Ribonuclease

Overview
NameRibonuclease
Smed IDSMED30030716
Length (bp)995
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribonuclease (SMED30030716) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribonuclease (SMED30030716) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribonuclease (SMED30030716) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribonuclease (SMED30030716) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030716

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30030716SMESG000022763.1 SmedASXL_006219SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30030716SMESG000022763.1 SmedASXL_006219SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30030716SMESG000022763.1 dd_Smed_v4_10404_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30030716SMESG000022763.1 dd_Smed_v4_10404_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30030716SMESG000022763.1 dd_Smed_v4_10404_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribonuclease vs. Ensembl Human
Match: RNASEH2A (ribonuclease H2 subunit A [Source:HGNC Symbol;Acc:HGNC:18518])

HSP 1 Score: 228.409 bits (581), Expect = 1.121e-72
Identity = 125/290 (43.10%), Postives = 170/290 (58.62%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMR--HKYFTARKLERVSKF 962
            PC LG+DEAGRGPVLGPMVY+  Y  +  L  L  + + DSK L E  R  L + + DTD    G+ +++LSP+ I+  ML   K NLNS+SHD A  +I+  +++GVN+T+V++DTVG PE Y A +   FP ++V V++KADA Y +VSAASI AKV RD+ +  W+  E     + + GSGYP+DP TK +LK   + +FGFPQFVR SW TA  I+EK+   + WED           SA  N  G+      K    F +       R  H+YF  R LE  +  
Sbjct:   28 PCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKTLLESERERLFAKMEDTDF--VGWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFVDTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEKLQDLDTDYGSGYPNDPKTKAWLKEHVEPVFGFPQFVRFSWRTAQTILEKEAEDVIWED-----------SASENQEGL-----RKITSYFLNEGSQARPRSSHRYFLERGLESATSL 299          
BLAST of Ribonuclease vs. Ensembl Human
Match: RNASEH2A (ribonuclease H2 subunit A [Source:HGNC Symbol;Acc:HGNC:18518])

HSP 1 Score: 98.2117 bits (243), Expect = 1.674e-24
Identity = 53/113 (46.90%), Postives = 74/113 (65.49%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEV 437
            PC LG+DEAGRGPVLGPMVY+  Y  +  L  L  + + DSK L E  R  L + + DTD    G+ +++LSP+ I+  ML   K NLNS+SHD A  +I+  +++GVN+T+V
Sbjct:   27 PCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKTLLESERERLFAKMEDTDFV--GWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQV 137          
BLAST of Ribonuclease vs. Ensembl Human
Match: RNASEH2A (ribonuclease H2 subunit A [Source:HGNC Symbol;Acc:HGNC:18518])

HSP 1 Score: 50.0618 bits (118), Expect = 1.007e-7
Identity = 21/33 (63.64%), Postives = 24/33 (72.73%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKL 197
            PC LG+DEAGRGPVLGPMVY+  Y  +  L  L
Sbjct:   28 PCVLGVDEAGRGPVLGPMVYAICYCPLPRLADL 60          
BLAST of Ribonuclease vs. Ensembl Celegans
Match: rnh-2 (Ribonuclease H2 subunit A [Source:UniProtKB/Swiss-Prot;Acc:Q9U6P6])

HSP 1 Score: 211.846 bits (538), Expect = 1.117e-66
Identity = 121/292 (41.44%), Postives = 165/292 (56.51%), Query Frame = 3
Query:   96 FPCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEX--XXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRE-TFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVSKF 962
             PC LGIDEAGRGPVLGPMVY+ A   +    +L N+G+DDSK L E  R E+       +  +++  Y +  LSP  I+  ML   K +LN +SH+AAI +IR  +   VN+ E+ +DTVG    Y A +   FP + + V  KAD+ + IVSAASI AKV RD  + NW+ RE    + +   GSGYP DP TK +L+ + + +FGF   VR SW TAS I+EK CVP SWED+E     +    +KR +S MV +   +           V  R+ YF  R +  +  F
Sbjct:   20 IPCVLGIDEAGRGPVLGPMVYAAAISPLDQNVELKNLGVDDSKALNEAKREEIFNKMNEDEDIQQIIAYALRCLSPELISCSMLKRQKYSLNEVSHEAAITLIRDALACNVNVVEIKVDTVGPKATYQAKLEKLFPGISICVTEKADSLFPIVSAASIAAKVTRDSRLRNWQFREKNIKVPDAGYGSGYPGDPNTKKFLQLSVEPVFGFCSLVRSSWKTASTIVEKRCVPGSWEDDEE----EGKSQSKRMTSWMVPKNETE----------VVPKRNVYFKERHMSNILTF 297          
BLAST of Ribonuclease vs. Ensembl Fly
Match: CG13690 (gene:FBgn0031252 transcript:FBtr0078090)

HSP 1 Score: 206.068 bits (523), Expect = 1.116e-63
Identity = 100/218 (45.87%), Postives = 139/218 (63.76%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEX--XXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTA 746
            PC LG+DEAGRGPVLGPMVY  +Y  + + + L ++G  DSK+L E  R+ +       +      G+ +EI+SP+ I+  M   +K +LN +S D+A+ +I++ I+ GVN+ EVY+DTVG PEKY   +   FP  K+ V  KAD++Y IVSAASI AKV RD  +  W   E   + ++  GSGYP DPVT+ +L    D +FGFP+ VR SWSTA
Sbjct:   70 PCMLGVDEAGRGPVLGPMVYGISYCPLESNKALEDLGCADSKQLTEGKRDIIFNDINTKEYATSCVGWAVEIISPNTISTSMYRRSKCSLNEVSMDSAMGLIQQAIDAGVNIAEVYVDTVGPPEKYQEKLLKRFPSFKITVAKKADSTYPIVSAASICAKVTRDHALKVWSFPEGLVIKDNEFGSGYPGDPVTRRFLTEYIDLVFGFPRLVRFSWSTA 287          
BLAST of Ribonuclease vs. Ensembl Zebrafish
Match: rnaseh2a (ribonuclease H2, subunit A [Source:ZFIN;Acc:ZDB-GENE-040426-976])

