Ephrin type-A receptor 4-B

Overview
NameEphrin type-A receptor 4-B
Smed IDSMED30030699
Length (bp)3697
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ephrin type-A receptor 4-B (SMED30030699) t-SNE clustered cells

Violin plots show distribution of expression levels for Ephrin type-A receptor 4-B (SMED30030699) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ephrin type-A receptor 4-B (SMED30030699) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ephrin type-A receptor 4-B (SMED30030699) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030699

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30030699SMESG000077240.1 SmedASXL_012895SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30030699SMESG000077240.1 SmedASXL_012896SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30030699SMESG000077240.1 dd_Smed_v4_16483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030699SMESG000077240.1 dd_Smed_v4_16483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030699SMESG000077240.1 dd_Smed_v4_16483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030699SMESG000077240.1 dd_Smed_v4_16483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30030699SMESG000077240.1 dd_Smed_v4_16483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30030699SMESG000077240.1 dd_Smed_v4_16483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30030699SMESG000077240.1 dd_Smed_v4_16483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030699SMESG000077240.1 dd_Smed_v4_12794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30030699SMESG000077240.1 dd_Smed_v6_12794_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30030699SMESG000077240.1 dd_Smed_v6_16483_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30030699SMESG000077240.1 dd_Smed_v4_16483_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30030699SMESG000077240.1 dd_Smed_v4_12794_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Human
Match: EPHA4 (EPH receptor A4 [Source:HGNC Symbol;Acc:HGNC:3388])

HSP 1 Score: 485.337 bits (1248), Expect = 5.490e-153
Identity = 317/923 (34.34%), Postives = 464/923 (50.27%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWR---IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL---GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIV--NYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS-FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI----------ECINCPNKLVFLPSSKT-KETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            E  LL + S+ G   W   +    GW    I +        Y VC V  PS N+WLR+ +I+R+    ++I++ FT+R+C + P    +  C+ETF L  YESD+  E     E  F  I TI+++  +   D  + I+ +      V  L   G  +AFQ+ G+C+ +  V V+Y  C   + N   FP T  G ++ +   V G CV      +NS+E+ V   YC A+G W        C C +G E  +    C  C   +YK L     C  CP ++YS + G+ SC C++G++   N    + C +PP  P N L+ + ++  + L W+SP     +     +ISY ++          +C  C + + + P     K TKV +   L    Y F++ +VN VS+Y  NP   DQS S +++ T          +++ +  ++ + L+W +P  P  ++ EYE        Y++      +  I      NT    +N +T  ++ V   R R   G+G FSE            L++ T    +  +   + ST+  +          +++                    + I R+      R K+   K EA     +         NQ    Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L VP      VA+K LK G ++K+R DFL EAS MGQF + N++ LEGV+T     MIITE+M NGSL  FLR      T IQL+ ML  + +GMKYLS + ++HRDLAARNIL++ NLVCKV+DFG+SR L D D +  YT +  GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI AI+ GYRLPPP++CP  +H LML CW      RP F  I
Sbjct:   30 EVTLLDSRSVQGELGWIA-SPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPG--VMGTCKETFNLYYYESDNDKERF-IRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCV------NNSEEKDVPKMYCGADGEWLVPIGN--CLCNAGHE--ERSGECQACKIGYYKALSTDATCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLN-LISNVNETSVNLEWSSP----QNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVSKYNPNP---DQSVS-VTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEV------KYYEKDQNERSYRIVRTAARNTDIKGLNPLTSYVFHV---RARTAAGYGDFSE-----------PLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIA------------------AFVISRR------RSKYSKAKQEADEEKHL---------NQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLED-DPEAAYTTR-GGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQI 874          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Human
Match: EPHA4 (EPH receptor A4 [Source:HGNC Symbol;Acc:HGNC:3388])

HSP 1 Score: 485.723 bits (1249), Expect = 1.008e-152
Identity = 317/923 (34.34%), Postives = 464/923 (50.27%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWR---IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL---GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIV--NYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS-FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI----------ECINCPNKLVFLPSSKT-KETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            E  LL + S+ G   W   +    GW    I +        Y VC V  PS N+WLR+ +I+R+    ++I++ FT+R+C + P    +  C+ETF L  YESD+  E     E  F  I TI+++  +   D  + I+ +      V  L   G  +AFQ+ G+C+ +  V V+Y  C   + N   FP T  G ++ +   V G CV      +NS+E+ V   YC A+G W        C C +G E  +    C  C   +YK L     C  CP ++YS + G+ SC C++G++   N    + C +PP  P N L+ + ++  + L W+SP     +     +ISY ++          +C  C + + + P     K TKV +   L    Y F++ +VN VS+Y  NP   DQS S +++ T          +++ +  ++ + L+W +P  P  ++ EYE        Y++      +  I      NT    +N +T  ++ V   R R   G+G FSE            L++ T    +  +   + ST+  +          +++                    + I R+      R K+   K EA     +         NQ    Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L VP      VA+K LK G ++K+R DFL EAS MGQF + N++ LEGV+T     MIITE+M NGSL  FLR      T IQL+ ML  + +GMKYLS + ++HRDLAARNIL++ NLVCKV+DFG+SR L D D +  YT +  GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI AI+ GYRLPPP++CP  +H LML CW      RP F  I
Sbjct:   30 EVTLLDSRSVQGELGWIA-SPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPG--VMGTCKETFNLYYYESDNDKERF-IRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCV------NNSEEKDVPKMYCGADGEWLVPIGN--CLCNAGHE--ERSGECQACKIGYYKALSTDATCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLN-LISNVNETSVNLEWSSP----QNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVSKYNPNP---DQSVS-VTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEV------KYYEKDQNERSYRIVRTAARNTDIKGLNPLTSYVFHV---RARTAAGYGDFSE-----------PLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILI------------------AAFVISRR------RSKYSKAKQEADEEKHL---------NQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLED-DPEAAYTTR-GGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQI 874          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Human
Match: EPHA4 (EPH receptor A4 [Source:HGNC Symbol;Acc:HGNC:3388])

HSP 1 Score: 485.723 bits (1249), Expect = 1.008e-152
Identity = 317/923 (34.34%), Postives = 464/923 (50.27%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWR---IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL---GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIV--NYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS-FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI----------ECINCPNKLVFLPSSKT-KETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            E  LL + S+ G   W   +    GW    I +        Y VC V  PS N+WLR+ +I+R+    ++I++ FT+R+C + P    +  C+ETF L  YESD+  E     E  F  I TI+++  +   D  + I+ +      V  L   G  +AFQ+ G+C+ +  V V+Y  C   + N   FP T  G ++ +   V G CV      +NS+E+ V   YC A+G W        C C +G E  +    C  C   +YK L     C  CP ++YS + G+ SC C++G++   N    + C +PP  P N L+ + ++  + L W+SP     +     +ISY ++          +C  C + + + P     K TKV +   L    Y F++ +VN VS+Y  NP   DQS S +++ T          +++ +  ++ + L+W +P  P  ++ EYE        Y++      +  I      NT    +N +T  ++ V   R R   G+G FSE            L++ T    +  +   + ST+  +          +++                    + I R+      R K+   K EA     +         NQ    Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L VP      VA+K LK G ++K+R DFL EAS MGQF + N++ LEGV+T     MIITE+M NGSL  FLR      T IQL+ ML  + +GMKYLS + ++HRDLAARNIL++ NLVCKV+DFG+SR L D D +  YT +  GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI AI+ GYRLPPP++CP  +H LML CW      RP F  I
Sbjct:   30 EVTLLDSRSVQGELGWIA-SPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPG--VMGTCKETFNLYYYESDNDKERF-IRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCV------NNSEEKDVPKMYCGADGEWLVPIGN--CLCNAGHE--ERSGECQACKIGYYKALSTDATCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLN-LISNVNETSVNLEWSSP----QNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVSKYNPNP---DQSVS-VTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEV------KYYEKDQNERSYRIVRTAARNTDIKGLNPLTSYVFHV---RARTAAGYGDFSE-----------PLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILI------------------AAFVISRR------RSKYSKAKQEADEEKHL---------NQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLED-DPEAAYTTR-GGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQI 874          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Human
Match: EPHB1 (EPH receptor B1 [Source:HGNC Symbol;Acc:HGNC:3392])

HSP 1 Score: 476.478 bits (1225), Expect = 3.605e-149
Identity = 307/939 (32.69%), Postives = 471/939 (50.16%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWR-----IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPI---ENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS-FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFN--MYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            E+ L+   + +    W  N  +  GW       +NL  N    Y VC V  P+ N+WL + FI+R     ++ ++ FT+R+C + P+ P S   C+ETF L  YE+DS I   ++  ++E  +  + TI+++  +   D    ++ +     S   + R G  +AFQ+ G+C+ +  V V++  C   + NF  FP T  G ES +  +  G C+         D  I  YC  +G W     +  C C  G E  +S  +C  C    +K  Q +E C  CP N+ S    S  C C  GYY       ++ C   P  PRN++    ++  IIL W+ P          D+++Y +I          C  C + + F+P      E +V +        Y F + ++N VS    +PF     S  I+        +  +    +      I LSW QP  P  I+    + +  R Y K  + FN+     +  + T+ + I+ +   + +V +VR R   G+G+FS     +T +    K+EL+ ++P        +  ++ + +  + + +                          +   C R++      +Y  K ++            YS+    P      Y +P TYED + A+ +F KEID  ++    +IG GEFG VY+G L +P      VA+K LK G SEK+R DFL EAS MGQF + N+++LEGV+T S   MIITEFM NG+L +FLR    + T IQL+ ML  +A GMKYL+ + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+P++ TAPEAI Y KF+ ASDVWS+G+V WEV+S+GE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   19 EETLMDTRTATAELGWTANPAS--GWEEVSGYDENL--NTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGS---CKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNA---EEVDVPIKLYCNGDGEWMVPIGR--CTCKPGYEPENS-VACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVI-SIVNETSIILEWHPP----RETGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSS--KSPFPPQHVSVNITTNQAAPSTVPIMH--QVSATMRSITLSWPQPEQPNGII----LDYEIRYYEKEHNEFNSS----MARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLP-------LIAGSAAAGVVFVVSLV-------------------------AISIVCSRKRAYSKEAVYSDKLQH------------YSTGRGSPGMKI--YIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKM 881          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Human
Match: EPHB1 (EPH receptor B1 [Source:HGNC Symbol;Acc:HGNC:3392])

HSP 1 Score: 475.707 bits (1223), Expect = 3.781e-148
Identity = 307/939 (32.69%), Postives = 471/939 (50.16%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWR-----IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPI---ENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS-FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFN--MYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            E+ L+   + +    W  N  +  GW       +NL  N    Y VC V  P+ N+WL + FI+R     ++ ++ FT+R+C + P+ P S   C+ETF L  YE+DS I   ++  ++E  +  + TI+++  +   D    ++ +     S   + R G  +AFQ+ G+C+ +  V V++  C   + NF  FP T  G ES +  +  G C+         D  I  YC  +G W     +  C C  G E  +S  +C  C    +K  Q +E C  CP N+ S    S  C C  GYY       ++ C   P  PRN++    ++  IIL W+ P          D+++Y +I          C  C + + F+P      E +V +        Y F + ++N VS    +PF     S  I+        +  +    +      I LSW QP  P  I+    + +  R Y K  + FN+     +  + T+ + I+ +   + +V +VR R   G+G+FS     +T +    K+EL+ ++P        +  ++ + +  + + +                          +   C R++      +Y  K ++            YS+    P      Y +P TYED + A+ +F KEID  ++    +IG GEFG VY+G L +P      VA+K LK G SEK+R DFL EAS MGQF + N+++LEGV+T S   MIITEFM NG+L +FLR    + T IQL+ ML  +A GMKYL+ + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+P++ TAPEAI Y KF+ ASDVWS+G+V WEV+S+GE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   19 EETLMDTRTATAELGWTANPAS--GWEEVSGYDENL--NTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGS---CKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNA---EEVDVPIKLYCNGDGEWMVPIGR--CTCKPGYEPENS-VACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVI-SIVNETSIILEWHPP----RETGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSS--KSPFPPQHVSVNITTNQAAPSTVPIMH--QVSATMRSITLSWPQPEQPNGII----LDYEIRYYEKEHNEFNSS----MARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLP-------LIAGSAAAGVVFVVSLV-------------------------AISIVCSRKRAYSKEAVYSDKLQH------------YSTGRGSPGMKI--YIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKM 881          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Celegans
Match: vab-1 (Ephrin receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:O61460])

HSP 1 Score: 265.388 bits (677), Expect = 6.690e-73
Identity = 135/313 (43.13%), Postives = 191/313 (61.02%), Query Frame = 3
Query: 2061 YTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVL------------------------FVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTI---QLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDA--DDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            Y  Y +P TYED   AL +FT +I P  +  + +IG GEFG V  G L                            +  + VA+K LK G+S K + +FL EA+ MGQF + NV++L GV+T ++  MI+ E+M NGSL  FLR        +   ++ +ML  +A+GMKYL+ +G++HRDLAARN+LLD  L CK+ADFGLSR +  + +  +  YT    GK+P++ TAPEAI + KF+ +SDVWSFGVV WEV S+GE+PYW W+N +VI  +  GYRLPPP++CP  ++ +   CW +   +RPTF  +
Sbjct:  664 YKTYVDPTTYEDPYQALIEFTFDISPNDVFITQVIGGGEFGDVCLGGLSKNSPAAAKWSVSNTTMGRGGGGGGYESEPYETVAIKTLKSGSSAKAKAEFLTEATIMGQFSHPNVIRLIGVVTSAEPVMIVAEYMANGSLDQFLRNTDQRGEKVHWEKITEMLYGIASGMKYLTDMGYVHRDLAARNVLLDMELRCKIADFGLSRGVRSEGSSVEPEYTTN-GGKIPVRWTAPEAITHRKFTPSSDVWSFGVVIWEVCSFGERPYWDWTNQKVISEVMIGYRLPPPMDCPMGLYRIAQWCWKMERHERPTFTQL 975          

HSP 2 Score: 124.79 bits (312), Expect = 1.852e-28
Identity = 124/505 (24.55%), Postives = 220/505 (43.56%), Query Frame = 3
Query:  279 EGWRIQNLPPNADE------VYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFT--LLKYESDSP----IENIHYNER--TFAIIGTISSNNKWETKDRTENI-LNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYF-PRTAAGFESYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLIECIN---CPNKLVFLPSSKTKETKVIVLGSL-PSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLEN----IEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQ 1721
            E WR    P   DE       Y  C  D  + ++WL S FI       ++I++ F  R+C  Y +PKS   C+ETF+  L ++++  P    IE   ++E    +  IG ++ +N   T   TE + + I   + ++R     +AF+  G C+ +  V +YY  C E     +YF P+     E+    + G C+    +K    + ++  C + G     + + VC+ G     + +   C  C  N YK  +G   C  CP N+ S   ++SC C  GY+   +    + C +PP +P  ++ ++       L+WN P  +     +     +Y ++C     C   +V  P  K   T+ + +  L PS +Y F V + N VS       +  + ++ I + T+  E     +  L++ + Q++  GI ++W+   S +D+ ++E      R        F    +   +TT     FI L  + +Y   +VR R+   W Q
Sbjct:   62 ETWRN---PAATDEKHANQRAYVTCNYDMINPSNWLFSHFIEVKTARRIYIELLFNTRDCDAYLNPKS---CKETFSVYLKQFKTSRPGSTKIEKERFSEDIDNWKNIGRLARSNSNMT---TETLGMEIDSDTKTIR-----IAFEEQGICLSLLNVKIYYRICDEFTDQLVYFRPQVTGPKETDMVRMNGSCIPNASKKIPGVD-LIGLCMSTGSGIKTSGECVCDSGYSQIADSNGARCESCPTNTYKP-KGQSLCKSCPSNSISSEAASSCRCLNGYFRAEDELISMPCTQPPSRPIKLVANAITATSTRLSWNEPSSLGGRPEI-----WYEVKCSGRGEC-GTVVMTPGDKKLSTRSVQINGLRPSSDYTFLVFAKNKVSAQFP---EFSEKNAVIDIRTRSEEEDVPPVSHLRVDASQSD--GITIAWS--VSDSDVSDFE---VEVRPAIVKKRTFETRHVNMTYTT-----FIGLNPETVYQF-RVRIRDDLRWSQ 528          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Celegans
Match: vab-1 (Ephrin receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:O61460])

