRPKKKTI--RAILYVSGDTIRVSDEISKGLIVDQTIEKVSFCSPDRNHKKGFAYICRDGTTRRWMCHAFLAVKETGERLSHAVGCAFAICLEKKQKRESEVAQSTILENKALQGKSGSFRQASLTERLQDPQSAIIAEPLASSPPHPPAINAISPNHTRASVVPRPHASVTFFSERQTSLRMFPKLQE-SSPFKRELSLRLAEI 271          
The following BLAST results are available for this feature:
BLAST of Protein numb vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NUMB6.999e-7342.86NUMB endocytic adaptor protein [Source:HGNC Symbol... [more]
NUMB1.966e-7242.86NUMB endocytic adaptor protein [Source:HGNC Symbol... [more]
NUMB1.966e-7242.86NUMB endocytic adaptor protein [Source:HGNC Symbol... [more]
NUMB2.289e-7142.35NUMB endocytic adaptor protein [Source:HGNC Symbol... [more]
NUMB2.289e-7142.35NUMB endocytic adaptor protein [Source:HGNC Symbol... [more]
back to top
BLAST of Protein numb vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
num-11.647e-6240.68Numb-related protein 1 [Source:UniProtKB/Swiss-Pr... [more]
num-11.860e-6240.68Numb-related protein 1 [Source:UniProtKB/Swiss-Pr... [more]
num-13.645e-6240.43Numb-related protein 1 [Source:UniProtKB/Swiss-Pr... [more]
num-13.365e-6140.43Numb-related protein 1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protein numb vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
numb3.097e-8354.48gene:FBgn0002973 transcript:FBtr0079821[more]
numb8.112e-8354.48gene:FBgn0002973 transcript:FBtr0079822[more]
numb8.112e-8354.48gene:FBgn0002973 transcript:FBtr0339526[more]
Dab5.445e-725.83gene:FBgn0000414 transcript:FBtr0330190[more]
Dab6.303e-725.83gene:FBgn0000414 transcript:FBtr0305085[more]
back to top
BLAST of Protein numb vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
numb1.257e-7243.45NUMB endocytic adaptor protein [Source:ZFIN;Acc:ZD... [more]
numb6.277e-7143.21NUMB endocytic adaptor protein [Source:ZFIN;Acc:ZD... [more]
numbl1.664e-6944.59NUMB like endocytic adaptor protein [Source:ZFIN;A... [more]
numbl1.879e-6944.59NUMB like endocytic adaptor protein [Source:ZFIN;A... [more]
numbl1.879e-6944.59NUMB like endocytic adaptor protein [Source:ZFIN;A... [more]
back to top
BLAST of Protein numb vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
numb5.505e-7342.57numb homolog [Source:NCBI gene;Acc:100038147][more]
numb7.375e-7342.57numb homolog [Source:NCBI gene;Acc:100038147][more]
numb1.192e-7046.25numb homolog [Source:NCBI gene;Acc:100038147][more]
NUMBL2.568e-6941.60numb homolog-like [Source:NCBI gene;Acc:100488844][more]
numb3.236e-6940.53numb homolog [Source:NCBI gene;Acc:100038147][more]
back to top
BLAST of Protein numb vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Numb1.093e-7142.54NUMB endocytic adaptor protein [Source:MGI Symbol;... [more]
Numb1.661e-7142.54NUMB endocytic adaptor protein [Source:MGI Symbol;... [more]
Numb7.969e-7146.21NUMB endocytic adaptor protein [Source:MGI Symbol;... [more]
Numb2.452e-7042.03NUMB endocytic adaptor protein [Source:MGI Symbol;... [more]
Numb4.699e-7042.03NUMB endocytic adaptor protein [Source:MGI Symbol;... [more]
back to top
BLAST of Protein numb vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16554|NUMB_DROME8.131e-8254.48Protein numb OS=Drosophila melanogaster OX=7227 GN... [more]