HSP 1 Score: 235.728 bits (600), Expect = 1.378e-75
Identity = 128/289 (44.29%), Postives = 176/289 (60.90%), Query Frame = 3
Query:  102 CCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYS---PSLSVDMR--HKYFTARKLERV 953
            CCLGIDEAGRGPVLGPMVY   +  +   E L N+ + DSK L E  R E L +  D  K   G+ ++ILSP+ I+  ML   K NLN++SHDAAI +++  ++ GV L EV++DTVG  EKY   +S  FP ++V V  KAD+ + IVSAASI AKV RD  + +WK  E     + + GSGYP+DP TK++L    D +FG+PQFVR SWSTA  +++   V + W+D+E        K+A R +        N S+L ++S   PS     R  H++FT RKL+ +
Sbjct:   29 CCLGIDEAGRGPVLGPMVYGICFCPVSRKEDLKNLKVADSKTLTEAER-ENLFVKLDEAKSFVGWALQILSPNMISTSMLQRAKYNLNALSHDAAIGLVQYALDSGVQLKEVFVDTVGPAEKYQDKLSQRFPGVEVTVRPKADSLFPIVSAASICAKVARDHAVKSWKFAEDLGDVDTDYGSGYPNDPKTKSWLLKYLDPVFGYPQFVRFSWSTAQTLLDSKAVTVHWDDDEE----DGEKAAARQN--------NTSVLSYFSRNKPSELTHTRDTHRFFTERKLKSI 304          
BLAST of Ribonuclease vs. Ensembl Zebrafish
Match: rnaseh2a (ribonuclease H2, subunit A [Source:ZFIN;Acc:ZDB-GENE-040426-976])

HSP 1 Score: 235.728 bits (600), Expect = 1.378e-75
Identity = 128/289 (44.29%), Postives = 176/289 (60.90%), Query Frame = 3
Query:  102 CCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYS---PSLSVDMR--HKYFTARKLERV 953
            CCLGIDEAGRGPVLGPMVY   +  +   E L N+ + DSK L E  R E L +  D  K   G+ ++ILSP+ I+  ML   K NLN++SHDAAI +++  ++ GV L EV++DTVG  EKY   +S  FP ++V V  KAD+ + IVSAASI AKV RD  + +WK  E     + + GSGYP+DP TK++L    D +FG+PQFVR SWSTA  +++   V + W+D+E        K+A R +        N S+L ++S   PS     R  H++FT RKL+ +
Sbjct:   29 CCLGIDEAGRGPVLGPMVYGICFCPVSRKEDLKNLKVADSKTLTEAER-ENLFVKLDEAKSFVGWALQILSPNMISTSMLQRAKYNLNALSHDAAIGLVQYALDSGVQLKEVFVDTVGPAEKYQDKLSQRFPGVEVTVRPKADSLFPIVSAASICAKVARDHAVKSWKFAEDLGDVDTDYGSGYPNDPKTKSWLLKYLDPVFGYPQFVRFSWSTAQTLLDSKAVTVHWDDDEE----DGEKAAARQN--------NTSVLSYFSRNKPSELTHTRDTHRFFTERKLKSI 304          
BLAST of Ribonuclease vs. Ensembl Zebrafish
Match: rnaseh2a (ribonuclease H2, subunit A [Source:ZFIN;Acc:ZDB-GENE-040426-976])

HSP 1 Score: 52.373 bits (124), Expect = 9.621e-9
Identity = 22/35 (62.86%), Postives = 25/35 (71.43%), Query Frame = 3
Query:  102 CCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNI 206
            CCLGIDEAGRGPVLGPMVY   +  +   E L N+
Sbjct:   29 CCLGIDEAGRGPVLGPMVYGICFCPVSRKEDLKNL 63          
BLAST of Ribonuclease vs. Ensembl Xenopus
Match: rnaseh2a (ribonuclease H2 subunit A [Source:NCBI gene;Acc:394751])

HSP 1 Score: 224.172 bits (570), Expect = 5.390e-71
Identity = 126/318 (39.62%), Postives = 172/318 (54.09%), Query Frame = 3
Query:   15 KFIESKVNEFCEKNDKNLSISSEKYFRFPCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSP--SLSVDMRHKYFTARKLERVSKF 962
            + + S V E C   D              CCLGIDEAGRGPVLGPMVY   Y  +   + L ++ + DSK L E  R E L    ++     G+ + ILSP+ I+  M    K NLN++SHD AI +I+  ++ GV L EV++DTVG  EKY   +   FP+L V V  KAD+ + +VSAASI AKV RD+ + +WK  E     +   GSGYP+DP TK++L    D +FG+PQFVR SWST   I+     P+SW DE+             + SG     P  S+L F+S     S    H++F  R L+ + +F
Sbjct:   16 RLLSSPVPEICRTED--------------CCLGIDEAGRGPVLGPMVYGICYCPVARKKDLQDLKVADSKTLSEAER-ERLFEKLNSTSDYIGWALHILSPNIISTSMQQRAKYNLNALSHDTAIGLIQFALDAGVQLKEVFLDTVGPAEKYQDKLKKIFPELDVTVRPKADSLFPVVSAASICAKVARDRVVKDWKFVEDLGDPDAEYGSGYPNDPKTKDWLSRHLDPVFGYPQFVRFSWSTTQTILGNKAAPVSWGDED-------------DDSGGKSSTP--SVLSFFSAPKDASQPQSHRFFQERNLKPLLEF 303          
BLAST of Ribonuclease vs. Ensembl Mouse
Match: Rnaseh2a (ribonuclease H2, large subunit [Source:MGI Symbol;Acc:MGI:1916974])

HSP 1 Score: 241.506 bits (615), Expect = 5.321e-78
Identity = 127/289 (43.94%), Postives = 171/289 (59.17%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVE-AMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVSKF 962
            PC LG+DEAGRGPVLGPMVY+  Y  +  L  L  + + DSK L E  R E L    + D    G+ +++LSP+ I+  ML   K NLNS+SHD A  +I+  +++ VN+T+V++DTVG PE Y A +  HFP ++V V++KAD+ + +VSAASIFAKV RDK + NW+  E     + + GSGYP+DP TK +L+   D +FGFPQFVR SWSTA  I+EK+   + WED EA E   +  K     S G    +P                 H+YF  R LE  S  
Sbjct:   28 PCVLGVDEAGRGPVLGPMVYAICYCPLSRLADLEALKVADSKTLTENER-ERLFAKMEEDGDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTAAGLIQYALDQNVNVTQVFVDTVGMPETYQARLQQHFPGIEVTVKAKADSLFPVVSAASIFAKVARDKAVKNWQFVENLQDLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWSTAQAILEKEAEDVIWEDSEAEEDPERPGKITSYFSQGPQTCRPQAP--------------HRYFQERGLEAASSL 301          
BLAST of Ribonuclease vs. Ensembl Mouse
Match: Rnaseh2a (ribonuclease H2, large subunit [Source:MGI Symbol;Acc:MGI:1916974])