HSP 1 Score: 259.61 bits (662), Expect = 6.359e-71
Identity = 135/318 (42.45%), Postives = 191/318 (60.06%), Query Frame = 3
Query: 2061 YTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVL------------------------FVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTI---QLLKMLSNVANGMKYLSSIGFIHR-----DLAARNILLDENLVCKVADFGLSRELSDKDA--DDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            Y  Y +P TYED   AL +FT +I P  +  + +IG GEFG V  G L                            +  + VA+K LK G+S K + +FL EA+ MGQF + NV++L GV+T ++  MI+ E+M NGSL  FLR        +   ++ +ML  +A+GMKYL+ +G++HR     DLAARN+LLD  L CK+ADFGLSR +  + +  +  YT    GK+P++ TAPEAI + KF+ +SDVWSFGVV WEV S+GE+PYW W+N +VI  +  GYRLPPP++CP  ++ +   CW +   +RPTF  +
Sbjct:  664 YKTYVDPTTYEDPYQALIEFTFDISPNDVFITQVIGGGEFGDVCLGGLSKNSPAAAKWSVSNTTMGRGGGGGGYESEPYETVAIKTLKSGSSAKAKAEFLTEATIMGQFSHPNVIRLIGVVTSAEPVMIVAEYMANGSLDQFLRNTDQRGEKVHWEKITEMLYGIASGMKYLTDMGYVHRVSFLRDLAARNVLLDMELRCKIADFGLSRGVRSEGSSVEPEYTTN-GGKIPVRWTAPEAITHRKFTPSSDVWSFGVVIWEVCSFGERPYWDWTNQKVISEVMIGYRLPPPMDCPMGLYRIAQWCWKMERHERPTFTQL 980          

HSP 2 Score: 124.79 bits (312), Expect = 1.595e-28
Identity = 124/505 (24.55%), Postives = 220/505 (43.56%), Query Frame = 3
Query:  279 EGWRIQNLPPNADE------VYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFT--LLKYESDSP----IENIHYNER--TFAIIGTISSNNKWETKDRTENI-LNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYF-PRTAAGFESYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLIECIN---CPNKLVFLPSSKTKETKVIVLGSL-PSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLEN----IEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQ 1721
            E WR    P   DE       Y  C  D  + ++WL S FI       ++I++ F  R+C  Y +PKS   C+ETF+  L ++++  P    IE   ++E    +  IG ++ +N   T   TE + + I   + ++R     +AF+  G C+ +  V +YY  C E     +YF P+     E+    + G C+    +K    + ++  C + G     + + VC+ G     + +   C  C  N YK  +G   C  CP N+ S   ++SC C  GY+   +    + C +PP +P  ++ ++       L+WN P  +     +     +Y ++C     C   +V  P  K   T+ + +  L PS +Y F V + N VS       +  + ++ I + T+  E     +  L++ + Q++  GI ++W+   S +D+ ++E      R        F    +   +TT     FI L  + +Y   +VR R+   W Q
Sbjct:   62 ETWRN---PAATDEKHANQRAYVTCNYDMINPSNWLFSHFIEVKTARRIYIELLFNTRDCDAYLNPKS---CKETFSVYLKQFKTSRPGSTKIEKERFSEDIDNWKNIGRLARSNSNMT---TETLGMEIDSDTKTIR-----IAFEEQGICLSLLNVKIYYRICDEFTDQLVYFRPQVTGPKETDMVRMNGSCIPNASKKIPGVD-LIGLCMSTGSGIKTSGECVCDSGYSQIADSNGARCESCPTNTYKP-KGQSLCKSCPSNSISSEAASSCRCLNGYFRAEDELISMPCTQPPSRPIKLVANAITATSTRLSWNEPSSLGGRPEI-----WYEVKCSGRGEC-GTVVMTPGDKKLSTRSVQINGLRPSSDYTFLVFAKNKVSAQFP---EFSEKNAVIDIRTRSEEEDVPPVSHLRVDASQSD--GITIAWS--VSDSDVSDFE---VEVRPAIVKKRTFETRHVNMTYTT-----FIGLNPETVYQF-RVRIRDDLRWSQ 528          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Celegans
Match: src-2 (Tyrosine protein-kinase src-2 [Source:UniProtKB/Swiss-Prot;Acc:O45539])

HSP 1 Score: 204.912 bits (520), Expect = 2.422e-56
Identity = 109/276 (39.49%), Postives = 166/276 (60.14%), Query Frame = 3
Query: 2112 HDFTKEIDPKWLTTSTIIGQGEFGHVYQGV--LFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            +D   E+D + +     IG G+FG V++G   + VP      VAVK LK G ++    DFL EA  M +  +  +L L  V T  +  +I+TE M   +LLTFL+ +  +    QL+++ + VA GM YL  + FIHRDLAARNIL++ +L  K+ADFGL+R L  ++    Y  +   + PIK TAPEA  Y +F+  SDVWSFG++  E++++G  PY   +N EV+  + +GYR+P P  CP  ++++M  CW  + DKRPTF  + +++E +
Sbjct:  229 YDDQWEVDRRSVRLIRQIGAGQFGEVWEGRWNVNVP------VAVKKLKAGTADP--TDFLAEAQIMKKLRHPKLLSLYAVCTRDEPILIVTELM-QENLLTFLQRRGRQCQMPQLVEISAQVAAGMAYLEEMNFIHRDLAARNILINNSLSVKIADFGLARILMKENE---YEARTGARFPIKWTAPEAANYNRFTTKSDVWSFGILLTEIVTFGRLPYPGMTNAEVLQQVDAGYRMPCPAGCPVTLYDIMQQCWRSDPDKRPTFETLQWKLEDL 492          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Celegans
Match: abl-1 (Tyrosine-protein kinase abl-1 [Source:UniProtKB/Swiss-Prot;Acc:P03949])

HSP 1 Score: 210.69 bits (535), Expect = 4.207e-55
Identity = 123/339 (36.28%), Postives = 191/339 (56.34%), Query Frame = 3
Query: 2127 EIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLR-IKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQISS------QLCVTIKKN-----ETDR-----KDFKNCETAHLLMHCSDLNKDPVYDVTA-PQPPPRNLI 3089
            E+D   +     +G G++G VY+G     +     +AVK LK+ A     ++FL EA+ M    ++N+++L GV T    + IITEFM NG+LL +LR   K+ L  I L++M S +A+GM YL +  FIHRDLAARN L+ E+ + K+ADFGL+R + +    D YT     K PIK TAPE + +  FS  SDVW+FGV+ WE+ +YG  PY       V   +++G+R+  P  CPP ++ LML CWN +   RP F  I + +E + S      ++   +KKN     E+D+     ++  + ++ H   H  D +++ ++   + P+ P R+ I
Sbjct:  290 ELDRSEIIMHNKLGGGQYGDVYEGYW---KRHDCTIAVKALKEDA--MPLHEFLAEAAIMKDLHHKNLVRLLGVCTHEAPFYIITEFMCNGNLLEYLRRTDKSLLPPIILVQMASQIASGMSYLEARHFIHRDLAARNCLVSEHNIVKIADFGLARFMKE----DTYTAHAGAKFPIKWTAPEGLAFNTFSSKSDVWAFGVLLWEIATYGMAPYPGVELSNVYGLLENGFRMDGPQGCPPSVYRLMLQCWNWSPSDRPRFRDIHFNLENLISSNSLNDEVQKQLKKNNDKKLESDKRRSNVRERSDSKSRHSSHHDRDRDRESLHSRNSNPEIPNRSFI 619          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Celegans
Match: abl-1 (Tyrosine-protein kinase abl-1 [Source:UniProtKB/Swiss-Prot;Acc:P03949])

HSP 1 Score: 210.69 bits (535), Expect = 4.334e-55
Identity = 123/339 (36.28%), Postives = 191/339 (56.34%), Query Frame = 3
Query: 2127 EIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLR-IKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQISS------QLCVTIKKN-----ETDR-----KDFKNCETAHLLMHCSDLNKDPVYDVTA-PQPPPRNLI 3089
            E+D   +     +G G++G VY+G     +     +AVK LK+ A     ++FL EA+ M    ++N+++L GV T    + IITEFM NG+LL +LR   K+ L  I L++M S +A+GM YL +  FIHRDLAARN L+ E+ + K+ADFGL+R + +    D YT     K PIK TAPE + +  FS  SDVW+FGV+ WE+ +YG  PY       V   +++G+R+  P  CPP ++ LML CWN +   RP F  I + +E + S      ++   +KKN     E+D+     ++  + ++ H   H  D +++ ++   + P+ P R+ I
Sbjct:  295 ELDRSEIIMHNKLGGGQYGDVYEGYW---KRHDCTIAVKALKEDA--MPLHEFLAEAAIMKDLHHKNLVRLLGVCTHEAPFYIITEFMCNGNLLEYLRRTDKSLLPPIILVQMASQIASGMSYLEARHFIHRDLAARNCLVSEHNIVKIADFGLARFMKE----DTYTAHAGAKFPIKWTAPEGLAFNTFSSKSDVWAFGVLLWEIATYGMAPYPGVELSNVYGLLENGFRMDGPQGCPPSVYRLMLQCWNWSPSDRPRFRDIHFNLENLISSNSLNDEVQKQLKKNNDKKLESDKRRSNVRERSDSKSRHSSHHDRDRDRESLHSRNSNPEIPNRSFI 624          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Fly
Match: Eph (gene:FBgn0025936 transcript:FBtr0301285)

HSP 1 Score: 327.405 bits (838), Expect = 1.287e-94
Identity = 160/326 (49.08%), Postives = 222/326 (68.10%), Query Frame = 3
Query: 2070 YQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPED--ERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQISSQ---LCVTIKKNETDRKDFKNCETAHLLMHCSDL 3032
            Y +P+TYED + A+ +F +EID  ++T   IIG GEFG V +G L +P +  +   VA+K LK G+SEK R DFL EAS MGQF + NV+ L+GV+T S+  MIITE+M NGSL TFLR+   +  T+QL+ ML  +A+GM YLS + ++HRDLAARN+L++  L+CK+ADFGLSRE+  ++A D YT +  GK+P++ TAPEAI + KF+ ASDVWS+GVV WEV+SYGE+PYW WSN +VI +I+ GYRLP P++CP  ++ LML CW      RPTF  I   ++ ++ Q   L  T    E+D     + +    +   +DL
Sbjct:  683 YVDPHTYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREI--ENASDAYTTR-GGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTRPSPESDGNHILDGQRGQNIFISTDL 1005          

HSP 2 Score: 170.629 bits (431), Expect = 1.039e-42
Identity = 133/458 (29.04%), Postives = 217/458 (47.38%), Query Frame = 3
Query:  198 LFYCEKVLLLNTSISGWNNWKK----NTKTYEGWRIQNLPPNADEV----YGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPI-ENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFE-SYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNT-YSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISY-----YLIECINCPNKLVFLPSSKT-KETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSS----SKISLLTKPLENIEKLKLKSIQTNKHGIVLS 1508
            L + ++V+LL+T+      W +          GW  ++       +    Y VC+V + + N+WL SPFI R     L+I++ FT+R+C  +P   +   C+ETF+LL YE D+   E   +   ++ +I  I++      ++   +I N    SI+V + GV  AF++ G+C+ +  V VYY+ C     NF +F  T  G E +      G CV+         E     C+ +G W    +   C C +G E N +  +C +C    +K  + + KC PCP N+  S TGS  C C  G+Y  PN  + + C  PP  P N+ +   DQ   I++W++P   ES  + +++  Y     Y I+C  C   +V+ PS+ T  ETK+ +    P   Y  ++ ++N VS         ++SS    S I      L NI  L L  ++T +  IV +
Sbjct:   46 LAHADQVVLLDTTREATLEWTRYPYGPQAQTPGWVEESFTDFVKGINWRSYVVCDVAYHNVNNWLWSPFIDRGSANRLYIEIQFTIRDCSLFPG--NALSCKETFSLLFYEFDAATREPPPWQTDSYRLIARIAAGEGRFNQNSDVDI-NTEVKSIAVNKKGVYFAFRDQGACISVLAVKVYYITCPAVTENFAHFNETPTGREITIIEKQNGTCVDNA----EPYETPTYLCKGDGKWTI--LTGGCRCKAGYEPNYTNKTCTECPLGTFKSPEVT-KCTPCPPNSNASKTGSPFCKCASGFYRHPNDGRHMPCYSPPAAPTNLTLLFVDQTSAIISWSAPAKNESFSSETNSKIYHSDIVYKIKCNICSPNVVYNPSTDTFNETKITLTNLEPVTTYTVQIHAINSVSHINEFKRHSNESSLVAVSDIVFSNTSLLNI-PLDLNEVKTGQAEIVFT 492          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Fly
Match: Eph (gene:FBgn0025936 transcript:FBtr0089083)

HSP 1 Score: 327.02 bits (837), Expect = 2.916e-94
Identity = 160/326 (49.08%), Postives = 222/326 (68.10%), Query Frame = 3
Query: 2070 YQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPED--ERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQISSQ---LCVTIKKNETDRKDFKNCETAHLLMHCSDL 3032
            Y +P+TYED + A+ +F +EID  ++T   IIG GEFG V +G L +P +  +   VA+K LK G+SEK R DFL EAS MGQF + NV+ L+GV+T S+  MIITE+M NGSL TFLR+   +  T+QL+ ML  +A+GM YLS + ++HRDLAARN+L++  L+CK+ADFGLSRE+  ++A D YT +  GK+P++ TAPEAI + KF+ ASDVWS+GVV WEV+SYGE+PYW WSN +VI +I+ GYRLP P++CP  ++ LML CW      RPTF  I   ++ ++ Q   L  T    E+D     + +    +   +DL
Sbjct:  667 YVDPHTYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREI--ENASDAYTTR-GGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTRPSPESDGNHILDGQRGQNIFISTDL 989          