sp|P49757|NUMB_HUMAN1.799e-7042.35Protein numb homolog OS=Homo sapiens OX=9606 GN=NU... [more]
sp|Q9QZS3|NUMB_MOUSE3.287e-6942.03Protein numb homolog OS=Mus musculus OX=10090 GN=N... [more]
sp|Q2LC84|NUMB_RAT8.676e-6941.53Protein numb homolog OS=Rattus norvegicus OX=10116... [more]
sp|Q9XTY6|NUMB1_CAEEL4.637e-6140.43Numb-related protein 1 OS=Caenorhabditis elegans O... [more]
back to top
BLAST of Protein numb vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7BNJ91.183e-10252.01PID domain-containing protein (Fragment) OS=Arion ... [more]
A0A2C9JZJ95.307e-10050.14PID domain-containing protein OS=Biomphalaria glab... [more]
A0A0B7BR895.905e-10051.13PID domain-containing protein (Fragment) OS=Arion ... [more]
A0A0B7BNK46.370e-10062.35PID domain-containing protein (Fragment) OS=Arion ... [more]
A0A182ZN867.232e-10050.41PID domain-containing protein OS=Biomphalaria glab... [more]
back to top
BLAST of Protein numb vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
numb2.254e-7343.43NUMB endocytic adaptor protein [Source:NCBI gene;A... [more]
numb3.409e-7242.90NUMB endocytic adaptor protein [Source:NCBI gene;A... [more]
numb4.921e-7242.90NUMB endocytic adaptor protein [Source:NCBI gene;A... [more]
numb4.921e-7242.90NUMB endocytic adaptor protein [Source:NCBI gene;A... [more]
numbl2.057e-7044.95NUMB like endocytic adaptor protein [Source:NCBI g... [more]
back to top
BLAST of Protein numb vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
numb1.688e-7141.10NUMB endocytic adaptor protein [Source:ZFIN;Acc:ZD... [more]
numb1.117e-5156.32NUMB endocytic adaptor protein [Source:ZFIN;Acc:ZD... [more]
numbl3.822e-3868.04NUMB like endocytic adaptor protein [Source:ZFIN;A... [more]
gulp1a7.867e-1131.25GULP PTB domain containing engulfment adaptor 1a [... [more]
back to top
BLAST of Protein numb vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein numb vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO429371.397e-4454.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453632.632e-731.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493711.194e-625.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431446.020e-625.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein numb vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
numb8.191e-7441.62NUMB endocytic adaptor protein [Source:NCBI gene;A... [more]
numb1.454e-7344.44NUMB endocytic adaptor protein [Source:NCBI gene;A... [more]
numb1.270e-7241.16NUMB endocytic adaptor protein [Source:NCBI gene;A... [more]
numb1.390e-7141.94NUMB endocytic adaptor protein [Source:NCBI gene;A... [more]
numbl2.746e-6947.10numb-like protein [Source:NCBI gene;Acc:101156908][more]
back to top
BLAST of Protein numb vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000033358.10.000e+099.11SMESG000033358.1[more]
SMESG000078082.11.818e-9761.54SMESG000078082.1[more]
SMESG000078082.15.601e-9762.60SMESG000078082.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030724 ID=SMED30030724|Name=Protein numb|organism=Schmidtea mediterranea sexual|type=transcript|length=2371bp