HSP 1 Score: 241.506 bits (615), Expect = 5.321e-78
Identity = 127/289 (43.94%), Postives = 171/289 (59.17%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVE-AMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVSKF 962
            PC LG+DEAGRGPVLGPMVY+  Y  +  L  L  + + DSK L E  R E L    + D    G+ +++LSP+ I+  ML   K NLNS+SHD A  +I+  +++ VN+T+V++DTVG PE Y A +  HFP ++V V++KAD+ + +VSAASIFAKV RDK + NW+  E     + + GSGYP+DP TK +L+   D +FGFPQFVR SWSTA  I+EK+   + WED EA E   +  K     S G    +P                 H+YF  R LE  S  
Sbjct:   28 PCVLGVDEAGRGPVLGPMVYAICYCPLSRLADLEALKVADSKTLTENER-ERLFAKMEEDGDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTAAGLIQYALDQNVNVTQVFVDTVGMPETYQARLQQHFPGIEVTVKAKADSLFPVVSAASIFAKVARDKAVKNWQFVENLQDLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWSTAQAILEKEAEDVIWEDSEAEEDPERPGKITSYFSQGPQTCRPQAP--------------HRYFQERGLEAASSL 301          
BLAST of Ribonuclease vs. Ensembl Mouse
Match: Rnaseh2a (ribonuclease H2, large subunit [Source:MGI Symbol;Acc:MGI:1916974])

HSP 1 Score: 241.506 bits (615), Expect = 5.321e-78
Identity = 127/289 (43.94%), Postives = 171/289 (59.17%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVE-AMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVSKF 962
            PC LG+DEAGRGPVLGPMVY+  Y  +  L  L  + + DSK L E  R E L    + D    G+ +++LSP+ I+  ML   K NLNS+SHD A  +I+  +++ VN+T+V++DTVG PE Y A +  HFP ++V V++KAD+ + +VSAASIFAKV RDK + NW+  E     + + GSGYP+DP TK +L+   D +FGFPQFVR SWSTA  I+EK+   + WED EA E   +  K     S G    +P                 H+YF  R LE  S  
Sbjct:   28 PCVLGVDEAGRGPVLGPMVYAICYCPLSRLADLEALKVADSKTLTENER-ERLFAKMEEDGDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTAAGLIQYALDQNVNVTQVFVDTVGMPETYQARLQQHFPGIEVTVKAKADSLFPVVSAASIFAKVARDKAVKNWQFVENLQDLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWSTAQAILEKEAEDVIWEDSEAEEDPERPGKITSYFSQGPQTCRPQAP--------------HRYFQERGLEAASSL 301          
BLAST of Ribonuclease vs. Ensembl Mouse
Match: Rnaseh2a (ribonuclease H2, large subunit [Source:MGI Symbol;Acc:MGI:1916974])

HSP 1 Score: 231.106 bits (588), Expect = 1.775e-74
Identity = 111/229 (48.47%), Postives = 152/229 (66.38%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISW 785
            PC LG+DEAGRGPVLGPMVY+  Y  +  L  L  + + DSK L E  R E L    + D    G+ +++LSP+ I+  ML   K NLNS+SHD A  +I+  +++ VN+T+V++DTVG PE Y A +  HFP ++V V++KAD+ + +VSAASIFAKV RDK + NW+  E     + + GSGYP+DP TK +L+   D +FGFPQFVR SWSTA  I+EK+   + W
Sbjct:   28 PCVLGVDEAGRGPVLGPMVYAICYCPLSRLADLEALKVADSKTLTENER-ERLFAKMEEDGDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTAAGLIQYALDQNVNVTQVFVDTVGMPETYQARLQQHFPGIEVTVKAKADSLFPVVSAASIFAKVARDKAVKNWQFVENLQDLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWSTAQAILEKEAEDVIW 255          
BLAST of Ribonuclease vs. Ensembl Mouse
Match: Rnaseh2a (ribonuclease H2, large subunit [Source:MGI Symbol;Acc:MGI:1916974])

HSP 1 Score: 228.794 bits (582), Expect = 1.324e-73
Identity = 110/224 (49.11%), Postives = 150/224 (66.96%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDC 770
            PC LG+DEAGRGPVLGPMVY+  Y  +  L  L  + + DSK L E  R E L    + D    G+ +++LSP+ I+  ML   K NLNS+SHD A  +I+  +++ VN+T+V++DTVG PE Y A +  HFP ++V V++KAD+ + +VSAASIFAKV RDK + NW+  E     + + GSGYP+DP TK +L+   D +FGFPQFVR SWSTA  I+EK+ 
Sbjct:   28 PCVLGVDEAGRGPVLGPMVYAICYCPLSRLADLEALKVADSKTLTENER-ERLFAKMEEDGDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTAAGLIQYALDQNVNVTQVFVDTVGMPETYQARLQQHFPGIEVTVKAKADSLFPVVSAASIFAKVARDKAVKNWQFVENLQDLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWSTAQAILEKEA 250          
BLAST of Ribonuclease vs. UniProt/SwissProt
Match: sp|Q9CWY8|RNH2A_MOUSE (Ribonuclease H2 subunit A OS=Mus musculus OX=10090 GN=Rnaseh2a PE=1 SV=2)