HSP 2 Score: 170.629 bits (431), Expect = 1.309e-42
Identity = 133/458 (29.04%), Postives = 217/458 (47.38%), Query Frame = 3
Query:  198 LFYCEKVLLLNTSISGWNNWKK----NTKTYEGWRIQNLPPNADEV----YGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPI-ENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFE-SYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNT-YSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISY-----YLIECINCPNKLVFLPSSKT-KETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSS----SKISLLTKPLENIEKLKLKSIQTNKHGIVLS 1508
            L + ++V+LL+T+      W +          GW  ++       +    Y VC+V + + N+WL SPFI R     L+I++ FT+R+C  +P   +   C+ETF+LL YE D+   E   +   ++ +I  I++      ++   +I N    SI+V + GV  AF++ G+C+ +  V VYY+ C     NF +F  T  G E +      G CV+         E     C+ +G W    +   C C +G E N +  +C +C    +K  + + KC PCP N+  S TGS  C C  G+Y  PN  + + C  PP  P N+ +   DQ   I++W++P   ES  + +++  Y     Y I+C  C   +V+ PS+ T  ETK+ +    P   Y  ++ ++N VS         ++SS    S I      L NI  L L  ++T +  IV +
Sbjct:   46 LAHADQVVLLDTTREATLEWTRYPYGPQAQTPGWVEESFTDFVKGINWRSYVVCDVAYHNVNNWLWSPFIDRGSANRLYIEIQFTIRDCSLFPG--NALSCKETFSLLFYEFDAATREPPPWQTDSYRLIARIAAGEGRFNQNSDVDI-NTEVKSIAVNKKGVYFAFRDQGACISVLAVKVYYITCPAVTENFAHFNETPTGREITIIEKQNGTCVDNA----EPYETPTYLCKGDGKWTI--LTGGCRCKAGYEPNYTNKTCTECPLGTFKSPEVT-KCTPCPPNSNASKTGSPFCKCASGFYRHPNDGRHMPCYSPPAAPTNLTLLFVDQTSAIISWSAPAKNESFSSETNSKIYHSDIVYKIKCNICSPNVVYNPSTDTFNETKITLTNLEPVTTYTVQIHAINSVSHINEFKRHSNESSLVAVSDIVFSNTSLLNI-PLDLNEVKTGQAEIVFT 492          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Fly
Match: Eph (gene:FBgn0025936 transcript:FBtr0089082)

HSP 1 Score: 327.02 bits (837), Expect = 5.066e-94
Identity = 160/326 (49.08%), Postives = 222/326 (68.10%), Query Frame = 3
Query: 2070 YQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPED--ERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQISSQ---LCVTIKKNETDRKDFKNCETAHLLMHCSDL 3032
            Y +P+TYED + A+ +F +EID  ++T   IIG GEFG V +G L +P +  +   VA+K LK G+SEK R DFL EAS MGQF + NV+ L+GV+T S+  MIITE+M NGSL TFLR+   +  T+QL+ ML  +A+GM YLS + ++HRDLAARN+L++  L+CK+ADFGLSRE+  ++A D YT +  GK+P++ TAPEAI + KF+ ASDVWS+GVV WEV+SYGE+PYW WSN +VI +I+ GYRLP P++CP  ++ LML CW      RPTF  I   ++ ++ Q   L  T    E+D     + +    +   +DL
Sbjct:  700 YVDPHTYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREI--ENASDAYTTR-GGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTRPSPESDGNHILDGQRGQNIFISTDL 1022          

HSP 2 Score: 170.244 bits (430), Expect = 1.605e-42
Identity = 133/458 (29.04%), Postives = 217/458 (47.38%), Query Frame = 3
Query:  198 LFYCEKVLLLNTSISGWNNWKK----NTKTYEGWRIQNLPPNADEV----YGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPI-ENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFE-SYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNT-YSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISY-----YLIECINCPNKLVFLPSSKT-KETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSS----SKISLLTKPLENIEKLKLKSIQTNKHGIVLS 1508
            L + ++V+LL+T+      W +          GW  ++       +    Y VC+V + + N+WL SPFI R     L+I++ FT+R+C  +P   +   C+ETF+LL YE D+   E   +   ++ +I  I++      ++   +I N    SI+V + GV  AF++ G+C+ +  V VYY+ C     NF +F  T  G E +      G CV+         E     C+ +G W    +   C C +G E N +  +C +C    +K  + + KC PCP N+  S TGS  C C  G+Y  PN  + + C  PP  P N+ +   DQ   I++W++P   ES  + +++  Y     Y I+C  C   +V+ PS+ T  ETK+ +    P   Y  ++ ++N VS         ++SS    S I      L NI  L L  ++T +  IV +
Sbjct:   79 LAHADQVVLLDTTREATLEWTRYPYGPQAQTPGWVEESFTDFVKGINWRSYVVCDVAYHNVNNWLWSPFIDRGSANRLYIEIQFTIRDCSLFPG--NALSCKETFSLLFYEFDAATREPPPWQTDSYRLIARIAAGEGRFNQNSDVDI-NTEVKSIAVNKKGVYFAFRDQGACISVLAVKVYYITCPAVTENFAHFNETPTGREITIIEKQNGTCVDNA----EPYETPTYLCKGDGKWTI--LTGGCRCKAGYEPNYTNKTCTECPLGTFKSPEVT-KCTPCPPNSNASKTGSPFCKCASGFYRHPNDGRHMPCYSPPAAPTNLTLLFVDQTSAIISWSAPAKNESFSSETNSKIYHSDIVYKIKCNICSPNVVYNPSTDTFNETKITLTNLEPVTTYTVQIHAINSVSHINEFKRHSNESSLVAVSDIVFSNTSLLNI-PLDLNEVKTGQAEIVFT 525          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Fly
Match: Eph (gene:FBgn0025936 transcript:FBtr0089086)

HSP 1 Score: 327.02 bits (837), Expect = 5.066e-94
Identity = 160/326 (49.08%), Postives = 222/326 (68.10%), Query Frame = 3
Query: 2070 YQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPED--ERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQISSQ---LCVTIKKNETDRKDFKNCETAHLLMHCSDL 3032
            Y +P+TYED + A+ +F +EID  ++T   IIG GEFG V +G L +P +  +   VA+K LK G+SEK R DFL EAS MGQF + NV+ L+GV+T S+  MIITE+M NGSL TFLR+   +  T+QL+ ML  +A+GM YLS + ++HRDLAARN+L++  L+CK+ADFGLSRE+  ++A D YT +  GK+P++ TAPEAI + KF+ ASDVWS+GVV WEV+SYGE+PYW WSN +VI +I+ GYRLP P++CP  ++ LML CW      RPTF  I   ++ ++ Q   L  T    E+D     + +    +   +DL
Sbjct:  700 YVDPHTYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREI--ENASDAYTTR-GGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTRPSPESDGNHILDGQRGQNIFISTDL 1022          

HSP 2 Score: 170.244 bits (430), Expect = 1.605e-42
Identity = 133/458 (29.04%), Postives = 217/458 (47.38%), Query Frame = 3
Query:  198 LFYCEKVLLLNTSISGWNNWKK----NTKTYEGWRIQNLPPNADEV----YGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPI-ENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFE-SYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNT-YSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISY-----YLIECINCPNKLVFLPSSKT-KETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSS----SKISLLTKPLENIEKLKLKSIQTNKHGIVLS 1508
            L + ++V+LL+T+      W +          GW  ++       +    Y VC+V + + N+WL SPFI R     L+I++ FT+R+C  +P   +   C+ETF+LL YE D+   E   +   ++ +I  I++      ++   +I N    SI+V + GV  AF++ G+C+ +  V VYY+ C     NF +F  T  G E +      G CV+         E     C+ +G W    +   C C +G E N +  +C +C    +K  + + KC PCP N+  S TGS  C C  G+Y  PN  + + C  PP  P N+ +   DQ   I++W++P   ES  + +++  Y     Y I+C  C   +V+ PS+ T  ETK+ +    P   Y  ++ ++N VS         ++SS    S I      L NI  L L  ++T +  IV +
Sbjct:   79 LAHADQVVLLDTTREATLEWTRYPYGPQAQTPGWVEESFTDFVKGINWRSYVVCDVAYHNVNNWLWSPFIDRGSANRLYIEIQFTIRDCSLFPG--NALSCKETFSLLFYEFDAATREPPPWQTDSYRLIARIAAGEGRFNQNSDVDI-NTEVKSIAVNKKGVYFAFRDQGACISVLAVKVYYITCPAVTENFAHFNETPTGREITIIEKQNGTCVDNA----EPYETPTYLCKGDGKWTI--LTGGCRCKAGYEPNYTNKTCTECPLGTFKSPEVT-KCTPCPPNSNASKTGSPFCKCASGFYRHPNDGRHMPCYSPPAAPTNLTLLFVDQTSAIISWSAPAKNESFSSETNSKIYHSDIVYKIKCNICSPNVVYNPSTDTFNETKITLTNLEPVTTYTVQIHAINSVSHINEFKRHSNESSLVAVSDIVFSNTSLLNI-PLDLNEVKTGQAEIVFT 525          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Fly
Match: Eph (gene:FBgn0025936 transcript:FBtr0089085)

HSP 1 Score: 326.635 bits (836), Expect = 6.916e-94
Identity = 160/326 (49.08%), Postives = 222/326 (68.10%), Query Frame = 3
Query: 2070 YQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPED--ERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQISSQ---LCVTIKKNETDRKDFKNCETAHLLMHCSDL 3032
            Y +P+TYED + A+ +F +EID  ++T   IIG GEFG V +G L +P +  +   VA+K LK G+SEK R DFL EAS MGQF + NV+ L+GV+T S+  MIITE+M NGSL TFLR+   +  T+QL+ ML  +A+GM YLS + ++HRDLAARN+L++  L+CK+ADFGLSRE+  ++A D YT +  GK+P++ TAPEAI + KF+ ASDVWS+GVV WEV+SYGE+PYW WSN +VI +I+ GYRLP P++CP  ++ LML CW      RPTF  I   ++ ++ Q   L  T    E+D     + +    +   +DL
Sbjct:  716 YVDPHTYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREI--ENASDAYTTR-GGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTRPSPESDGNHILDGQRGQNIFISTDL 1038          

HSP 2 Score: 170.244 bits (430), Expect = 1.940e-42
Identity = 133/458 (29.04%), Postives = 217/458 (47.38%), Query Frame = 3
Query:  198 LFYCEKVLLLNTSISGWNNWKK----NTKTYEGWRIQNLPPNADEV----YGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPI-ENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFE-SYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNT-YSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISY-----YLIECINCPNKLVFLPSSKT-KETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSS----SKISLLTKPLENIEKLKLKSIQTNKHGIVLS 1508
            L + ++V+LL+T+      W +          GW  ++       +    Y VC+V + + N+WL SPFI R     L+I++ FT+R+C  +P   +   C+ETF+LL YE D+   E   +   ++ +I  I++      ++   +I N    SI+V + GV  AF++ G+C+ +  V VYY+ C     NF +F  T  G E +      G CV+         E     C+ +G W    +   C C +G E N +  +C +C    +K  + + KC PCP N+  S TGS  C C  G+Y  PN  + + C  PP  P N+ +   DQ   I++W++P   ES  + +++  Y     Y I+C  C   +V+ PS+ T  ETK+ +    P   Y  ++ ++N VS         ++SS    S I      L NI  L L  ++T +  IV +
Sbjct:   79 LAHADQVVLLDTTREATLEWTRYPYGPQAQTPGWVEESFTDFVKGINWRSYVVCDVAYHNVNNWLWSPFIDRGSANRLYIEIQFTIRDCSLFPG--NALSCKETFSLLFYEFDAATREPPPWQTDSYRLIARIAAGEGRFNQNSDVDI-NTEVKSIAVNKKGVYFAFRDQGACISVLAVKVYYITCPAVTENFAHFNETPTGREITIIEKQNGTCVDNA----EPYETPTYLCKGDGKWTI--LTGGCRCKAGYEPNYTNKTCTECPLGTFKSPEVT-KCTPCPPNSNASKTGSPFCKCASGFYRHPNDGRHMPCYSPPAAPTNLTLLFVDQTSAIISWSAPAKNESFSSETNSKIYHSDIVYKIKCNICSPNVVYNPSTDTFNETKITLTNLEPVTTYTVQIHAINSVSHINEFKRHSNESSLVAVSDIVFSNTSLLNI-PLDLNEVKTGQAEIVFT 525          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Zebrafish
Match: ephb2a (eph receptor B2a [Source:ZFIN;Acc:ZDB-GENE-070713-2])

HSP 1 Score: 473.781 bits (1218), Expect = 4.398e-148
Identity = 312/948 (32.91%), Postives = 474/948 (50.00%), Query Frame = 3
Query:  162 IISWLWIMDLINLFYCEKVLLLNTSISGWNNWKKNTKTYEGWR-IQNLPPNADEV--YGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHY---NERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTY-SFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNI-----SYYLIECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRR--QMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            II  LWI+ L+  +  E VL+ +T+ +    W        GW  +     N + +  Y VC V   + N+W+R+ +I R     +H+++ F++R+C + P  K    C+ETF L  +ESDS      Y    E  +  + TI+++  +   D    ++ I     S   V R G  +AFQ+ G+C+ +  V V+Y  C   + N   F  T +G ES +  +  G CV  G      D  I  YC  +G W     +  C C +G E  D+ T C  C    +K  QG ++C+ CP N+  S  G+ SC+C  GYY   +   ++ C   P  P+ ++  S ++  + L W+ P      E V  NI           C  C + + F+P      E ++ +   L   +Y F++ +VN VS    +P+    ++  I+        +  +   S   +   I LSW+QP  P  ++    + +  + Y KN      +S   +  + T+ + I  +     +V +VR R   G+G+FS     +T +     + L+ K+P        + +A+   +  I   ++                          +  C RR      + Y  K ++            Y+S +  P      Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L +P     +VA+K LK G +EK+R DFL EAS MGQF + N++ LEGV+T S   MIITEFM NGSL +FLR    + T IQL+ ML  +A GMKYL  + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+PI+ TAPEAI Y KF+ +SDVWS+G+V WEV+SYGE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   35 IIRLLWIIRLV--WAVEDVLMDSTTATAELGWTIYPSL--GWEEVSGYDENMNTIRTYQVCNVFDANQNNWVRTKYIRRRGAQRIHVEMKFSVRDCSSIP--KVPGSCKETFNLYYFESDSDTATKVYPAWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGACMSLIAVKVFYRKCPRIIRNGAIFQETLSGAESTSLVSARGTCVPNG---EEVDVPIKLYCNGDGEWLVPIGR--CVCKAGHESVDNGTMCKACPFGSFKASQGDQQCLQCPINSRTSSEGATSCVCRNGYYRTDSDPLQMPCTTVPSAPQRVI-SSVNETSLRLEWDVPKESGGREDVVYNIICKSCGSGRGACTRCGDNVQFVPRQLGLTEPRIHISDLLAHTQYTFEIQAVNGVSD--QSPYSPQFTAVNITTNQAAPSAVSIMHQVSRAVDS--ITLSWSQPDQPNGVI----LDYELQYYEKNA----VESNSSLLRSQTNTAVIRGLKSGTIYVFQVRARTVAGFGRFSGKMYFQTMTEEEYNSSLQEKLPL------IIGSAAAGVVFLIAVVVL--------------------------IIVCNRRGSDRTDSEYTDKLQH------------YTSGHMSPGMKI--YIDPFTYEDPNEAVREFAKEIDVTCVKIEQVIGAGEFGEVCSGNLRLPGKREILVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNIIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLCDMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSSSDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNNRPKFSQIVNTLDKM 912          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Zebrafish
Match: ephb4b (eph receptor B4b [Source:NCBI gene;Acc:30691])