GTTTGTTTAAACAATCCAACGACACTTTAATATTTCCATATGGAACGTTT
CAAAAGAACATTTACTTTACGAAAAAAGAAACCTACTAGCAAAGCATTAT
TAGATTCTAATACTAAACCAAGTCAATGGAATGATGATGAAAAAAAAGTT
CGCGAAGGTTGTTGCAGTTTCCAAGTTAAATATTTAGGAAGTATTGAAGT
GTTTGAATCTCGTGGAATGCCGGTTTGTGAAGAAGCAATGAAGCAATTGC
TAAAATACAAATCTAAAAAAAAATCAAAAAGAGCAATTTTATATGTTAGT
GGTGATGCATTGAGAGTCACAGAAGAAATAAGCAAAGGACTCATTGTTGA
TCAAGTTATTGAAAAGGTTTCATTTTGTGCACCAGATCGCAATCATAAAC
GTGGATTCGCGTACATTTGTCGTGATGCAACCACTAGAAGGTGGTTATGT
CATGGATTTAAAGCTGTCAAAGAATCTGGTGAGCGATTATCACACGCAGT
TGGCTGTGCTTTTGCTGTTTGTCTTGAGAAGAAGCAACAACGCGAAAAGG
ATTCTGTCGATGTGACTTTTAATGAGAATAAAACTAGTTTTACAAGACTT
GGGTCATTTAAACAAGCAACAATTACCGAGAGGCGTTTAGACCCCCAATC
AGTGATTATAGCTGAACCAGTTTCTGGTTCTAACAATGCCAATTCCACGA
ATAATTCCGTTCCCACTCCATCGTCTATTCCACGGCCTCATGCTAGTCAG
TCGGTTTTGGACAGACAAAACTCGATGAAAATTTTTCCTAAACTACAAGA
ACAAAATAATCCTTTCAAAAGAGATCATTCAGTAAGAATTACAGATTTAT
CATCTAACCAAGAAAGAAAAAATATGTGGAACACAGCGGCAGCGGTGATC
AAAGAGGAAGTCAGTGAAACCAAGGATGAGCCGAAGACAATGACAACAAC
GTCGGAATCAATTAATAAAATTCCGATTGAGTCCACTACACCAGTGGACC
CAGTTCCTTCTAATGGCAATAAAGAACCAGATTTTACTAATTTGTTTTCC
GACGATCCATTCAGTGCTGCACCGATAAATCCTGCAGTTCATATCAAACA
CAACTTTGTAAATGAAAGTAACAATCAAACTCCATTCAGTAGCACAAGTG
CTTATCAATATTCAATGCGAGCACCTCACTCAGAAAAACTTTATCCCGGT
CCAAACACTAATCTGTGGAATAATACCAATGGCAGCAATAGTACCAACAA
TAACTTTTGGCCCACCCAAAATCAATACAAGTCATTCAATGGGAAATTAT
CTACGACGTGGAGTGATGATATTTTAAGACCAACTCATGTGGATCATGAA
TTAAATGATAAACATTTTCAATTATGTGCCAATTCTGTCCAGAAAAATCC
ATTCGACGTGACCTGGGTCCGAAGCCCTCCAAACATCAGTACAAATATCA
ATAATAATAATAATAATATTAACAAGACCAGCAGCAATCACAATACGAAT
CCTTTTAAAACTTGATATTTCTACCTTCATTTCGACGCAAAGTATATTTA
TTACACCTGATATCATTCCTTATCATCTTTATTTGCCTTTTACCGAAATT
ATTATTCGGCTCTTTTTAAAAAAACTCAATAAATCGTTATTAGAATGATG
CAGACTGATTATTGATAAATATATTGATATTATTTTATTATTTCATTAAC
ACATCGATAATTATTGTGAAGATTTTATTGAATTTCGATTTTCATTGATT
CAAATTTATAGATATTTGTATATTATATTTACTATAATGCACATCTTTGT
ATGAAATAATTGAACTATCCAAAGTTTAATTTTCAAAAAAGTTTATTAAT
AATATTTACAAAGACAATTTTTCAAAATCTTTCGGACTTATTTGTTGATA
TTTCGCTAATATATTCATTCGTTTCAAGATCATATTGATATATATAATAT
ATATAATTATATATTAATATATATTTTACTATTTTTATCTTCGACCAATC
CGATCTATTGGCTGCCGCAGCTGATAGTTTTTTATTTGTAATTTCTTGCT
CAATGGATTTTATTGGATGTTGAAGCGCGTTATTGTGTGTGACTAGTAGG
GTCGTCGGTTCAAATGTGTTGTTCAAACCAAGCTTAGCTTTATTGTTAAT
GAGATTTTTCTGTATCATGTTTAAAATGGTCATTTGATCTGTATCAGTTT
TATAAATAAAATATTTTTTAGGAATTAATTTTATTAATCAATTTTTCATG
TGAGATAATTTTTATTGAAGCTTGCTGTTGTTACTAACTTTAATTATTGA
CTAACATTTGATAGGTTTTGGTTTCGGTATATTTTGATAATTAAATCTTG
TAAGTAGTTTATTTATTTATC
back to top

protein sequence of SMED30030724-orf-1

>SMED30030724-orf-1 ID=SMED30030724-orf-1|Name=SMED30030724-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=492bp
MERFKRTFTLRKKKPTSKALLDSNTKPSQWNDDEKKVREGCCSFQVKYLG
SIEVFESRGMPVCEEAMKQLLKYKSKKKSKRAILYVSGDALRVTEEISKG
LIVDQVIEKVSFCAPDRNHKRGFAYICRDATTRRWLCHGFKAVKESGERL
SHAVGCAFAVCLEKKQQREKDSVDVTFNENKTSFTRLGSFKQATITERRL
DPQSVIIAEPVSGSNNANSTNNSVPTPSSIPRPHASQSVLDRQNSMKIFP
KLQEQNNPFKRDHSVRITDLSSNQERKNMWNTAAAVIKEEVSETKDEPKT
MTTTSESINKIPIESTTPVDPVPSNGNKEPDFTNLFSDDPFSAAPINPAV
HIKHNFVNESNNQTPFSSTSAYQYSMRAPHSEKLYPGPNTNLWNNTNGSN