HSP 1 Score: 241.506 bits (615), Expect = 3.722e-77
Identity = 127/289 (43.94%), Postives = 171/289 (59.17%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVE-AMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVSKF 962
            PC LG+DEAGRGPVLGPMVY+  Y  +  L  L  + + DSK L E  R E L    + D    G+ +++LSP+ I+  ML   K NLNS+SHD A  +I+  +++ VN+T+V++DTVG PE Y A +  HFP ++V V++KAD+ + +VSAASIFAKV RDK + NW+  E     + + GSGYP+DP TK +L+   D +FGFPQFVR SWSTA  I+EK+   + WED EA E   +  K     S G    +P                 H+YF  R LE  S  
Sbjct:   28 PCVLGVDEAGRGPVLGPMVYAICYCPLSRLADLEALKVADSKTLTENER-ERLFAKMEEDGDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTAAGLIQYALDQNVNVTQVFVDTVGMPETYQARLQQHFPGIEVTVKAKADSLFPVVSAASIFAKVARDKAVKNWQFVENLQDLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWSTAQAILEKEAEDVIWEDSEAEEDPERPGKITSYFSQGPQTCRPQAP--------------HRYFQERGLEAASSL 301          
BLAST of Ribonuclease vs. UniProt/SwissProt
Match: sp|Q5U209|RNH2A_RAT (Ribonuclease H2 subunit A OS=Rattus norvegicus OX=10116 GN=Rnaseh2a PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 2.293e-74
Identity = 124/289 (42.91%), Postives = 170/289 (58.82%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKF-SKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVSKF 962
            PC LG+DEAGRGPVLGPMVY+  Y  +  L  L  + + DSK L E  R E L    + D    G+ ++ILSP+ I+  ML   K NLNSMSHD A  +I+  +++ V +T+V++DTVG PE Y A +   FP ++V V++KAD+ + +VSAASI AKV RD+ + NW+  E+    + + GSGYP+DP TK +L+   D +FGFPQFVR SWSTA  I+EK+   ++WED  A E  +   +     S G    +P  S              HKYF  R LE  +  
Sbjct:   28 PCVLGVDEAGRGPVLGPMVYAICYCPLSRLADLEALKVADSKTLTENER-ERLFAKMEEDGDFVGWALDILSPNLISTSMLGRVKYNLNSMSHDTAAGLIQHAMDQNVKVTQVFVDTVGMPETYQARLQQRFPGIEVTVKAKADSLFPVVSAASIIAKVARDQAVKNWQFVESLQGLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWSTAQAILEKEAESVTWEDSAAEEDPEGPGRITSYFSQGPQACRPQVS--------------HKYFQERGLETATSL 301          
BLAST of Ribonuclease vs. UniProt/SwissProt
Match: sp|Q2TBT5|RNH2A_BOVIN (Ribonuclease H2 subunit A OS=Bos taurus OX=9913 GN=RNASEH2A PE=1 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 5.984e-73
Identity = 118/286 (41.26%), Postives = 167/286 (58.39%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVS 956
            PC LG+DEAGRGPVLGPMVY+  Y  +  LE L  + + DSK L E  R+ L + + +      G+ +++LSP+ I+  ML   K NLN++SHD A  +++  +++GVN+ +V++DTVG PE Y   +   FP ++V V++KADA Y +VSAASI AKV RD+ + NWK  E     + + GSGYP+DP TK +L+   D +FGFPQFVR SW TA  I+E +   + WED E  +     K     S                SP   + + H+YF  R LE  +
Sbjct:   28 PCVLGVDEAGRGPVLGPMVYAICYCPLSRLEDLEALKVADSKTLSESERDRLFAKMEEDGDF-VGWALDVLSPNLISTSMLGRVKYNLNALSHDTATGLVQFALDQGVNVAQVFVDTVGLPETYQERLQQRFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKNWKFVEKLQDLDTDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWRTAQSILESEAEDVKWEDSETGDPKGPGKIKSYFSE---------------SPQTCLRLPHRYFQERGLESAT 297          
BLAST of Ribonuclease vs. UniProt/SwissProt
Match: sp|O75792|RNH2A_HUMAN (Ribonuclease H2 subunit A OS=Homo sapiens OX=9606 GN=RNASEH2A PE=1 SV=2)

HSP 1 Score: 228.409 bits (581), Expect = 5.382e-72
Identity = 125/290 (43.10%), Postives = 170/290 (58.62%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMR--HKYFTARKLERVSKF 962
            PC LG+DEAGRGPVLGPMVY+  Y  +  L  L  + + DSK L E  R  L + + DTD    G+ +++LSP+ I+  ML   K NLNS+SHD A  +I+  +++GVN+T+V++DTVG PE Y A +   FP ++V V++KADA Y +VSAASI AKV RD+ +  W+  E     + + GSGYP+DP TK +LK   + +FGFPQFVR SW TA  I+EK+   + WED           SA  N  G+      K    F +       R  H+YF  R LE  +  
Sbjct:   28 PCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKTLLESERERLFAKMEDTDF--VGWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFVDTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEKLQDLDTDYGSGYPNDPKTKAWLKEHVEPVFGFPQFVRFSWRTAQTILEKEAEDVIWED-----------SASENQEGL-----RKITSYFLNEGSQARPRSSHRYFLERGLESATSL 299          
BLAST of Ribonuclease vs. UniProt/SwissProt
Match: sp|Q9SEZ6|RNH2A_ARATH (Ribonuclease H2 subunit A OS=Arabidopsis thaliana OX=3702 GN=At2g25100 PE=2 SV=2)

HSP 1 Score: 218.394 bits (555), Expect = 3.755e-68
Identity = 124/292 (42.47%), Postives = 174/292 (59.59%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKS---AKRNSSGM-VIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVSKF 962
            PC +GIDEAGRGPVLGPMVY   Y  I     L+++   DSK LKEE R EL   L        G+ ++++ P  ++ +ML  NKTNLN +SH++A+ +I++V++ GV LTE Y+DTVG P+KY   +S  FP +K VV  KAD+ + IVS ASI AKV RD+ +  W   ET    N N GSGYP DP TK +L      +FGFP  VR SW T +  ++ + V ++WE +E  E+   S S   AK +S G    EK ++ +        S   R K+  ARK++++++F
Sbjct:   14 PCLMGIDEAGRGPVLGPMVYGCMYCPISYQSSLASLHFADSKTLKEEKREELYESLKLDKS--LGWAVDVIDPRELSAKMLAKNKTNLNEISHNSAMGLIKRVLDMGVLLTEAYLDTVGDPDKYRIKLSERFPSIKFVVSKKADSLFPIVSGASIVAKVTRDRALKEWLVEETGEDINRNFGSGYPGDPETKAWLVQHKHSVFGFPSLVRFSWGTCTTHLKGE-VEVAWEADENEESGNGSSSKRQAKLSSFGFKTCEKRSEEI------ESSGKGRCKFLQARKIQQLTQF 296          
BLAST of Ribonuclease vs. TrEMBL
Match: F7B1W3 (Ribonuclease OS=Ciona intestinalis OX=7719 PE=3 SV=2)