HSP 1 Score: 471.855 bits (1213), Expect = 1.013e-147
Identity = 308/977 (31.53%), Postives = 471/977 (48.21%), Query Frame = 3
Query:  159 WI--ISWLWIMDLINLFYCEKVLLLNTSISG----WNNWKKNTKTYEGWRIQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENI---HYNERTFAIIGTISSNNKWE-TKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS-FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLIE---CINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYV-TNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI---SSQLCVTIKKNETDRKDFKNCETAHLLMHCSDL 3032
            WI  +SW W++    L   E+ +L+NT +      W  +      +E     +   N+   + VC +D  S + WLR+ FI R     +++++ FTM EC   P   S R C+ETF L  Y+SD    +     + E  ++ + T++++       +R  N+  +    +S +  G  +AFQ  G+C+ +  V V++  C      F  FP T     S  +   G CV+       S      +C  +G W        C C  G E  DS   C  C    YK   G   C  CP N+ + F GS+ C+C  GY+   +      C KPP  PR+I+   +D   + L W+ P        +S ++         C+ C + + + P        +VI+ G LP   Y F V + N VS    T+P     +SS +++ T     +    ++ I+ ++  + +SW  P                +DY     L   D  +   ++ +S   +N ++    +  +VR R   G+G FS   SI+   ++ +   P+++ LT  +       +  I   I+                            +C RR    +  R+    +K            S   L  Q    Y +P TYED + A+ +F KEID  ++    +IG GEFG V +G L VP  +   VA+K LK G ++K+R DFL EAS MGQF + N++ LEGV+T S   MI+TE+M NG+L +FLR+   + T IQL+ ML  +A+GMKYLS + F+HRDLAARNIL++ NLVCKV+DFGLSR L++  +D  YT+   GK+PI+ TAPEAI + KF+ ASDVWS+G+V WEV+S+GE+PYW  SN +VI+AI+  YRLPPP  CP  +H LML CW      RP F  I   ++++    + L +T +  +       +      L HCS +
Sbjct:    6 WIMALSWFWMVS-TGLVSAEEEVLMNTKLETSDLRWTIYPSGDPEWEEMSGLDEEGNSVRTFQVCPMDS-SVSHWLRTRFIPRHGASQVYVEIRFTMMECSAMP--ASFRTCKETFNLYYYQSDEDTASATHPAWMENPYSKVDTVAADFLLRRGGERKSNVKTVRVGPLSKK--GFYLAFQTQGACMALLSVRVFFKKCPAVSRAFSSFPETLP--HSLVQQAEGVCVDNSAPTGQSTAPPTMFCGEDGQWVGPP-SSTCACKPGYEPVDSD-RCRACGLGQYKASVGGSLCRVCPDNSNTHFAGSSLCVCRPGYHRATSDLPDSACTKPPSAPRSIIYQINDTV-VTLEWSEPLDRGGRSDLSYSVECMHCRGSLCVQCADSITYRPGQMGVPGRRVIIRGLLPHTTYTFTVLAQNGVSAVSHTSP-----ASSSVNITTSRDVAVPVSGIRRIKASESSVSISWTVPPQ---------TQHSIQDYQLRYSLKGQDDGWQYVSSRSSSVVLNDLSRASQYQVQVRARTAAGYGHFSSAVSISTLPDDEE--SPSRLMLTGVLVAIGLLIL--IAVVIV--------------------------AVFCFRR----STRRRDPDPDK------------SGQFLMGQGIKVYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVCRGRLKVPGKKENYVAIKTLKGGYTDKQRRDFLSEASIMGQFQHPNIIHLEGVITASCPVMILTEYMENGALDSFLRLNDGQFTPIQLVGMLRGIASGMKYLSEMSFVHRDLAARNILVNSNLVCKVSDFGLSRFLTENSSDPTYTSSLGGKIPIRWTAPEAIAFRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPECPASLHQLMLDCWQKERSSRPRFCAIVSALDRLIRNPASLKITGRIPDGPSHPLLDQRAPPPLSHCSSV 911          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Zebrafish
Match: ephb2b (eph receptor B2b [Source:ZFIN;Acc:ZDB-GENE-050522-415])

HSP 1 Score: 470.7 bits (1210), Expect = 3.135e-147
Identity = 312/950 (32.84%), Postives = 488/950 (51.37%), Query Frame = 3
Query:  174 LWIM-DLINLFYCEKVLLLNTSIS---GWNNWKKNTKTYEGWR-IQNLPPNADEV--YGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIENIHY---NERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNI-----SYYLIECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVS-------QYVTNPFDMDQSS-SKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            LWI+  L ++   E++L+ +T+ +   GW  +  +  +   W  +     N + +  Y VC V   + N+W+R+ +I R     +H+++ F++R+C + P  P S   C+ETF L  YESDS      +    E  +  + TI+++  +   D    ++ I     S   V R G  +AFQ+ G C+ +  V V+Y  C   + N   F  T +G ES +     G C+         D  I  YC  +G W     +  C C +G E  ++ T C  C + F+K  QG EKC+ CP N+ +   G+ +C+C  GYY   +   ++ C   P  P+N++  S ++  ++L WN P      + V  NI           C  C + + F+P      E++V +   L   +Y F++ +VN VS       QY +     +Q++ S +S++ +    I+             I LSW+QP  P  ++    + +  + Y K+    N+  +     + T+ + I  +     +V +VR R   G+G+                          +     F T+T+ + +  + ++ + ++I  +   +  L+ +++++  C RR          F+    E T   Q  Y+S +  P      Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L +P      VA+K LK G +EK+R DFL EAS MGQF + NV+ LEGV+T S   MIITEFM NGSL +FLR    + T IQL+ ML  +A+GMKYL+ + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  +N +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:    5 LWILWTLPSVLAIEEILMDSTTATAELGWTVYPVSGTSDSSWEEVSGYDENMNTIRTYQVCNVFDANQNNWVRTKYIRRRGAQRIHVEMKFSVRDCSSIPRVPGS---CKETFNLYYYESDSDTATKTFPPWMENPWIKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRNGFYLAFQDYGGCMSLIAVRVFYRKCPRTIRNGAIFQETLSGAESTSLVAARGVCIPNA---EEVDVPIKLYCNGDGEWMVPIGR--CMCKAGHEAVENGTVCRACPSGFFKTAQGDEKCLQCPINSRTTNDGATNCVCRNGYYRTDSDPLEMPCTTVPSAPQNVI-SSVNETSLMLEWNPPRETGGRDDVVYNIICKSCGGGRGGCTRCGDNVQFIPRQLGLTESRVFISDLLAHTQYTFEIQAVNGVSDQSPYSPQYTSVNITTNQAAPSTVSIMHQVSRTIDS------------ITLSWSQPDQPNGVI----LDYELQYYEKDQTEHNSSMV----KSQTNTAVIRGLKPGGIYVFQVRARTVAGFGR--------------------------YSGKMYFQTMTE-EEYNTSIQEKLPLIIGSAAAGLVFLIAVVVIIIVCNRR---------GFERADSEYTDKLQH-YTSGHMSPGMKI--YIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGNLKLPGKREMFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSSPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIASGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNNRPKFSQIVNNLDKM 886          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Zebrafish
Match: AL929508.2 (eph receptor B2a [Source:NCBI gene;Acc:562176])

HSP 1 Score: 466.463 bits (1199), Expect = 1.065e-146
Identity = 300/897 (33.44%), Postives = 445/897 (49.61%), Query Frame = 3
Query:  309 NADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHY---NERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTY-SFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNI-----SYYLIECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVS-------QYVTNPFDMDQSS-SKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            N    Y VC V   + N+W+R+ +I R     +H+++ F++R+C + P  K    C+ETF L  +ESDS      Y    E  +  + TI+++  +   D    ++ I     S   V R G  +AFQ+ G+C+ +  V V+Y  C   + N   F  T +G ES +  +  G CV  G      D  I  YC  +G W     +  C C +G E  D+ T C  C    +K  QG ++C+ CP N+  S  G+ SC+C  GYY   +   ++ C   P  P+ ++  S ++  + L W+ P      E V  NI           C  C + + F+P      E ++ +   L   +Y F++ +VN VS       Q+       +Q++ S +S++ +    ++             I LSW+QP  P  ++    + +  + Y KN      +S   +  + T+ + I  +     +V +VR R   G+G+FS    I     +  L +  K+ L      A    +  +   II                             C RR           K + + + SP   IY               +P TYED + A+ +F KEID   +    +IG GEFG V  G L +P     +VA+K LK G +EK+R DFL EAS MGQF + N++ LEGV+T S   MIITEFM NGSL +FLR    + T IQL+ ML  +A GMKYL  + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+PI+ TAPEAI Y KF+ +SDVWS+G+V WEV+SYGE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   15 NTIRTYQVCNVFDANQNNWVRTKYIRRRGAQRIHVEMKFSVRDCSSIP--KVPGSCKETFNLYYFESDSDTATKVYPAWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGACMSLIAVKVFYRKCPRIIRNGAIFQETLSGAESTSLVSARGTCVPNG---EEVDVPIKLYCNGDGEWLVPIGR--CVCKAGHESVDNGTMCKACPFGSFKPSQGDQQCLQCPINSRTSSEGATSCVCRNGYYRTDSDPLQMPCTTVPSAPQRVI-SSVNETSLRLEWDVPKESGGREDVVYNIICKSCGSGRGACTRCGDNVQFVPRQLGLTEPRIHISDLLAHTQYTFEIQAVNGVSDQSPYSPQFTAVNITTNQAAPSAVSIMHQVSRAVDS------------ITLSWSQPDQPNGVI----LDYELQYYEKNA----VESNSSLLRSQTNTAVIRGLKSGTIYVFQVRARTVAGFGRFSGKIHI-----DFVLLLQEKLPLIIGSAAAGVVFLIAVVVLII----------------------------VCNRRGSDRTDSEYTDKLQHYTSVSPGMKIYI--------------DPFTYEDPNEAVREFAKEIDVTCVKIEQVIGAGEFGEVCSGNLRLPGKREILVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNIIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLCDMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSSSDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNNRPKFSQIVNTLDKM 836          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Zebrafish
Match: epha4a (eph receptor A4a [Source:NCBI gene;Acc:64271])

HSP 1 Score: 468.774 bits (1205), Expect = 1.759e-146
Identity = 306/943 (32.45%), Postives = 476/943 (50.48%), Query Frame = 3
Query:  162 IISWLWIMDLINLFYC--EKVLLLNTSISGWNNWKKNTKTYEGWR---IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVI------VAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIV--NYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSF-TGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSSKTKETKVIVLGSLPSR-EYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            +I W+    L    Y   E  LL + ++ G   W   + T  GW    I +        Y VC V  PS N+WLR+ +I R     ++I++ FT+R+C + P    +  C+ETF L  YES++  E  +  E  F  I TI+++  +   D  + I+ +   +  VR +G++      +AFQ+ G+C+ +  V ++Y  C   + N   FP T  G ++ +   V G CV+      NS+E+ V   YC A+G W        C C  G E  + + +C  C    Y+ L     C  CP ++YS   GS SC C++G++        + C +PP  P++ L+ + ++  + L W +P    +S     +++Y +I          C  C N + F P      T  + +  L +   Y F++ +VN VS+    P    + +  +++ T          +++    +H + L+W QP  P  ++ EYE      + Y K+ +    +  + +  T++  + I  ++ L  +V  VR R   G+G+FS                     +TN V +       +    +++    V+++++   + +              RR+  ++  +Q    E+     P   IY               +P TYED + A+ +F KEID   +    +IG GEFG V  G L +P      VA+K LK G ++K+R DFL EAS MGQF + N+++LEGV+T     MIITE+M NGSL  FLR      T IQL+ +L  +A+GMKYLS + ++HRDLAARNIL++ NLVCKV+DFG+SR L ++D D  YT +  GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI AI+ GYRLPPP++CP  +H LML CW     +RP F  I
Sbjct:   12 LIIWIPTFALTARVYPPNEVTLLDSRTVQGELKWVA-SPTEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWIPRGGAQRVYIEIKFTLRDCNSLPG--VMGTCKETFNLYYYESNNDKER-YIRENQFTKIDTIAADESFTQVDIGDRIMKL---NTEVRDVGILTRKGFYLAFQDVGACIALVSVRIFYKKCPLTVRNLAQFPDTTTGADTSSLVEVRGSCVD------NSEEREVPKMYCGADGEWLVPIGN--CLCNPGYE--EHEGTCQACKIGNYRALATDGSCSKCPLHSYSVREGSTSCACDKGFFRSETDPASMPCTQPPSAPQH-LISNVNETSVNLEWTAP----ASSGGRQDLAYNVICKRCSSDGQRCQPCGNGIHFSPQQLGLRTTRVSINDLQAHTNYTFEIWAVNGVSKQSPGP----EQAVSVTVTTNQAAPSPVTTIQAKDITRHAVSLAWQQPERPNGVILEYE-----VKYYEKDQN----ERSYRIMKTSSRSAEIKGLSPLTSYVFHVRARTAAGYGEFSAPFEF----------------MTNSVPSPIIGDGANSTVLLVSVIGSVILLLIFIGVFIIS------------RRRSKYSKAKQDSDEERH--LHPGVRIYV--------------DPFTYEDPNQAVREFAKEIDASCIKIEKVIGIGEFGEVCSGRLKMPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIRLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGILRGIASGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVL-EEDPDAAYTTR-GGKIPIRWTAPEAITYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPVSLHQLMLDCWQKERAERPKFSQI 873          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Xenopus
Match: sik1 (salt inducible kinase 1 [Source:Xenbase;Acc:XB-GENE-6462410])

HSP 1 Score: 492.271 bits (1266), Expect = 3.025e-155
Identity = 314/941 (33.37%), Postives = 477/941 (50.69%), Query Frame = 3
Query:  198 LFYCEKVLLLNTSISGWNNWKKNTKTYEGWR-----IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIEN---IHYNERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            +F   K L+   + +    W  N  +  GW       +NL  N    Y VC V  PS N+WL + FI R     +++++ FT+R+C + P+ P S   C+ETF L  YE+DS I+N     +NE  +  + TI+++  +   D    ++ +     S   + R G  +AFQ+ G+C+ +  V V++  C   + NF  FP T  G ES +  +  G C+         D  I  YC  +G W     K  C C +G E  ++   C  C    +K  QG   C PCP N+ S +  S  CIC  GYY       +  C   P  PRN++   ++ A I L W+ P          D+++Y +I          C  C + + F+P      +T+V +        Y F++ ++N V+    +PF     S  I+       ++  +    ++     I LSW QP  P  I+    + +  R Y K+   FN+     +  + T+ + I  +   + +V +VR R   G+G+FS     +T +    K+EL+ ++P        +  ++ + +  I + +                          +   C R++      ++   ++K +        YS+    P      Y +P TYED + A+ +F KEID  ++    +IG GEFG VY+G L +P      VA+K LK G SEK+R DFL EAS MGQF + N+++LEGV+T S   MIITEFM NG+L +FLR    + T IQL+ ML  +A GMKYLS + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+P++ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:    8 VFLIAKTLMDTRTATAELGWTANPSS--GWEEVSGYDENL--NTIRTYQVCNVFGPSQNNWLLTTFIPRRGAHRVYVEMRFTVRDCSSLPNVPGS---CKETFNLYYYETDSNIDNKISTFWNESPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRSGFYLAFQDYGACMSLLSVRVFFKKCPSVVQNFAVFPETMTGAESTSLVIARGTCIPNA---EEVDVPIKLYCNGDGEWMVPIGK--CTCKAGYE-PENHVVCKACPAAMFKANQGMGVCAPCPANSRSTSEASPICICRNGYYRADFDTPEAPCTSVPSGPRNVISIVNETA-ITLEWHPP----RETGGRDDVTYNIICKKCQSDRRGCSRCDDNVEFVPRQMGLTDTRVFISNLWAHTPYTFEIQAINGVTN--KSPFPPQHVSVNITTNQAAPSSVPIMH--QVKATMKSITLSWPQPEQPNGII----LDYEIRYYEKDHHEFNSS----LARSQTNTASIEGLRPGVVYVVQVRARTVAGYGKFSSKMCFQTLTAEDYKSELREQLP-------LIAGSAAAGVVFIVSLV-------------------------AISIVCSRKR---TYSKEAVYSDKLQH-------YSTGRGSPGMKI--YIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPSKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFGEIVNTLDKM 874          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Xenopus
Match: sik1 (salt inducible kinase 1 [Source:Xenbase;Acc:XB-GENE-6462410])