STNNNFWPTQNQYKSFNGKLSTTWSDDILRPTHVDHELNDKHFQLCANSV
QKNPFDVTWVRSPPNISTNINNNNNNINKTSSNHNTNPFKT*
back to top

protein sequence of SMED30030724-orf-2

>SMED30030724-orf-2 ID=SMED30030724-orf-2|Name=SMED30030724-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
MTILNMIQKNLINNKAKLGLNNTFEPTTLLVTHNNALQHPIKSIEQEITN
KKLSAAAANRSDWSKIKIVKYILIYNYIYYIYQYDLETNEYISEISTNKS
ERF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005868cytoplasmic dynein complex
GO:0005929cilium
GO:0045178basal part of cell
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005938cell cortex
GO:0045180basal cortex
Vocabulary: biological process
TermDefinition
GO:0035721intraciliary retrograde transport
GO:0035735intraciliary transport involved in cilium assembly
GO:0008593regulation of Notch signaling pathway
GO:0009786regulation of asymmetric cell division
GO:0016360sensory organ precursor cell fate determination
GO:0035050embryonic heart tube development
GO:0042694muscle cell fate specification
GO:0045035sensory organ precursor cell division
GO:0045165cell fate commitment
GO:0001709cell fate determination
GO:0007219Notch signaling pathway
GO:0007275multicellular organism development
GO:0007400neuroblast fate determination
GO:0007405neuroblast proliferation
GO:0007417central nervous system development
GO:0007419ventral cord development
GO:0007422peripheral nervous system development
GO:0007507heart development
GO:0007622rhythmic behavior
GO:0008104protein localization
GO:0008347glial cell migration
GO:0008356asymmetric cell division
GO:0045746negative regulation of Notch signaling pathway
GO:0045807positive regulation of endocytosis
GO:0050767regulation of neurogenesis
GO:0051642centrosome localization
GO:0051960regulation of nervous system development
GO:0055059asymmetric neuroblast division
GO:0061320pericardial nephrocyte differentiation
GO:0061382Malpighian tubule tip cell differentiation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor cell
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0000429neoblast
PLANA:0000463cholinergic neuron
PLANA:0000478pharynx musculature
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR006020PTB/PI_dom
IPR011993PH-like_dom_sf
IPR010449Numb_domain
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0005112Notch binding
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006020PTB/PI domainSMARTSM00462PTB_9coord: 39..171
e-value: 7.3E-38
score: 141.8
IPR006020PTB/PI domainPFAMPF00640PIDcoord: 44..167
e-value: 1.3E-23
score: 83.6
IPR006020PTB/PI domainPROSITEPS01179PIDcoord: 42..174
score: 27.516
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 28..167
e-value: 3.7E-55
score: 187.4
IPR010449NUMB domainPFAMPF06311NumbFcoord: 227..311
e-value: 1.1E-16
score: 61.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 468..490
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 210..239
NoneNo IPR availablePANTHERPTHR47368FAMILY NOT NAMEDcoord: 1..355
NoneNo IPR availableCDDcd01268PTB_Numbcoord: 28..164
e-value: 9.19389E-84
score: 252.996
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 24..171