HSP 1 Score: 263.848 bits (673), Expect = 1.825e-83
Identity = 136/288 (47.22%), Postives = 182/288 (63.19%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVSKF 962
            PCCLGIDEAGRGPVLGPMVY+  +  I   +KL+ +G DDSK LKEE R E L    +   +  G+ I ILSP++I+  ML  +K NLNS+SHD AI++IR  +  GV +TEVY+DTVG P+ Y   +   FP +K  VE KAD+ Y +VSAASI AKV RDK +  W+ RE  P ++   GSGYP+DPVTK +L+N  DRIFGFP FVR SWST S ++E + VP+ W D++                    E  N+ +  ++S     + RH++FT  K++RV+ F
Sbjct:   28 PCCLGIDEAGRGPVLGPMVYASCFTPISCKDKLAGLGCDDSKVLKEEQR-ESLFETLNKASEYIGWMIHILSPAYISTSMLGRSKYNLNSISHDTAIDLIRSALKLGVEVTEVYVDTVGPPQTYAEKLKKIFPSIKFTVEKKADSKYPVVSAASICAKVCRDKAVKEWRFREN-PDTDTKYGSGYPADPVTKVWLRNNVDRIFGFPSFVRFSWSTTSKLLENEAVPVHWADDDE-------------------ESSNEPITSYFSK--KGNSRHQFFTENKMKRVTNF 292          
BLAST of Ribonuclease vs. TrEMBL
Match: A0A1W2WGX2 (Ribonuclease OS=Ciona intestinalis OX=7719 GN=LOC100178254 PE=3 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 2.744e-83
Identity = 141/320 (44.06%), Postives = 194/320 (60.62%), Query Frame = 3
Query:   12 LKFIESKVNEFCEKNDKNLSISSE---KYFRFPCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVSKF 962
            L ++  ++  F    D+N  + S+        PCCLGIDEAGRGPVLGPMVY+  +  I   +KL+ +G DDSK LKEE R E L    +   +  G+ I ILSP++I+  ML  +K NLNS+SHD AI++IR  +  GV +TEVY+DTVG P+ Y   +   FP +K  VE KAD+ Y +VSAASI AKV RDK +  W+ RE  P ++   GSGYP+DPVTK +L+N  DRIFGFP FVR SWST S ++E + VP+ W D++                    E  N+ +  ++S     + RH++FT  K++RV+ F
Sbjct:   19 LSYLLMEIEHFLNNCDENFKLKSDIPKLLTSEPCCLGIDEAGRGPVLGPMVYASCFTPISCKDKLAGLGCDDSKVLKEEQR-ESLFETLNKASEYIGWMIHILSPAYISTSMLGRSKYNLNSISHDTAIDLIRSALKLGVEVTEVYVDTVGPPQTYAEKLKKIFPSIKFTVEKKADSKYPVVSAASICAKVCRDKAVKEWRFREN-PDTDTKYGSGYPADPVTKVWLRNNVDRIFGFPSFVRFSWSTTSKLLENEAVPVHWADDDE-------------------ESSNEPITSYFSK--KGNSRHQFFTENKMKRVTNF 315          
BLAST of Ribonuclease vs. TrEMBL
Match: R7U7R0 (Ribonuclease OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_183401 PE=3 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 3.779e-81
Identity = 145/319 (45.45%), Postives = 189/319 (59.25%), Query Frame = 3
Query:    9 DLKFIESKVNEFCEKNDKNLSISSEKYFRF---PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVS 956
            D KF    + EF E N   + I+S    R    PCCLGIDEAGRGPVLGPMVY   +  I + E+L  +G  DSK L EE R  L   +   +  L G+ + ILSP+ I+N ML  +K NLN +SHD AI +I+K ++ GVN+ EV++DTVG PEKY A +   FP+LK+ V  KADA+Y IVSAASI AKV RD  + +W   E    +  + GSGYP D  TKN+L  + D +FGFPQFVR SWSTAS I++   V + WED++  E     KS    SS     K N +         +   +H++FT R L +VS
Sbjct:   11 DFKF---DLQEFGEDNRSGVVIASAICDRLKTEPCCLGIDEAGRGPVLGPMVYGTCFCPIADKERLKEMGFADSKTLTEEKRENLFQKIQAAEADLIGWAVHILSPNQISNSMLRRSKYNLNELSHDTAIGLIQKALDSGVNVDEVFVDTVGMPEKYQAKLERIFPELKITVAKKADATYPIVSAASICAKVSRDHAVKSWNFIEGRDYAGKSYGSGYPGDSETKNFLSESMDPVFGFPQFVRFSWSTASNILDAKAVTVEWEDDD--EMPDDVKSTPAISSYFSGNKTNAA---------NAQKKHQFFTDRSLHQVS 315          
BLAST of Ribonuclease vs. TrEMBL
Match: A0A4E0RDJ0 (Ribonuclease OS=Fasciola hepatica OX=6192 GN=D915_003763 PE=3 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 1.914e-80
Identity = 136/287 (47.39%), Postives = 186/287 (64.81%), Query Frame = 3
Query:   81 EKYFRFPCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARK 941
            E  F  PC +GIDEAGRGPVLGPMVY+ A   I  L++L  +GL DSK+L E+ R +LLS +      + G  + ++SP FI+ +ML+  KT+LN++SHDAAI +IR  ++ G+NL+E Y+DTVG  E Y   + S FPKL+V VESKAD +Y IVSAASIFAKV RD+ +  W  ++   +     GSGYP DP+TK+YL++  D IFGFP  VR SWSTA+ +M++  V I+WED+E  E    +  AKR +    + K    L  F+SPS   + + K  T R+
Sbjct:   16 ETAFTSPCMIGIDEAGRGPVLGPMVYACAVAPINRLDQLKTLGLADSKQLTEQKREQLLSDMLSNTDWIVG-GVHVISPVFISEKMLDRCKTSLNTISHDAAIGLIRAALDAGINLSEAYVDTVGKAEHYQTKLQSLFPKLQVCVESKADDTYPIVSAASIFAKVTRDRLLQMWFAKDGDTVKT-PLGSGYPGDPLTKSYLESCLDPIFGFPSIVRASWSTATTLMDRHGVKITWEDDENPEQ---AAEAKRLARKRDLAKGTCQLSNFFSPSSKPNEKDKRTTIRQ 297          
BLAST of Ribonuclease vs. TrEMBL
Match: A0A3Q0K5J6 (Ribonuclease OS=Ciona intestinalis OX=7719 GN=LOC100178254 PE=3 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 2.944e-80
Identity = 141/328 (42.99%), Postives = 194/328 (59.15%), Query Frame = 3
Query:   12 LKFIESKVNEFCEKNDKNLSISSE---KYFRFPCCLGIDEAGRGPVL--------GPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVSKF 962
            L ++  ++  F    D+N  + S+        PCCLGIDEAGRGPVL        GPMVY+  +  I   +KL+ +G DDSK LKEE R E L    +   +  G+ I ILSP++I+  ML  +K NLNS+SHD AI++IR  +  GV +TEVY+DTVG P+ Y   +   FP +K  VE KAD+ Y +VSAASI AKV RDK +  W+ RE  P ++   GSGYP+DPVTK +L+N  DRIFGFP FVR SWST S ++E + VP+ W D++                    E  N+ +  ++S     + RH++FT  K++RV+ F
Sbjct:   19 LSYLLMEIEHFLNNCDENFKLKSDIPKLLTSEPCCLGIDEAGRGPVLDFMNELYSGPMVYASCFTPISCKDKLAGLGCDDSKVLKEEQR-ESLFETLNKASEYIGWMIHILSPAYISTSMLGRSKYNLNSISHDTAIDLIRSALKLGVEVTEVYVDTVGPPQTYAEKLKKIFPSIKFTVEKKADSKYPVVSAASICAKVCRDKAVKEWRFREN-PDTDTKYGSGYPADPVTKVWLRNNVDRIFGFPSFVRFSWSTTSKLLENEAVPVHWADDDE-------------------ESSNEPITSYFSK--KGNSRHQFFTENKMKRVTNF 323          
BLAST of Ribonuclease vs. Ensembl Cavefish
Match: rnaseh2a (ribonuclease H2, subunit A [Source:ZFIN;Acc:ZDB-GENE-040426-976])