HSP 1 Score: 489.96 bits (1260), Expect = 2.728e-154
Identity = 305/899 (33.93%), Postives = 462/899 (51.39%), Query Frame = 3
Query:  309 NADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIEN---IHYNERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            N    Y VC V  PS N+WL + FI R     +++++ FT+R+C + P+ P S   C+ETF L  YE+DS I+N     +NE  +  + TI+++  +   D    ++ +     S   + R G  +AFQ+ G+C+ +  V V++  C   + NF  FP T  G ES +  +  G C+         D  I  YC  +G W     K  C C +G E  ++   C  C    +K  QG   C PCP N+ S +  S  CIC  GYY       +  C   P  PRN++   ++ A I L W+ P          D+++Y +I          C  C + + F+P      +T+V +        Y F++ ++N V+    +PF     S  I+       ++  +    ++     I LSW QP  P  I+    + +  R Y K+   FN+     +  + T+ + I  +   + +V +VR R   G+G+FS     +T +    K+EL+ ++P        +  ++ + +  I + +                          +   C R++      ++   ++K +        YS+    P      Y +P TYED + A+ +F KEID  ++    +IG GEFG VY+G L +P      VA+K LK G SEK+R DFL EAS MGQF + N+++LEGV+T S   MIITEFM NG+L +FLR    + T IQL+ ML  +A GMKYLS + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+P++ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   57 NTIRTYQVCNVFGPSQNNWLLTTFIPRRGAHRVYVEMRFTVRDCSSLPNVPGS---CKETFNLYYYETDSNIDNKISTFWNESPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRSGFYLAFQDYGACMSLLSVRVFFKKCPSVVQNFAVFPETMTGAESTSLVIARGTCIPNA---EEVDVPIKLYCNGDGEWMVPIGK--CTCKAGYE-PENHVVCKACPAAMFKANQGMGVCAPCPANSRSTSEASPICICRNGYYRADFDTPEAPCTSVPSGPRNVISIVNETA-ITLEWHPP----RETGGRDDVTYNIICKKCQSDRRGCSRCDDNVEFVPRQMGLTDTRVFISNLWAHTPYTFEIQAINGVTN--KSPFPPQHVSVNITTNQAAPSSVPIMH--QVKATMKSITLSWPQPEQPNGII----LDYEIRYYEKDHHEFNSS----LARSQTNTASIEGLRPGVVYVVQVRARTVAGYGKFSSKMCFQTLTAEDYKSELREQLP-------LIAGSAAAGVVFIVSLV-------------------------AISIVCSRKR---TYSKEAVYSDKLQH-------YSTGRGSPGMKI--YIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPSKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFGEIVNTLDKM 885          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Xenopus
Match: sik1 (salt inducible kinase 1 [Source:Xenbase;Acc:XB-GENE-6462410])

HSP 1 Score: 489.189 bits (1258), Expect = 4.151e-154
Identity = 305/899 (33.93%), Postives = 462/899 (51.39%), Query Frame = 3
Query:  309 NADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIEN---IHYNERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            N    Y VC V  PS N+WL + FI R     +++++ FT+R+C + P+ P S   C+ETF L  YE+DS I+N     +NE  +  + TI+++  +   D    ++ +     S   + R G  +AFQ+ G+C+ +  V V++  C   + NF  FP T  G ES +  +  G C+         D  I  YC  +G W     K  C C +G E  ++   C  C    +K  QG   C PCP N+ S +  S  CIC  GYY       +  C   P  PRN++   ++ A I L W+ P          D+++Y +I          C  C + + F+P      +T+V +        Y F++ ++N V+    +PF     S  I+       ++  +    ++     I LSW QP  P  I+    + +  R Y K+   FN+     +  + T+ + I  +   + +V +VR R   G+G+FS     +T +    K+EL+ ++P        +  ++ + +  I + +                          +   C R++      ++   ++K +        YS+    P      Y +P TYED + A+ +F KEID  ++    +IG GEFG VY+G L +P      VA+K LK G SEK+R DFL EAS MGQF + N+++LEGV+T S   MIITEFM NG+L +FLR    + T IQL+ ML  +A GMKYLS + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+P++ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   51 NTIRTYQVCNVFGPSQNNWLLTTFIPRRGAHRVYVEMRFTVRDCSSLPNVPGS---CKETFNLYYYETDSNIDNKISTFWNESPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRSGFYLAFQDYGACMSLLSVRVFFKKCPSVVQNFAVFPETMTGAESTSLVIARGTCIPNA---EEVDVPIKLYCNGDGEWMVPIGK--CTCKAGYE-PENHVVCKACPAAMFKANQGMGVCAPCPANSRSTSEASPICICRNGYYRADFDTPEAPCTSVPSGPRNVISIVNETA-ITLEWHPP----RETGGRDDVTYNIICKKCQSDRRGCSRCDDNVEFVPRQMGLTDTRVFISNLWAHTPYTFEIQAINGVTN--KSPFPPQHVSVNITTNQAAPSSVPIMH--QVKATMKSITLSWPQPEQPNGII----LDYEIRYYEKDHHEFNSS----LARSQTNTASIEGLRPGVVYVVQVRARTVAGYGKFSSKMCFQTLTAEDYKSELREQLP-------LIAGSAAAGVVFIVSLV-------------------------AISIVCSRKR---TYSKEAVYSDKLQH-------YSTGRGSPGMKI--YIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPSKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFGEIVNTLDKM 879          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Xenopus
Match: sik1 (salt inducible kinase 1 [Source:Xenbase;Acc:XB-GENE-6462410])

HSP 1 Score: 487.263 bits (1253), Expect = 7.310e-154
Identity = 306/899 (34.04%), Postives = 456/899 (50.72%), Query Frame = 3
Query:  309 NADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIEN---IHYNERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            N    Y VC V  PS N+WL + FI R     +++++ FT+R+C + P+ P S   C+ETF L  YE+DS I+N     +NE  +  + TI+++  +   D    ++ +     S   + R G  +AFQ+ G+C+ +  V V++  C   + NF  FP T  G ES +  +  G C+         D  I  YC  +G W     K  C C +G E  ++   C  C    +K  QG   C PCP N+ S +  S  CIC  GYY       +  C   P  PRN++   ++ A I L W+ P          D+++Y +I          C  C + + F+P      +T+V +        Y F++ ++N V+    +PF     S  I+       ++  +    ++     I LSW QP  P  I+    + +  R Y K+   FN+     +  + T+ + I  +   + +V +VR R   G+G+FS     +T +    K+EL+ ++P    +           ++ +   I+   K+ V                                Y  K ++  +   SP   IY               +P TYED + A+ +F KEID  ++    +IG GEFG VY+G L +P      VA+K LK G SEK+R DFL EAS MGQF + N+++LEGV+T S   MIITEFM NG+L +FLR    + T IQL+ ML  +A GMKYLS + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+P++ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   19 NTIRTYQVCNVFGPSQNNWLLTTFIPRRGAHRVYVEMRFTVRDCSSLPNVPGS---CKETFNLYYYETDSNIDNKISTFWNESPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRSGFYLAFQDYGACMSLLSVRVFFKKCPSVVQNFAVFPETMTGAESTSLVIARGTCIPNA---EEVDVPIKLYCNGDGEWMVPIGK--CTCKAGYE-PENHVVCKACPAAMFKANQGMGVCAPCPANSRSTSEASPICICRNGYYRADFDTPEAPCTSVPSGPRNVISIVNETA-ITLEWHPP----RETGGRDDVTYNIICKKCQSDRRGCSRCDDNVEFVPRQMGLTDTRVFISNLWAHTPYTFEIQAINGVTN--KSPFPPQHVSVNITTNQAAPSSVPIMH--QVKATMKSITLSWPQPEQPNGII----LDYEIRYYEKDHHEFNSS----LARSQTNTASIEGLRPGVVYVVQVRARTVAGYGKFSSKMCFQTLTAEDYKSELREQLPL---IAGSAAAGVVFIVSLVAISIVCSSKEAV--------------------------------YSDKLQH--YSTGSPGMKIYI--------------DPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPSKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFGEIVNTLDKM 840          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Xenopus
Match: sik1 (salt inducible kinase 1 [Source:Xenbase;Acc:XB-GENE-6462410])

HSP 1 Score: 487.649 bits (1254), Expect = 7.573e-154
Identity = 306/899 (34.04%), Postives = 456/899 (50.72%), Query Frame = 3
Query:  309 NADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIEN---IHYNERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            N    Y VC V  PS N+WL + FI R     +++++ FT+R+C + P+ P S   C+ETF L  YE+DS I+N     +NE  +  + TI+++  +   D    ++ +     S   + R G  +AFQ+ G+C+ +  V V++  C   + NF  FP T  G ES +  +  G C+         D  I  YC  +G W     K  C C +G E  ++   C  C    +K  QG   C PCP N+ S +  S  CIC  GYY       +  C   P  PRN++   ++ A I L W+ P          D+++Y +I          C  C + + F+P      +T+V +        Y F++ ++N V+    +PF     S  I+       ++  +    ++     I LSW QP  P  I+    + +  R Y K+   FN+     +  + T+ + I  +   + +V +VR R   G+G+FS     +T +    K+EL+ ++P    +           ++ +   I+   K+ V                                Y  K ++  +   SP   IY               +P TYED + A+ +F KEID  ++    +IG GEFG VY+G L +P      VA+K LK G SEK+R DFL EAS MGQF + N+++LEGV+T S   MIITEFM NG+L +FLR    + T IQL+ ML  +A GMKYLS + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+P++ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   31 NTIRTYQVCNVFGPSQNNWLLTTFIPRRGAHRVYVEMRFTVRDCSSLPNVPGS---CKETFNLYYYETDSNIDNKISTFWNESPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRSGFYLAFQDYGACMSLLSVRVFFKKCPSVVQNFAVFPETMTGAESTSLVIARGTCIPNA---EEVDVPIKLYCNGDGEWMVPIGK--CTCKAGYE-PENHVVCKACPAAMFKANQGMGVCAPCPANSRSTSEASPICICRNGYYRADFDTPEAPCTSVPSGPRNVISIVNETA-ITLEWHPP----RETGGRDDVTYNIICKKCQSDRRGCSRCDDNVEFVPRQMGLTDTRVFISNLWAHTPYTFEIQAINGVTN--KSPFPPQHVSVNITTNQAAPSSVPIMH--QVKATMKSITLSWPQPEQPNGII----LDYEIRYYEKDHHEFNSS----LARSQTNTASIEGLRPGVVYVVQVRARTVAGYGKFSSKMCFQTLTAEDYKSELREQLPL---IAGSAAAGVVFIVSLVAISIVCSSKEAV--------------------------------YSDKLQH--YSTGSPGMKIYI--------------DPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPSKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFGEIVNTLDKM 852          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Mouse
Match: Epha4 (Eph receptor A4 [Source:MGI Symbol;Acc:MGI:98277])

HSP 1 Score: 481.485 bits (1238), Expect = 3.295e-151
Identity = 314/923 (34.02%), Postives = 464/923 (50.27%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWR---IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL---GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIV--NYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS-FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI----------ECINCPNKLVFLPSSKT-KETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            E  LL + S+ G   W   +    GW    I +        Y VC V   S N+WLR+ +I+R+    ++I++ FT+R+C + P    +  C+ETF L  YESD+  E     E  F  I TI+++  +   D  + I+ +      V  L   G  +AFQ+ G+C+ +  V V+Y  C   + N   FP T  G ++ +   V G CV      +NS+E+ V   YC A+G W        C C +G E  + +  C  C   +YK L     C  CP ++YS + G+ SC C++G++   N    + C +PP  P N L+ + ++  + L W+SP     +     +ISY ++          +C  C + + + P     K T+V +   L    Y F++ +VN VS+Y  +P   DQS S +++ T          +++ +  ++ + L+W +P  P  ++ EYE        Y++      +  I      NT    +N +T  ++ V   R R   G+G FSE            L++ T    +  +   + ST+  +          +++                    + I R+      R K+   K EA     +         NQ    Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L VP      VA+K LK G ++K+R DFL EAS MGQF + N++ LEGV+T     MIITE+M NGSL  FLR      T IQL+ ML  + +GMKYLS + ++HRDLAARNIL++ NLVCKV+DFG+SR L D D +  YT +  GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI AI+ GYRLPPP++CP  +H LML CW      RP F  I
Sbjct:   30 EVTLLDSRSVQGELGWIA-SPLEGGWEEVSIMDEKNTPIRTYQVCNVMEASQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPG--VMGTCKETFNLYYYESDNDKERF-IRESQFGKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCV------NNSEEKDVPKMYCGADGEWLVPIGN--CLCNAGHEEQNGE--CQACKIGYYKALSTDASCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLN-LISNVNETSVNLEWSSP----QNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTRVSITDLLAHTNYTFEIWAVNGVSKYNPSP---DQSVS-VTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEV------KYYEKDQNERSYRIVRTAARNTDIKGLNPLTSYVFHV---RARTAAGYGDFSE-----------PLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILI------------------AAFVISRR------RSKYSKAKQEADEEKHL---------NQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLED-DPEAAYTTR-GGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQI 874          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Mouse
Match: Epha4 (Eph receptor A4 [Source:MGI Symbol;Acc:MGI:98277])

HSP 1 Score: 481.485 bits (1238), Expect = 3.295e-151
Identity = 314/923 (34.02%), Postives = 464/923 (50.27%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWR---IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL---GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIV--NYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS-FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI----------ECINCPNKLVFLPSSKT-KETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            E  LL + S+ G   W   +    GW    I +        Y VC V   S N+WLR+ +I+R+    ++I++ FT+R+C + P    +  C+ETF L  YESD+  E     E  F  I TI+++  +   D  + I+ +      V  L   G  +AFQ+ G+C+ +  V V+Y  C   + N   FP T  G ++ +   V G CV      +NS+E+ V   YC A+G W        C C +G E  + +  C  C   +YK L     C  CP ++YS + G+ SC C++G++   N    + C +PP  P N L+ + ++  + L W+SP     +     +ISY ++          +C  C + + + P     K T+V +   L    Y F++ +VN VS+Y  +P   DQS S +++ T          +++ +  ++ + L+W +P  P  ++ EYE        Y++      +  I      NT    +N +T  ++ V   R R   G+G FSE            L++ T    +  +   + ST+  +          +++                    + I R+      R K+   K EA     +         NQ    Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L VP      VA+K LK G ++K+R DFL EAS MGQF + N++ LEGV+T     MIITE+M NGSL  FLR      T IQL+ ML  + +GMKYLS + ++HRDLAARNIL++ NLVCKV+DFG+SR L D D +  YT +  GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI AI+ GYRLPPP++CP  +H LML CW      RP F  I
Sbjct:   30 EVTLLDSRSVQGELGWIA-SPLEGGWEEVSIMDEKNTPIRTYQVCNVMEASQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPG--VMGTCKETFNLYYYESDNDKERF-IRESQFGKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCV------NNSEEKDVPKMYCGADGEWLVPIGN--CLCNAGHEEQNGE--CQACKIGYYKALSTDASCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLN-LISNVNETSVNLEWSSP----QNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTRVSITDLLAHTNYTFEIWAVNGVSKYNPSP---DQSVS-VTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEV------KYYEKDQNERSYRIVRTAARNTDIKGLNPLTSYVFHV---RARTAAGYGDFSE-----------PLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILI------------------AAFVISRR------RSKYSKAKQEADEEKHL---------NQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLED-DPEAAYTTR-GGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQI 874          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Mouse
Match: Epha4 (Eph receptor A4 [Source:MGI Symbol;Acc:MGI:98277])

HSP 1 Score: 481.485 bits (1238), Expect = 3.295e-151
Identity = 314/923 (34.02%), Postives = 464/923 (50.27%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWR---IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL---GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIV--NYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS-FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI----------ECINCPNKLVFLPSSKT-KETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            E  LL + S+ G   W   +    GW    I +        Y VC V   S N+WLR+ +I+R+    ++I++ FT+R+C + P    +  C+ETF L  YESD+  E     E  F  I TI+++  +   D  + I+ +      V  L   G  +AFQ+ G+C+ +  V V+Y  C   + N   FP T  G ++ +   V G CV      +NS+E+ V   YC A+G W        C C +G E  + +  C  C   +YK L     C  CP ++YS + G+ SC C++G++   N    + C +PP  P N L+ + ++  + L W+SP     +     +ISY ++          +C  C + + + P     K T+V +   L    Y F++ +VN VS+Y  +P   DQS S +++ T          +++ +  ++ + L+W +P  P  ++ EYE        Y++      +  I      NT    +N +T  ++ V   R R   G+G FSE            L++ T    +  +   + ST+  +          +++                    + I R+      R K+   K EA     +         NQ    Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L VP      VA+K LK G ++K+R DFL EAS MGQF + N++ LEGV+T     MIITE+M NGSL  FLR      T IQL+ ML  + +GMKYLS + ++HRDLAARNIL++ NLVCKV+DFG+SR L D D +  YT +  GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI AI+ GYRLPPP++CP  +H LML CW      RP F  I
Sbjct:   30 EVTLLDSRSVQGELGWIA-SPLEGGWEEVSIMDEKNTPIRTYQVCNVMEASQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPG--VMGTCKETFNLYYYESDNDKERF-IRESQFGKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCV------NNSEEKDVPKMYCGADGEWLVPIGN--CLCNAGHEEQNGE--CQACKIGYYKALSTDASCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLN-LISNVNETSVNLEWSSP----QNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTRVSITDLLAHTNYTFEIWAVNGVSKYNPSP---DQSVS-VTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEV------KYYEKDQNERSYRIVRTAARNTDIKGLNPLTSYVFHV---RARTAAGYGDFSE-----------PLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILI------------------AAFVISRR------RSKYSKAKQEADEEKHL---------NQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLED-DPEAAYTTR-GGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQI 874          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Mouse
Match: Ephb1 (Eph receptor B1 [Source:MGI Symbol;Acc:MGI:1096337])

HSP 1 Score: 476.478 bits (1225), Expect = 2.607e-149
Identity = 309/937 (32.98%), Postives = 470/937 (50.16%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWR-----IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPI---ENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            E+ L+   + +    W  N  +  GW       +NL  N    Y VC V  P+ N+WL + FI+R     ++ ++ FT+R+C + P+ P S   C+ETF L  YE+DS I   ++  ++E  +  + TI+++  +   D    ++ +     S   + R G  +AFQ+ G+C+ +  V V++  C   + NF  FP T  G ES +  +  G C+         D  I  YC  +G W     +  C C  G E  +S  +C  C    +K  Q +E C  CP N+ S +  S  C C  GYY       ++ C   P  PRN++    ++  IIL W+ P          D+++Y +I          C  C + + F+P      E +V +        Y F + ++N VS    +PF     S  I+        +  +    +      I LSW QP  P  I+    + +  R Y K  + FN+     +  + T+ + I+ +   + +V +VR R   G+G+FS     +T +    K+EL+ ++P        +  ++ + +  + + +                          +   C R++             K  A S     YS+    P      Y +P TYED + A+ +F KEID  ++    +IG GEFG VY+G L +P      VA+K LK G SEK+R DFL EAS MGQF + N+++LEGV+T S   MIITEFM NG+L +FLR    + T IQL+ ML  +A GMKYLS + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+P++ TAPEAI Y KF+ ASDVWS+G+V WEV+S+GE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   19 EETLMDTRTATAELGWTANPAS--GWEEVSGYDENL--NTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGS---CKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNA---EEVDVPIKLYCNGDGEWMVPIGR--CTCKPGYEPENS-VACKACPAGTFKASQEAEGCSHCPSNSRSPSEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVI-SIVNETSIILEWHPP----RETGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSS--KSPFPPQHVSVNITTNQAAPSTVPIMH--QVSATMRSITLSWPQPEQPNGII----LDYEIRYYEKEHNEFNSS----MARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLP-------LIAGSAAAGVVFVVSLV-------------------------AISIVCSRKRAY----------SKEAAYSDKLQHYSTGRGSPGMKI--YIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKM 881          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Mouse
Match: Ephb2 (Eph receptor B2 [Source:MGI Symbol;Acc:MGI:99611])

HSP 1 Score: 468.389 bits (1204), Expect = 2.422e-146
Identity = 302/894 (33.78%), Postives = 449/894 (50.22%), Query Frame = 3
Query:  309 NADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIENI---HYNERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            N    Y VC V   S N+WLR+ FI R     +H+++ F++R+C + P  P S   C+ETF L  YE+D  +      ++ E  +  + TI+++  +   D    ++ I     S   V R G  +AFQ+ G C+ +  V V+Y  C   + N   F  T +G ES +     G C+         D  I  YC  +G W     +  C C +G E  ++ T C  C +  +K  QG E C  CP N+ + + G+ +C+C  GYY        + C   P  P+ ++  S ++  ++L W  P          +++ Y +I          C  C + + + P      E ++ +   L   +Y F++ +VN V+    +PF    +S  +++ T          +  +      I LSW+QP  P  ++    + +  + Y K    +NA +I     TNT  +   L    IY V +VR R   G+G++S  K   +   E + +   K +L   V +++   +  I   +I                             C RR+         F+    E T   Q  Y+S +  P      Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L +P      VA+K LK G +EK+R DFL EAS MGQF + NV+ LEGV+T S   MIITEFM NGSL +FLR    + T IQL+ ML  +A GMKYL+ + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  +N +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   54 NTIRTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGS---CKETFNLYYYEADFDLATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRNGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGSCI---ANAEEVDVPIKLYCNGDGEWLVPIGR--CMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVI-SSVNETSLMLEWTPP----RDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTD--QSPFSPQFAS--VNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVI----LDYELQYYEKELSEYNATAIKS--PTNT-VTVQGLKAGAIY-VFQVRARTVAGYGRYS-GKMYFQTMTEAEYQTSIKEKLPLIVGSSAAGLVFLIAVVVI--------------------------AIVCNRRR--------GFERADSEYTDKLQH-YTSGHMTPGMKI--YIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKM 884          
BLAST of Ephrin type-A receptor 4-B vs. UniProt/SwissProt
Match: sp|Q07496|EPHA4_CHICK (Ephrin type-A receptor 4 OS=Gallus gallus OX=9031 GN=EPHA4 PE=1 SV=2)

HSP 1 Score: 488.419 bits (1256), Expect = 5.069e-153
Identity = 320/923 (34.67%), Postives = 469/923 (50.81%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWR---IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL---GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIV--NYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS-FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI----------ECINCPNKLVFLPSSKT-KETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            E  LL + S+ G   W   +    GW    I +        Y VC V  PS N+WLR+ +I R+    ++I++ FT+R+C + P    +  C+ETF L  YES++  E     E  FA I TI+++  +   D  + I+ +      V  L   G  +AFQ+ G+C+ +  V V+Y  C   + N   FP T  G ++ +   V G CV      +NS+E+ V   YC A+G W        C C +G E  + +  C  C   +YK L     C  CP ++YS + GS SC C++G++   N    + C +PP  P+N L+ + ++  + L W++P     ++   D+ISY ++           C +C + + F P     K TKV +   L    Y F+V +VN VS++  NP   DQ+ S +++ T          +++ +  +H + L+W +P  P  ++ EYE        Y++      +  I    + NT    +N +T  ++ V   R R   G+G FS                      TN V +      T+    +++    VV++++                 + I R+      R K+   K EA     +         NQ    Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L VP      VA+K LK G ++K+R DFL EAS MGQF + N++ LEGV+T     MIITE+M NGSL  FLR      T IQL+ ML  + +GMKYLS + ++HRDLAARNIL++ NLVCKV+DFG+SR L D D +  YT +  GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI AI+ GYRLPPP++CP  +H LML CW      RP F  I
Sbjct:   30 EVTLLDSRSVQGELGWIA-SPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWIPREGAQRVYIEIKFTLRDCNSLPG--VMGTCKETFNLYYYESNNDKERF-IRESQFAKIDTIAADESFTQVDIGDRIMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCV------NNSEEKDVPKMYCGADGEWLVPIGN--CLCNAGYEERNGE--CQACKIGYYKALSTDVACAKCPPHSYSIWEGSTSCTCDRGFFRAENDAASMPCTRPPSAPQN-LISNVNETSVNLEWSAP----QNKGGRDDISYNVVCKRCGAGEPSHCRSCGSGVHFSPQQNGLKTTKVSITDLLAHTNYTFEVWAVNGVSKH--NP-SQDQAVS-VTVTTNQAAPSPIALIQAKEITRHSVALAWLEPDRPNGVILEYEV------KYYEKDQNERSYRIVKTASRNTDIKGLNPLTSYVFHV---RARTAAGYGDFSGPFEFT----------------TNTVPSPIIGDGTNPTVLLVSVAGSVVLVVILIA-------------AFVISRR------RSKYSKAKQEADEEKHL---------NQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLED-DPEAAYTTR-GGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQI 874          
BLAST of Ephrin type-A receptor 4-B vs. UniProt/SwissProt
Match: sp|P54764|EPHA4_HUMAN (Ephrin type-A receptor 4 OS=Homo sapiens OX=9606 GN=EPHA4 PE=1 SV=1)

HSP 1 Score: 485.723 bits (1249), Expect = 4.842e-152
Identity = 317/923 (34.34%), Postives = 464/923 (50.27%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWR---IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL---GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIV--NYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS-FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI----------ECINCPNKLVFLPSSKT-KETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            E  LL + S+ G   W   +    GW    I +        Y VC V  PS N+WLR+ +I+R+    ++I++ FT+R+C + P    +  C+ETF L  YESD+  E     E  F  I TI+++  +   D  + I+ +      V  L   G  +AFQ+ G+C+ +  V V+Y  C   + N   FP T  G ++ +   V G CV      +NS+E+ V   YC A+G W        C C +G E  +    C  C   +YK L     C  CP ++YS + G+ SC C++G++   N    + C +PP  P N L+ + ++  + L W+SP     +     +ISY ++          +C  C + + + P     K TKV +   L    Y F++ +VN VS+Y  NP   DQS S +++ T          +++ +  ++ + L+W +P  P  ++ EYE        Y++      +  I      NT    +N +T  ++ V   R R   G+G FSE            L++ T    +  +   + ST+  +          +++                    + I R+      R K+   K EA     +         NQ    Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L VP      VA+K LK G ++K+R DFL EAS MGQF + N++ LEGV+T     MIITE+M NGSL  FLR      T IQL+ ML  + +GMKYLS + ++HRDLAARNIL++ NLVCKV+DFG+SR L D D +  YT +  GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI AI+ GYRLPPP++CP  +H LML CW      RP F  I
Sbjct:   30 EVTLLDSRSVQGELGWIA-SPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPG--VMGTCKETFNLYYYESDNDKERF-IRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCV------NNSEEKDVPKMYCGADGEWLVPIGN--CLCNAGHE--ERSGECQACKIGYYKALSTDATCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLN-LISNVNETSVNLEWSSP----QNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVSKYNPNP---DQSVS-VTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEV------KYYEKDQNERSYRIVRTAARNTDIKGLNPLTSYVFHV---RARTAAGYGDFSE-----------PLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILI------------------AAFVISRR------RSKYSKAKQEADEEKHL---------NQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLED-DPEAAYTTR-GGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQI 874          
BLAST of Ephrin type-A receptor 4-B vs. UniProt/SwissProt
Match: sp|Q03137|EPHA4_MOUSE (Ephrin type-A receptor 4 OS=Mus musculus OX=10090 GN=Epha4 PE=1 SV=2)

HSP 1 Score: 481.485 bits (1238), Expect = 2.305e-150
Identity = 314/923 (34.02%), Postives = 464/923 (50.27%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWR---IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL---GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIV--NYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS-FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI----------ECINCPNKLVFLPSSKT-KETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            E  LL + S+ G   W   +    GW    I +        Y VC V   S N+WLR+ +I+R+    ++I++ FT+R+C + P    +  C+ETF L  YESD+  E     E  F  I TI+++  +   D  + I+ +      V  L   G  +AFQ+ G+C+ +  V V+Y  C   + N   FP T  G ++ +   V G CV      +NS+E+ V   YC A+G W        C C +G E  + +  C  C   +YK L     C  CP ++YS + G+ SC C++G++   N    + C +PP  P N L+ + ++  + L W+SP     +     +ISY ++          +C  C + + + P     K T+V +   L    Y F++ +VN VS+Y  +P   DQS S +++ T          +++ +  ++ + L+W +P  P  ++ EYE        Y++      +  I      NT    +N +T  ++ V   R R   G+G FSE            L++ T    +  +   + ST+  +          +++                    + I R+      R K+   K EA     +         NQ    Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L VP      VA+K LK G ++K+R DFL EAS MGQF + N++ LEGV+T     MIITE+M NGSL  FLR      T IQL+ ML  + +GMKYLS + ++HRDLAARNIL++ NLVCKV+DFG+SR L D D +  YT +  GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI AI+ GYRLPPP++CP  +H LML CW      RP F  I
Sbjct:   30 EVTLLDSRSVQGELGWIA-SPLEGGWEEVSIMDEKNTPIRTYQVCNVMEASQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPG--VMGTCKETFNLYYYESDNDKERF-IRESQFGKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCV------NNSEEKDVPKMYCGADGEWLVPIGN--CLCNAGHEEQNGE--CQACKIGYYKALSTDASCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLN-LISNVNETSVNLEWSSP----QNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTRVSITDLLAHTNYTFEIWAVNGVSKYNPSP---DQSVS-VTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEV------KYYEKDQNERSYRIVRTAARNTDIKGLNPLTSYVFHV---RARTAAGYGDFSE-----------PLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILI------------------AAFVISRR------RSKYSKAKQEADEEKHL---------NQGVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLED-DPEAAYTTR-GGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQI 874          
BLAST of Ephrin type-A receptor 4-B vs. UniProt/SwissProt
Match: sp|P09759|EPHB1_RAT (Ephrin type-B receptor 1 OS=Rattus norvegicus OX=10116 GN=Ephb1 PE=1 SV=2)

HSP 1 Score: 478.019 bits (1229), Expect = 4.558e-149
Identity = 308/939 (32.80%), Postives = 473/939 (50.37%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWR-----IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPI---ENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFN--MYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            E+ L+   + +    W  N  +  GW       +NL  N    Y VC V  P+ N+WL + FI+R     ++ ++ FT+R+C + P+ P S   C+ETF L  YE+DS I   ++  ++E  +  + TI+++  +   D    ++ +     S   + R G  +AFQ+ G+C+ +  V V++  C   + NF  FP T  G ES +  +  G C+         D  I  YC  +G W     +  C C +G E  +S  +C  C    +K  Q +E C  CP N+ S +  S  C C  GYY       ++ C   P  PRN++    ++  IIL W+ P          D+++Y +I          C  C + + F+P      E +V +        Y F + ++N VS    +PF     S  I+        +  +    +      I LSW QP  P  I+    + +  R Y K  + FN+     +  + T+ + I+ +   + +V +VR R   G+G+FS     +T +    K+EL+ ++P        +  ++ + +  + + +                          +   C R++      +Y  K ++            YS+    P      Y +P TYED + A+ +F KEID  ++    +IG GEFG VY+G L +P      VA+K LK G SEK+R DFL EAS MGQF + N+++LEGV+T S   MIITEFM NG+L +FLR    + T IQL+ ML  +A GMKYLS + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+P++ TAPEAI Y KF+ ASDVWS+G+V WEV+S+GE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   19 EETLMDTRTATAELGWTANPAS--GWEEVSGYDENL--NTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGS---CKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNA---EEVDVPIKLYCNGDGEWMVPIGR--CTCKAGYEPENS-VACKACPAGTFKASQEAEGCSHCPSNSRSPSEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVI-SIVNETSIILEWHPP----RETGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSS--KSPFPPQHVSVNITTNQAAPSTVPIMH--QVSATMRSITLSWPQPEQPNGII----LDYEIRYYEKEHNEFNSS----MARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLP-------LIAGSAAAGVVFVVSLV-------------------------AISIVCSRKRAYSKEAVYSDKLQH------------YSTGRGSPGMKI--YIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKM 881          
BLAST of Ephrin type-A receptor 4-B vs. UniProt/SwissProt
Match: sp|P54762|EPHB1_HUMAN (Ephrin type-B receptor 1 OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1)