HSP 1 Score: 196.052 bits (497), Expect = 1.402e-60
Identity = 118/289 (40.83%), Postives = 158/289 (54.67%), Query Frame = 3
Query:  102 CCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYS---PSLSVDMR--HKYFTARKLERV 953
            CCLGIDEAGRGPVL                        DSK L E  R E L    D  K   G+ ++ILSP+ I+  ML   K NLN++SHDAAI +++  ++ GV L EV++DTVG  EKY   +S  F  +KV V  KAD+ + IVSAASI AKV RD+ + +WK  E     +   GSGYP+DP TK+++    D +FG+PQFVR SWSTA  +M+   V    ED E        K+A R +        N S+L ++    P+     R  H++FT R+L+ V
Sbjct:   29 CCLGIDEAGRGPVL------------------------DSKTLSEAER-ENLFEKLDEAKSFVGWALQILSPNTISTSMLQRAKYNLNALSHDAAIGLVQFALDSGVQLKEVFVDTVGPAEKYEEKLSKRFSGIKVTVRPKADSLFPIVSAASICAKVARDRVVKDWKFAEDLGEVDTEYGSGYPNDPKTKSWMLKYLDPVFGYPQFVRFSWSTAQTLMDSKAVT---EDGE--------KAAARQN--------NTSMLSYFGRNKPAGQTQTRETHRFFTERRLQTV 273          
BLAST of Ribonuclease vs. Ensembl Sea Lamprey
Match: rnaseh2a (ribonuclease H2, subunit A [Source:ZFIN;Acc:ZDB-GENE-040426-976])

HSP 1 Score: 218.394 bits (555), Expect = 1.075e-69
Identity = 120/288 (41.67%), Postives = 170/288 (59.03%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETF----PLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSP--SLSVDMRHKYFTARKL 944
            P  LG+DEAGRGPVLGPMVY   Y  +     L  I + DSK L E+ R +L   L+       G+ ++ILSP++I+  M    K NLN++SHDAAI++I+  I+ GVN+ EV++DTVG  +KY   +S+ FP + V V +KADA + +VSAASI AKV RD+C+  WK  E           + GSGYP+DP TK++L++  D +FGFPQ VR SWSTA+ ++++   P++W+D+E  E    S                 S++ F+S     S    H+YF  R L
Sbjct:   28 PVALGVDEAGRGPVLGPMVYGICYCLVSKKSALEKIKVADSKTLSEKEREQLFEQLNGEASSFVGWALQILSPNYISTCMQT--KYNLNALSHDAAIDLIQHAIDMGVNVQEVFVDTVGPADKYQQKLSARFPGVSVTVSAKADALFPVVSAASICAKVARDRCVSRWKFVENLDDVAASVAADVGSGYPNDPKTKSWLRSHCDPVFGFPQLVRFSWSTATTLLQELATPVTWDDDEDGEGGDLS---------------TPSVMSFFSKKNQASTPETHRYFRDRSL 298          
BLAST of Ribonuclease vs. Ensembl Yeast
Match: RNH201 (Ribonuclease H2 catalytic subunit; removes RNA primers during Okazaki fragment synthesis and errant ribonucleotides misincorporated during DNA replication; role in ribonucleotide excision repair; homolog of RNAse HI; related to human AGS4 which causes Aicardi-Goutieres syndrome [Source:SGD;Acc:S000005016])

HSP 1 Score: 140.584 bits (353), Expect = 7.387e-40
Identity = 96/267 (35.96%), Postives = 139/267 (52.06%), Query Frame = 3
Query:   99 PCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEK--LSNIGLDDSKKLKEETRNE--XXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKT---NLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFP-QFVRMSWSTASVIME---KDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKP 866
            P  +GIDEAGRGPVLGPMVY+ AY   +  ++  + N   DDSKKL +  R          + +    GY    ++P  I+  M     T   NLN  +HD  + +I  VI + V L+ VY+DTVG P  Y   +   FP +K  V  KAD+ Y +VS AS+ AKV RD  + + K        ++  GSGYPSDP T  +LK     + G+P   VR SW T   +++   K+ +PI WE E+ +++ K +    +     ++ KP
Sbjct:   33 PIIMGIDEAGRGPVLGPMVYAVAYSTQKYQDETIIPNYEFDDSKKLTDPIRRMLFSKIYQDNEELTQIGYATTCITPLDISRGMSKFPPTRNYNLNEQAHDVTMALIDGVIKQNVKLSHVYVDTVGPPASYQKKLEQRFPGVKFTVAKKADSLYCMVSVASVVAKVTRDILVESLKRD-----PDEILGSGYPSDPKTVAWLKRNQTSLMGWPANMVRFSWQTCQTLLDDASKNSIPIKWE-EQYMDSRKNAAQKTKQLQLQMVAKP 293          
BLAST of Ribonuclease vs. Ensembl Nematostella
Match: EDO37978 (Ribonuclease [Source:UniProtKB/TrEMBL;Acc:A7SEB2])

HSP 1 Score: 155.221 bits (391), Expect = 7.027e-43
Identity = 87/181 (48.07%), Postives = 114/181 (62.98%), Query Frame = 3
Query:   39 EFCEKNDKNLSISS---EKYFRFPCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAK 572
            EF + N KN  I S   E     PCC+GIDEAGRGPVLGPMVY   Y  +   E+L   G  DSK L EE R  L   LS+      G+ I+IL+P+F++N ML   K +LN +SH++AI +IR +++ GV + EVY+DTVG  EKY   +   FP+ K+VV  KADA + +VSAAS+ AK
Sbjct:    5 EFKKDNSKNCIIKSKIPEIARNEPCCVGIDEAGRGPVLGPMVYGICYCPLSKAEELKTTGFADSKTLTEEEREALFKELSENCHGYMGWVIDILTPNFLSNCMLQRTKCSLNEVSHNSAIGLIRLLLDSGVKVQEVYVDTVGPAEKYQDKLQKIFPEQKIVVTPKADAKFPVVSAASVCAK 185          

HSP 2 Score: 124.405 bits (311), Expect = 8.909e-32
Identity = 71/168 (42.26%), Postives = 101/168 (60.12%), Query Frame = 3
Query:  192 KLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAF 695
             L  I   DSK L EE R  L   LS+      G+ I+IL+P+F++N ML   K +LN +SH++AI +IR +++ GV + EVY+DTVG  EKY   +   FP+ K+VV  KADA + +VSAAS+ AKV RD+ I  W+  E    + +  GSGYPS   +  +L   +
Sbjct:  318 HLVAIDTQDSKTLTEEEREALFKELSENCHGYMGWVIDILTPNFLSNCMLQRTKCSLNEVSHNSAIGLIRLLLDSGVKVQEVYVDTVGPAEKYQDKLQKIFPEQKIVVTPKADAKFPVVSAASVCAKVSRDRVISAWEFSEDIIFTKET-GSGYPSGYQSGGHLHTEY 484          
BLAST of Ribonuclease vs. Ensembl Medaka
Match: rnaseh2a (ribonuclease H2 subunit A [Source:NCBI gene;Acc:101155490])

HSP 1 Score: 239.195 bits (609), Expect = 4.468e-77
Identity = 127/291 (43.64%), Postives = 175/291 (60.14%), Query Frame = 3
Query:  102 CCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVD----MRHKYFTARKLERVSKF 962
            CCLGIDEAGRGPVLGPMVY   +  +   ++L ++ + DSK L EE R E L    D  K   G+ + +LSP+ I+  ML   K NLN++SHD AI +I+  ++ GV L E+Y+DTVG  EKY   +S  FP ++V V  KAD+ + +VSAASI AKV RD+ +  WK  E     + + GSGYP+DP TK +L    D +FG+PQFVR SWSTA  +++   V + W+D+E        K+AKR +        NKS+L F+S S   D      H++FT R+L  +S  
Sbjct:   29 CCLGIDEAGRGPVLGPMVYGICFCPVSKKQELKDLKVADSKTLTEEER-ERLFHNLDEAKSYVGWALHVLSPNTISTSMLQRTKYNLNALSHDTAIGLIQYALDSGVQLKEIYVDTVGPAEKYEEKLSQRFPGIEVTVRPKADSLFPVVSAASICAKVARDRVVKGWKFAEDLGDVDADYGSGYPNDPKTKAWLLKYLDPVFGYPQFVRFSWSTAQTLLDSKAVTVHWDDDEE----DGEKAAKRLN--------NKSMLSFFSASAGSDDQSRQTHRFFTDRRLRGLSSL 306          
BLAST of Ribonuclease vs. Planmine SMEST
Match: SMESG000022763.1 (SMESG000022763.1)