HSP 1 Score: 476.478 bits (1225), Expect = 1.731e-148
Identity = 307/939 (32.69%), Postives = 471/939 (50.16%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWR-----IQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPI---ENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS-FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFN--MYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            E+ L+   + +    W  N  +  GW       +NL  N    Y VC V  P+ N+WL + FI+R     ++ ++ FT+R+C + P+ P S   C+ETF L  YE+DS I   ++  ++E  +  + TI+++  +   D    ++ +     S   + R G  +AFQ+ G+C+ +  V V++  C   + NF  FP T  G ES +  +  G C+         D  I  YC  +G W     +  C C  G E  +S  +C  C    +K  Q +E C  CP N+ S    S  C C  GYY       ++ C   P  PRN++    ++  IIL W+ P          D+++Y +I          C  C + + F+P      E +V +        Y F + ++N VS    +PF     S  I+        +  +    +      I LSW QP  P  I+    + +  R Y K  + FN+     +  + T+ + I+ +   + +V +VR R   G+G+FS     +T +    K+EL+ ++P        +  ++ + +  + + +                          +   C R++      +Y  K ++            YS+    P      Y +P TYED + A+ +F KEID  ++    +IG GEFG VY+G L +P      VA+K LK G SEK+R DFL EAS MGQF + N+++LEGV+T S   MIITEFM NG+L +FLR    + T IQL+ ML  +A GMKYL+ + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+P++ TAPEAI Y KF+ ASDVWS+G+V WEV+S+GE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   19 EETLMDTRTATAELGWTANPAS--GWEEVSGYDENL--NTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGS---CKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNA---EEVDVPIKLYCNGDGEWMVPIGR--CTCKPGYEPENS-VACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVI-SIVNETSIILEWHPP----RETGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSS--KSPFPPQHVSVNITTNQAAPSTVPIMH--QVSATMRSITLSWPQPEQPNGII----LDYEIRYYEKEHNEFNSS----MARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLP-------LIAGSAAAGVVFVVSLV-------------------------AISIVCSRKRAYSKEAVYSDKLQH------------YSTGRGSPGMKI--YIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKM 881          
BLAST of Ephrin type-A receptor 4-B vs. TrEMBL
Match: A0A2T7PUI0 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_04077 PE=3 SV=1)

HSP 1 Score: 530.406 bits (1365), Expect = 1.579e-166
Identity = 312/876 (35.62%), Postives = 468/876 (53.42%), Query Frame = 3
Query:  333 CEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIEN---IHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL-GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLIECINCPNKLVFLPSSKTKETKVIVLGSLPSRE-YDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTK---YQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            C +     ++W+R+PF+ R    +LHI + F+MR+C    DP +L+ C+ETF L  YE+DS   N     ++  T+ +I  ++++  +E  D  +  +N    S+++R L GV  AFQ+ GSCV +  + VYY+ C +   NF +F    AG +       G CV   V K          CQ +GLW  D+  E C C  G +GN  KT+C  C  NFYK  +G+  C  CP N++S + G+A C C  G+Y  P   + L C +PP +PR++++++     + L W+ P  +     +      Y + C  C N +++ P      T  + L +L S   Y   V + N VS  ++  F    +S+ +++ T+    +  + ++ +      I ++W  P S    +  E   F  R YF      +A +++ V+   T   F     D IYF   V  +  KGWG+FS+   +A  +         + +L + V+T        I   ++      +M+I+                    RR       RQ   +EK E   P   +    +  P   ++    Y +P+TYED + A+ +FT+EID   +   T+IG GEFG V +G L +P      VA+K LK GA+EK R DFL EAS MGQF + NV+ LEGV+T S+  MI+TEFM NGSL TFLR    + T +QL+ M+  +A+GM YL+ +G++HRDLAARNIL++E LVCKVADFGLSRE+     D  YT K  GK+P++ T+PEAI Y KF+ +SDVWSFGVV WE++SYGE+PYW WSN +VI A++ GYRLPPP++CP  +H LML CW      RP   H+   ++++
Sbjct:   62 CYLKTSRVDNWVRTPFVERGDAKTLHIDIRFSMRKCSRITDPANLQQCKETFNLYYYEADSDFANEMMPTWDSSTYTVIDKVAADFLYE--DTKDFRINTESRSVTLRGLRGVYFAFQDEGSCVTLTSIRVYYITCPDITLNFAFFKEVPAGSDHGVEEYEGVCVPNSVEKTPP----TYLCQTSGLWYRDSKGE-CVCMPGYQGNADKTACTSCPQNFYKWSEGTGPCWECPDNSFSNSEGAAQCTCRTGFYRSPQDSKSLPCTRPPSEPRHLIVNAVSSNSVTLDWSPPLDLGGRTDLQ-----YRVVCAECGNDVLYSPGWYGFNTTSVTLTNLKSSSLYHITVYAENGVSN-ISGAF----ASAYVTVNTEASAKV--IGVRRVSVGPSHITIAWELPPS----LVGEVTRFKVR-YFPQQKEASAVTVYTVYRNLTVTEF---ELDTIYFFM-VSAQTSKGWGEFSDPIEVATGQQ-------GQYKLEDEVSTPIGIVAGSIVAVLLCMAIATIMIIILL------------------RRN------RQNC-SEKKECDPPYSHVTMPLFPSPGSVHSSVRTYIDPHTYEDPNQAVREFTREIDACHIIIETVIGGGEFGDVCKGKLRIPGRPEMTVAIKTLKPGATEKNRLDFLTEASIMGQFDDPNVIFLEGVVTKSNPIMIVTEFMANGSLDTFLRANDGKFTVMQLVGMMRGIASGMSYLAEMGYVHRDLAARNILVNEMLVCKVADFGLSREIESDTTDGAYTTK-GGKIPVRWTSPEAIAYRKFTSSSDVWSFGVVMWEIMSYGERPYWNWSNQDVIKAVEKGYRLPPPMDCPEALHQLMLDCWQKERSHRPKMLHVVKTLDKL 876          
BLAST of Ephrin type-A receptor 4-B vs. TrEMBL
Match: A0A1S3I266 (ephrin type-B receptor 1-B isoform X5 OS=Lingula unguis OX=7574 GN=LOC106159654 PE=3 SV=1)

HSP 1 Score: 514.227 bits (1323), Expect = 9.830e-160
Identity = 318/939 (33.87%), Postives = 509/939 (54.21%), Query Frame = 3
Query:  198 LFYCEKVLLLNTSI-SGWNNWK--KNTKTYEGWRIQ--NLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDS-----PIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFE-SYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS--FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSSKTKETKVIVLGSL-PSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKT----FIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            L Y  +V+LL+T+I  G  N+K  +   +  GWR    N   N   VY  C+++H   ++WLR P+I R     L++++ FTMR+C  +  P+ +  C+ET  L  YE+ S      +      + ++ ++ +I+++ K+   + ++  +N+   S+ V + GV  AF + G+C  +  + VYY+ C     NF +F  TA G + S   +  G CV+  VR  N        C+++G W     +  C C +G + N   T C+ C +  YK   G + C  CP N+ +   T +  C CN GYY +P+      C +PP+ P N+ +   DQ  + + W +P         + +I+Y++          +C+ C + + ++P     +   + L SL PS  Y   V S+N +S  VT   D + ++  +  +      ++ +++  +  N+  I+++W++P    +  +YE        YF   + FNA S+    TT +    I  +     +  +VR + ++GWG+++           L + + T+  +T  V T + S   D K     F+     D ++      ++V+++++ +++V Y  R     N  + K   ++   ++ T  +++     P    T Y +P+TYED   A+ +FTKEID  ++T  ++IG GEFG V +G L VP      VA+K LK GAS+K R DFL EAS MGQF + NV+ LEGV+T S+  MIITEFM NG+L  FLR    + T IQL+ ML  +A+GM+YLS +G++HRDLAARNIL+++NLVCKVADFGLSRE+     D  YT +  GK+P++ TAPEAI + KF+ ASDVWS+GVV WEV+SYGE+PYW WSN +VI A+  GYRLPPP++CP   H LML CW    ++RP F  +   ++++
Sbjct:   35 LTYAIRVVLLDTTIVDGALNYKTHRGGVSGYGWREGSFNDGENVRRVYMACDIEHSEVSNWLRLPYIPRGDANRLYVEIEFTMRDCSTHRKPEEVFQCKETIALYYYEAMSDFATDTLPRWQAEQGSYQMVDSIAADYKF--TNLSDYQINLKYRSVPVSKNGVYFAFLDEGACTSLLSINVYYITCPAVRKNFAFFNTTATGRDVSSVVSKEGVCVDNAVRVGNGPAP-AYLCKSDGTWVWPTGQ--CYCKAGYQPNVDNTECLACPSGTYKATIGGDTCHSCPANSNADGKTRATICDCNPGYYRLPHANASQPCIEPPEAPSNLEIQFKDQTTLRVAWMAP-----DGGNAAHITYHVQCLKCNSQRGQCVECDSTVRYVPIQTGIQQTTVTLHSLNPSTNYKINVYSMNGISIPVT---DFNHATIIVKTMDAIASKVDNVRV--VSKNQTAILVAWDRPVEQHE--QYEV------KYFPTDNPFNALSV----TTTSLRVIIGSLQASTQYSFQVRGKVFEGWGEWT-----------LPVSVFTEAFITREVPTTTVSLAKDDKQTSPGFV---NTDGIIAGAAVAVIVSLIIVAVMVVIYLKRNNQPCNE-KNKSDCDQLHYSNVTMPLFA-----PPGVRT-YVDPHTYEDPQQAVREFTKEIDASFITIESVIGGGEFGDVCKGKLRVPGKMELSVAIKTLKPGASDKSRMDFLTEASIMGQFDDPNVIYLEGVVTKSNPIMIITEFMENGALDQFLRTNDGKFTIIQLVGMLRGIASGMRYLSEMGYVHRDLAARNILVNDNLVCKVADFGLSREIESDTTDGAYTTR-GGKIPVRWTAPEAISFRKFTSASDVWSYGVVAWEVMSYGERPYWNWSNQDVIKAVDKGYRLPPPMDCPEATHVLMLDCWQKERNQRPKFAQLVKTLDKL 924          
BLAST of Ephrin type-A receptor 4-B vs. TrEMBL
Match: A0A1S3HZJ6 (ephrin type-B receptor 1-B isoform X4 OS=Lingula unguis OX=7574 GN=LOC106159654 PE=3 SV=1)

HSP 1 Score: 513.072 bits (1320), Expect = 2.863e-159
Identity = 317/939 (33.76%), Postives = 507/939 (53.99%), Query Frame = 3
Query:  198 LFYCEKVLLLNTSI-SGWNNWK--KNTKTYEGWRIQ--NLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDS-----PIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFE-SYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS--FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSSKTKETKVIVLGSL-PSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKT----FIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            L Y  +V+LL+T+I  G  N+K  +   +  GWR    N   N   VY  C+++H   ++WLR P+I R     L++++ FTMR+C  +  P+ +  C+ET  L  YE+ S      +      + ++ ++ +I+++ K+   + ++  +N+   S+ V + GV  AF + G+C  +  + VYY+ C     NF +F  TA G + S   +  G CV+  VR  N        C+++G W     +  C C +G + N   T C+ C +  YK   G + C  CP N+ +   T +  C CN GYY +P+      C +PP+ P N+ +   DQ  + + W +P         + +I+Y++          +C+ C + + ++P     +   + L SL PS  Y   V S+N +S  VT   D + ++  +  +      ++ +++  +  N+  I+++W++P    +  +YE        YF   + FNA S+    TT +    I  +     +  +VR + ++GWG+++           L + + T+  +T  V T + S   D K     F+     D ++      ++V+++++ +++V Y  R     N   +K K++  +       +    ++ P      Y +P+TYED   A+ +FTKEID  ++T  ++IG GEFG V +G L VP      VA+K LK GAS+K R DFL EAS MGQF + NV+ LEGV+T S+  MIITEFM NG+L  FLR    + T IQL+ ML  +A+GM+YLS +G++HRDLAARNIL+++NLVCKVADFGLSRE+     D  YT +  GK+P++ TAPEAI + KF+ ASDVWS+GVV WEV+SYGE+PYW WSN +VI A+  GYRLPPP++CP   H LML CW    ++RP F  +   ++++
Sbjct:   35 LTYAIRVVLLDTTIVDGALNYKTHRGGVSGYGWREGSFNDGENVRRVYMACDIEHSEVSNWLRLPYIPRGDANRLYVEIEFTMRDCSTHRKPEEVFQCKETIALYYYEAMSDFATDTLPRWQAEQGSYQMVDSIAADYKF--TNLSDYQINLKYRSVPVSKNGVYFAFLDEGACTSLLSINVYYITCPAVRKNFAFFNTTATGRDVSSVVSKEGVCVDNAVRVGNGPAP-AYLCKSDGTWVWPTGQ--CYCKAGYQPNVDNTECLACPSGTYKATIGGDTCHSCPANSNADGKTRATICDCNPGYYRLPHANASQPCIEPPEAPSNLEIQFKDQTTLRVAWMAP-----DGGNAAHITYHVQCLKCNSQRGQCVECDSTVRYVPIQTGIQQTTVTLHSLNPSTNYKINVYSMNGISIPVT---DFNHATIIVKTMDAIASKVDNVRV--VSKNQTAILVAWDRPVEQHE--QYEV------KYFPTDNPFNALSV----TTTSLRVIIGSLQASTQYSFQVRGKVFEGWGEWT-----------LPVSVFTEAFITREVPTTTVSLAKDDKQTSPGFV---NTDGIIAGAAVAVIVSLIIVAVMVVIYLKRNNQPCN---EKNKSDCDQLHYSNGEVTMPLFAPPG--VRTYVDPHTYEDPQQAVREFTKEIDASFITIESVIGGGEFGDVCKGKLRVPGKMELSVAIKTLKPGASDKSRMDFLTEASIMGQFDDPNVIYLEGVVTKSNPIMIITEFMENGALDQFLRTNDGKFTIIQLVGMLRGIASGMRYLSEMGYVHRDLAARNILVNDNLVCKVADFGLSREIESDTTDGAYTTR-GGKIPVRWTAPEAISFRKFTSASDVWSYGVVAWEVMSYGERPYWNWSNQDVIKAVDKGYRLPPPMDCPEATHVLMLDCWQKERNQRPKFAQLVKTLDKL 926          
BLAST of Ephrin type-A receptor 4-B vs. TrEMBL
Match: A0A1S3HZJ3 (ephrin type-B receptor 1-B isoform X1 OS=Lingula unguis OX=7574 GN=LOC106159654 PE=3 SV=1)