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 320/321 (99.69%), Postives = 321/321 (100.00%), Query Frame = 3
Query:    3 MTDLKFIESKVNEFCEKNDKNLSISSEKYFRFPCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNEXXXXXXXXXXXXCGYEIEILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVSKFH 965
            MTDLKFIESKVNEFCEKNDKNLSISSEKYFRFPCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNELLSLLSDTDKKLCGYEIEILSPSFITNQMLNVNKTNLN+MSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVSKFH
Sbjct:    1 MTDLKFIESKVNEFCEKNDKNLSISSEKYFRFPCCLGIDEAGRGPVLGPMVYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNELLSLLSDTDKKLCGYEIEILSPSFITNQMLNVNKTNLNTMSHDAAINIIRKVINKGVNLTEVYIDTVGSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNWKHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASVIMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSLSVDMRHKYFTARKLERVSKFH 321          
The following BLAST results are available for this feature:
BLAST of Ribonuclease vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RNASEH2A1.121e-7243.10ribonuclease H2 subunit A [Source:HGNC Symbol;Acc:... [more]
RNASEH2A1.674e-2446.90ribonuclease H2 subunit A [Source:HGNC Symbol;Acc:... [more]
RNASEH2A1.007e-763.64ribonuclease H2 subunit A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Ribonuclease vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnh-21.117e-6641.44Ribonuclease H2 subunit A [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Ribonuclease vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG136901.116e-6345.87gene:FBgn0031252 transcript:FBtr0078090[more]
back to top
BLAST of Ribonuclease vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rnaseh2a1.378e-7544.29ribonuclease H2, subunit A [Source:ZFIN;Acc:ZDB-GE... [more]
rnaseh2a1.378e-7544.29ribonuclease H2, subunit A [Source:ZFIN;Acc:ZDB-GE... [more]
rnaseh2a9.621e-962.86ribonuclease H2, subunit A [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Ribonuclease vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnaseh2a5.390e-7139.62ribonuclease H2 subunit A [Source:NCBI gene;Acc:39... [more]
back to top
BLAST of Ribonuclease vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnaseh2a5.321e-7843.94ribonuclease H2, large subunit [Source:MGI Symbol;... [more]
Rnaseh2a5.321e-7843.94ribonuclease H2, large subunit [Source:MGI Symbol;... [more]
Rnaseh2a5.321e-7843.94ribonuclease H2, large subunit [Source:MGI Symbol;... [more]
Rnaseh2a1.775e-7448.47ribonuclease H2, large subunit [Source:MGI Symbol;... [more]
Rnaseh2a1.324e-7349.11ribonuclease H2, large subunit [Source:MGI Symbol;... [more]
back to top
BLAST of Ribonuclease vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CWY8|RNH2A_MOUSE3.722e-7743.94Ribonuclease H2 subunit A OS=Mus musculus OX=10090... [more]
sp|Q5U209|RNH2A_RAT2.293e-7442.91Ribonuclease H2 subunit A OS=Rattus norvegicus OX=... [more]
sp|Q2TBT5|RNH2A_BOVIN5.984e-7341.26Ribonuclease H2 subunit A OS=Bos taurus OX=9913 GN... [more]
sp|O75792|RNH2A_HUMAN5.382e-7243.10Ribonuclease H2 subunit A OS=Homo sapiens OX=9606 ... [more]
sp|Q9SEZ6|RNH2A_ARATH3.755e-6842.47Ribonuclease H2 subunit A OS=Arabidopsis thaliana ... [more]
back to top
BLAST of Ribonuclease vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F7B1W31.825e-8347.22Ribonuclease OS=Ciona intestinalis OX=7719 PE=3 SV... [more]
A0A1W2WGX22.744e-8344.06Ribonuclease OS=Ciona intestinalis OX=7719 GN=LOC1... [more]
R7U7R03.779e-8145.45Ribonuclease OS=Capitella teleta OX=283909 GN=CAPT... [more]
A0A4E0RDJ01.914e-8047.39Ribonuclease OS=Fasciola hepatica OX=6192 GN=D915_... [more]
A0A3Q0K5J62.944e-8042.99Ribonuclease OS=Ciona intestinalis OX=7719 GN=LOC1... [more]
back to top
BLAST of Ribonuclease vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnaseh2a1.402e-6040.83ribonuclease H2, subunit A [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Ribonuclease vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnaseh2a1.075e-6941.67ribonuclease H2, subunit A [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Ribonuclease vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RNH2017.387e-4035.96Ribonuclease H2 catalytic subunit; removes RNA pri... [more]
back to top
BLAST of Ribonuclease vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO379787.027e-4348.07Ribonuclease [Source:UniProtKB/TrEMBL;Acc:A7SEB2][more]
back to top
BLAST of Ribonuclease vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnaseh2a4.468e-7743.64ribonuclease H2 subunit A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Ribonuclease vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000022763.10.000e+099.69SMESG000022763.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030716 ID=SMED30030716|Name=Ribonuclease|organism=Schmidtea mediterranea sexual|type=transcript|length=995bp
CGATGACTGACTTAAAGTTTATAGAATCTAAAGTTAACGAATTTTGTGAA
AAAAATGATAAGAATCTTAGTATTAGTAGCGAAAAATATTTTAGATTTCC
TTGTTGTTTAGGAATAGATGAAGCTGGCAGAGGCCCAGTATTGGGTCCAA
TGGTTTATTCCGGTGCTTATATTGAAATTAGAAATTTAGAAAAGTTATCA
AATATTGGATTAGATGATTCTAAAAAATTAAAAGAAGAAACAAGAAATGA
GTTACTAAGTCTTTTGAGTGATACTGATAAAAAATTGTGTGGTTATGAAA
TAGAGATTTTGTCACCTAGTTTCATAACAAATCAGATGTTAAATGTTAAT
AAAACAAATTTAAATTCAATGTCTCACGACGCTGCAATTAATATTATTCG
TAAAGTAATTAACAAAGGAGTAAATCTAACTGAGGTATATATCGACACAG
TCGGAAGTCCTGAAAAATACAACGCGTTAATTTCAAGTCATTTTCCCAAG
CTTAAAGTCGTGGTTGAAAGCAAAGCTGATGCTAGTTACAAAATCGTCAG
CGCTGCAAGTATATTTGCAAAAGTTGTTCGAGACAAATGCATTCATAATT
GGAAGCACAGAGAAACATTTCCTCTGTCTAATGATAATTGTGGCAGTGGA
TATCCATCAGATCCAGTAACTAAAAATTATTTGAAGAATGCATTCGATCG
AATTTTTGGATTTCCCCAATTTGTTAGAATGAGCTGGTCGACAGCATCAG
TAATTATGGAAAAAGATTGTGTTCCGATTTCATGGGAAGATGAAGAAGCC
GTTGAAGCTATGAAGTTTTCTAAGTCAGCTAAAAGAAATAGCTCAGGGAT
GGTAATAGAAAAACCAAACAAATCTTTACTTGAATTTTATTCTCCGTCAC
TTTCTGTCGATATGCGTCATAAATATTTCACTGCTCGAAAATTAGAAAGA
GTGTCCAAGTTTCATTAAATGCTAATAAATATTCCCTGTTCCAAA
back to top

protein sequence of SMED30030716-orf-1

>SMED30030716-orf-1 ID=SMED30030716-orf-1|Name=SMED30030716-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=322bp
MTDLKFIESKVNEFCEKNDKNLSISSEKYFRFPCCLGIDEAGRGPVLGPM
VYSGAYIEIRNLEKLSNIGLDDSKKLKEETRNELLSLLSDTDKKLCGYEI
EILSPSFITNQMLNVNKTNLNSMSHDAAINIIRKVINKGVNLTEVYIDTV
GSPEKYNALISSHFPKLKVVVESKADASYKIVSAASIFAKVVRDKCIHNW
KHRETFPLSNDNCGSGYPSDPVTKNYLKNAFDRIFGFPQFVRMSWSTASV
IMEKDCVPISWEDEEAVEAMKFSKSAKRNSSGMVIEKPNKSLLEFYSPSL
SVDMRHKYFTARKLERVSKFH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR004649RNase_H2_suA
IPR036397RNaseH_sf
IPR001352RNase_HII/HIII
IPR012337RNaseH-like_sf
IPR023160RNase_HII_hlx-loop-hlx_cap_dom
IPR024567RNase_HII/HIII_dom
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0004523RNA-DNA hybrid ribonuclease activity
GO:0003723RNA binding
GO:0004518nuclease activity
GO:0004519endonuclease activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0016070RNA metabolic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023160Ribonuclease HII, helix-loop-helix cap domain superfamilyGENE3DG3DSA:1.10.10.460coord: 209..256
e-value: 9.7E-22
score: 78.2
IPR004649Ribonuclease H2, subunit ATIGRFAMTIGR00729TIGR00729coord: 36..251
e-value: 5.8E-57
score: 191.1
IPR036397Ribonuclease H superfamilyGENE3DG3DSA:3.30.420.10coord: 8..207
e-value: 1.9E-68
score: 232.1
IPR024567Ribonuclease HII/HIII domainPFAMPF01351RNase_HIIcoord: 36..247
e-value: 6.8E-53
score: 179.5
NoneNo IPR availablePANTHERPTHR10954:SF7RIBONUCLEASE H2 SUBUNIT Acoord: 11..318
NoneNo IPR availableCDDcd07181RNase_HII_eukaryota_likecoord: 36..257
e-value: 2.62523E-128
score: 363.377
IPR001352Ribonuclease HII/HIIIPANTHERPTHR10954RIBONUCLEASE H2 SUBUNIT Acoord: 11..318
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 34..253