HSP 1 Score: 511.916 bits (1317), Expect = 1.087e-158
Identity = 318/950 (33.47%), Postives = 507/950 (53.37%), Query Frame = 3
Query:  198 LFYCEKVLLLNTSI-SGWNNWK--KNTKTYEGWRIQ--NLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDS-----PIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFE-SYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS--FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSSKTKETKVIVLGSL-PSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKT----FIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQK------FKNEKFEATSPTQIIYSSAYSLPNQTYT-----KYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            L Y  +V+LL+T+I  G  N+K  +   +  GWR    N   N   VY  C+++H   ++WLR P+I R     L++++ FTMR+C  +  P+ +  C+ET  L  YE+ S      +      + ++ ++ +I+++ K+   + ++  +N+   S+ V + GV  AF + G+C  +  + VYY+ C     NF +F  TA G + S   +  G CV+  VR  N        C+++G W     +  C C +G + N   T C+ C +  YK   G + C  CP N+ +   T +  C CN GYY +P+      C +PP+ P N+ +   DQ  + + W +P         + +I+Y++          +C+ C + + ++P     +   + L SL PS  Y   V S+N +S  VT   D + ++  +  +      ++ +++  +  N+  I+++W++P    +  +YE        YF   + FNA S+    TT +    I  +     +  +VR + ++GWG+++           L + + T+  +T  V T + S   D K     F+     D ++      ++V+++++ +++V Y  R     N   +       + N + +   P  +      SL    +       Y +P+TYED   A+ +FTKEID  ++T  ++IG GEFG V +G L VP      VA+K LK GAS+K R DFL EAS MGQF + NV+ LEGV+T S+  MIITEFM NG+L  FLR    + T IQL+ ML  +A+GM+YLS +G++HRDLAARNIL+++NLVCKVADFGLSRE+     D  YT +  GK+P++ TAPEAI + KF+ ASDVWS+GVV WEV+SYGE+PYW WSN +VI A+  GYRLPPP++CP   H LML CW    ++RP F  +   ++++
Sbjct:   35 LTYAIRVVLLDTTIVDGALNYKTHRGGVSGYGWREGSFNDGENVRRVYMACDIEHSEVSNWLRLPYIPRGDANRLYVEIEFTMRDCSTHRKPEEVFQCKETIALYYYEAMSDFATDTLPRWQAEQGSYQMVDSIAADYKF--TNLSDYQINLKYRSVPVSKNGVYFAFLDEGACTSLLSINVYYITCPAVRKNFAFFNTTATGRDVSSVVSKEGVCVDNAVRVGNGPAP-AYLCKSDGTWVWPTGQ--CYCKAGYQPNVDNTECLACPSGTYKATIGGDTCHSCPANSNADGKTRATICDCNPGYYRLPHANASQPCIEPPEAPSNLEIQFKDQTTLRVAWMAP-----DGGNAAHITYHVQCLKCNSQRGQCVECDSTVRYVPIQTGIQQTTVTLHSLNPSTNYKINVYSMNGISIPVT---DFNHATIIVKTMDAIASKVDNVRV--VSKNQTAILVAWDRPVEQHE--QYEV------KYFPTDNPFNALSV----TTTSLRVIIGSLQASTQYSFQVRGKVFEGWGEWT-----------LPVSVFTEAFITREVPTTTVSLAKDDKQTSPGFV---NTDGIIAGAAVAVIVSLIIVAVMVVIYLKRNNQPCNEKNKSDCDQLHYSNGEVQYPPPVIVDTHMNGSLTMPLFAPPGVRTYVDPHTYEDPQQAVREFTKEIDASFITIESVIGGGEFGDVCKGKLRVPGKMELSVAIKTLKPGASDKSRMDFLTEASIMGQFDDPNVIYLEGVVTKSNPIMIITEFMENGALDQFLRTNDGKFTIIQLVGMLRGIASGMRYLSEMGYVHRDLAARNILVNDNLVCKVADFGLSREIESDTTDGAYTTR-GGKIPVRWTAPEAISFRKFTSASDVWSYGVVAWEVMSYGERPYWNWSNQDVIKAVDKGYRLPPPMDCPEATHVLMLDCWQKERNQRPKFAQLVKTLDKL 942          
BLAST of Ephrin type-A receptor 4-B vs. TrEMBL
Match: A0A1S3I0T4 (ephrin type-B receptor 1-B isoform X2 OS=Lingula unguis OX=7574 GN=LOC106159654 PE=3 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 1.604e-158
Identity = 316/948 (33.33%), Postives = 507/948 (53.48%), Query Frame = 3
Query:  198 LFYCEKVLLLNTSI-SGWNNWK--KNTKTYEGWRIQ--NLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDS-----PIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFE-SYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS--FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSSKTKETKVIVLGSL-PSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKT----FIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQK------FKNEKFEATSPTQIIYSSAYSLP---NQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            L Y  +V+LL+T+I  G  N+K  +   +  GWR    N   N   VY  C+++H   ++WLR P+I R     L++++ FTMR+C  +  P+ +  C+ET  L  YE+ S      +      + ++ ++ +I+++ K+   + ++  +N+   S+ V + GV  AF + G+C  +  + VYY+ C     NF +F  TA G + S   +  G CV+  VR  N        C+++G W     +  C C +G + N   T C+ C +  YK   G + C  CP N+ +   T +  C CN GYY +P+      C +PP+ P N+ +   DQ  + + W +P         + +I+Y++          +C+ C + + ++P     +   + L SL PS  Y   V S+N +S  VT   D + ++  +  +      ++ +++  +  N+  I+++W++P    +  +YE        YF   + FNA S+    TT +    I  +     +  +VR + ++GWG+++           L + + T+  +T  V T + S   D K     F+     D ++      ++V+++++ +++V Y  R     N   +       + N ++          + + ++P         Y +P+TYED   A+ +FTKEID  ++T  ++IG GEFG V +G L VP      VA+K LK GAS+K R DFL EAS MGQF + NV+ LEGV+T S+  MIITEFM NG+L  FLR    + T IQL+ ML  +A+GM+YLS +G++HRDLAARNIL+++NLVCKVADFGLSRE+     D  YT +  GK+P++ TAPEAI + KF+ ASDVWS+GVV WEV+SYGE+PYW WSN +VI A+  GYRLPPP++CP   H LML CW    ++RP F  +   ++++
Sbjct:   35 LTYAIRVVLLDTTIVDGALNYKTHRGGVSGYGWREGSFNDGENVRRVYMACDIEHSEVSNWLRLPYIPRGDANRLYVEIEFTMRDCSTHRKPEEVFQCKETIALYYYEAMSDFATDTLPRWQAEQGSYQMVDSIAADYKF--TNLSDYQINLKYRSVPVSKNGVYFAFLDEGACTSLLSINVYYITCPAVRKNFAFFNTTATGRDVSSVVSKEGVCVDNAVRVGNGPAP-AYLCKSDGTWVWPTGQ--CYCKAGYQPNVDNTECLACPSGTYKATIGGDTCHSCPANSNADGKTRATICDCNPGYYRLPHANASQPCIEPPEAPSNLEIQFKDQTTLRVAWMAP-----DGGNAAHITYHVQCLKCNSQRGQCVECDSTVRYVPIQTGIQQTTVTLHSLNPSTNYKINVYSMNGISIPVT---DFNHATIIVKTMDAIASKVDNVRV--VSKNQTAILVAWDRPVEQHE--QYEV------KYFPTDNPFNALSV----TTTSLRVIIGSLQASTQYSFQVRGKVFEGWGEWT-----------LPVSVFTEAFITREVPTTTVSLAKDDKQTSPGFV---NTDGIIAGAAVAVIVSLIIVAVMVVIYLKRNNQPCNEKNKSDCDQLHYSNVQYPPPVIVDTHMNGSLTMPLFAPPGVRTYVDPHTYEDPQQAVREFTKEIDASFITIESVIGGGEFGDVCKGKLRVPGKMELSVAIKTLKPGASDKSRMDFLTEASIMGQFDDPNVIYLEGVVTKSNPIMIITEFMENGALDQFLRTNDGKFTIIQLVGMLRGIASGMRYLSEMGYVHRDLAARNILVNDNLVCKVADFGLSREIESDTTDGAYTTR-GGKIPVRWTAPEAISFRKFTSASDVWSYGVVAWEVMSYGERPYWNWSNQDVIKAVDKGYRLPPPMDCPEATHVLMLDCWQKERNQRPKFAQLVKTLDKL 940          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Cavefish
Match: ephb2a (EPH receptor B2 [Source:NCBI gene;Acc:103031596])

HSP 1 Score: 469.929 bits (1208), Expect = 7.840e-147
Identity = 318/957 (33.23%), Postives = 479/957 (50.05%), Query Frame = 3
Query:  162 IISWLWIMDLINLFYCEKVLLLNTSISGWNNWKKNTKTYEGWR-IQNLPPNADEV--YGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIENIHY---NERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNI-----SYYLIECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVS-------QYVTNPFDMDQSS-SKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRR--QMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            II  LWI+  I  +  E VL+ +T+ +    W        GW  +     N + +  Y VC V   S N+W+R+ +I R     +H+++ F++R+C + P+ P S   C+ETF L  +E+DS      Y    E  +  + TI+++  +   D    ++ I     S   V R G  +AFQ+ G+C+ +  V VYY  C   + N   FP T +G ES +     G C+  G      D  I  YC  +G W     +  C C +G E  ++ T C  C + F+K  QG ++C+ CP N+ +   G+ +C+C  GYY   +   ++ C   P  P+ ++  S ++  + L W+ P      E V  NI           C  C + + F+P      E +V +   L   +Y F++ +VN VS       Q+       +Q++ S +S++ +    I+             I LSW+QP  P  ++    + +  + Y KN    N+     V  + T+ + +  +     +V +VR R   G+G+FS     +T +     + L+ K+P  I        A F                              L+ +I+LV  C RR      + Y  K ++      SP   IY   ++        Y++PN       A+ +F KEID   +    +IG GEFG V  G L +P     +VA+K LK G +EK+R DFL EAS MGQF + N++ LEGV+T S   MIITEFM NGSL +FLR    + T IQL+ ML  +A GMKYL  + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+PI+ TAPEAI Y KF+ +SDVWS+G+V WEV+SYGE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   19 IIRLLWIVAPI--WAVEDVLMDSTTATAELGWTIYPSL--GWEEVSGYDENMNTIRTYQVCNVFDSSQNNWVRTKYIRRRGAQRIHVEMKFSVRDCSSIPNVPGS---CKETFNLYYFEADSDTATKVYPAWMENPWIKVDTIAADESFSQVDLGGRVMKINREVRSFGPVSRNGFYLAFQDYGACMSLIAVRVYYRKCPRVVRNGAVFPETLSGAESTSLVAARGTCIPNG---EEVDVPIKLYCNGDGEWLVPIGR--CMCKAGHEAAENGTICRACPSGFFKPSQGDQQCLQCPMNSRTTNEGATNCVCRNGYYRTDSDPVQMPCTTMPSAPQRVI-SSVNETSLRLVWSPPRESGGREDVVYNIICKSCGSGRGACTRCGDNVQFVPRQLGLTEPQVHISDLLAHTQYTFEIQAVNGVSDQSPYSPQFAAVNITTNQAAPSVVSIMHQVSRAIDS------------ITLSWSQPDQPNGVI----LDYELQYYEKNLAELNSS----VLRSQTNTAVVRGLKSGTIYVFQVRARTVAGFGRFSGKMYFQTMTEEEYNSSLQEKLPLIIG----SAAAGF----------------------------VFLVAVIVLVIVCNRRGSDRTDSEYTDKLQHYTSGHMSPGMKIYIDPFT--------YEDPNE------AVREFAKEIDMSCVKIEQVIGAGEFGEVCSGNLRLPGKREILVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNIIHLEGVVTKSSPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLCDMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSSSDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCPNALHQLMLDCWQKDRNNRPKFSQIVNTLDKM 896          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Cavefish
Match: ephb1 (ephrin type-B receptor 1 [Source:NCBI gene;Acc:103025121])

HSP 1 Score: 466.077 bits (1198), Expect = 2.220e-145
Identity = 304/899 (33.82%), Postives = 455/899 (50.61%), Query Frame = 3
Query:  309 NADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIEN---IHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL---GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLIE-----CINCPNKLVFLPSSKTKETKVIVLGSLPSRE-YDFKVSSVNDV---SQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTK-YQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            N    Y VC V   S N+WL + FI R     +++++ FT+R+C + P  P S   C+ETF L  YESD  I       + E  +  + TI+++  +   D    ++ +     S   L   G  +AFQ+ G+C+ +  V V+Y  C   + NF  FP T  G ES +  +  G C+         D  I  YC  +G W        C C +G E  D+   C  C    +K  QG+E C+ CP N+ S +  S  C+C  GYY          C   P  PRN++    ++  +IL W+ P      E V  NI           C +C + + F+P         +V+ +L +   Y F++ +VN V   S Y      +D ++++ +    P+       +  + +    I LSW QP  P  I+    + +  R Y K  DL  A+S      TNT+    +L T  +Y V +VR R   G+G++S     +T +    K+EL+ ++P        +  ++ + +  I + +      + ++           +    L  Y    ++     R    N       PT         LP     K Y +P TYED + A+ +F KEID   +    +IG GEFG VY+G L +P      VA+K LK G SEK+R DFL EAS MGQF + N+++LEGV+T S   MI+TEFM NG+L +FLR    + T IQL+ M+  +A GMKYLS + ++HRDLAARNIL++ NLVCKV+DFGLSR L +  +D  YT+   GK+P++ T+PEAI + KF+ ASDVWS+G+V WEV+S+GE+PYW  SN +VI+AI+  YRLP P++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   54 NTIRTYQVCNVFESSQNNWLLTTFIQRRAAQRVYVEMRFTVRDCSSIPRVPGS---CKETFNLYYYESDQVIATKGTAFWMEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLSKNGFYLAFQDYGACMSLLSVRVFYKKCPSVVQNFAVFPETMTGAESTSLVIARGMCIPN---SEEVDVPIKLYCNGDGEWMVPIGS--CTCKAGFE-PDNGNICRACPPGTFKSSQGTELCLQCPPNSRSTSEASTICVCRNGYYRADGDLPDTPCTSVPSGPRNVI-SIVNETSVILEWHPPRETGGREDVVYNIVCKKCRADRRSCSHCDDNVDFVPRQLGLTDNRVVISNLWAHTLYTFEIQAVNGVTNKSPYPAQHVSIDITTNQAAPSMVPI-------MHQVSSTMRSITLSWPQPEQPNGII----LDYELRYYEK--DLTEANSTILRSQTNTA-RVDSLRTGTMY-VVQVRARTVAGFGKYSSKMCFQTLTDEDYKSELREQLP-------LIAGSAAAAVVFIVSLVA-----ISIVCSRKRAYSKEAVYSDKLQHYSTGTELSL---RPDLSNCHSSMGCPT---------LPGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSTVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLAEASIMGQFDHPNIIRLEGVVTKSRPVMIVTEFMENGALDSFLRQNDGQFTVIQLVGMMRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQEDTSDPTYTSSLGGKIPVRWTSPEAIAFRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPAPMDCPTALHQLMLDCWQKDRNARPRFTDIVNTLDKL 903          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Cavefish
Match: ephb1 (ephrin type-B receptor 1 [Source:NCBI gene;Acc:103025121])

HSP 1 Score: 465.307 bits (1196), Expect = 2.267e-145
Identity = 304/894 (34.00%), Postives = 449/894 (50.22%), Query Frame = 3
Query:  309 NADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIEN---IHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL---GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLIE-----CINCPNKLVFLPSSKTKETKVIVLGSLPSRE-YDFKVSSVNDV---SQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTK-YQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            N    Y VC V   S N+WL + FI R     +++++ FT+R+C + P  P S   C+ETF L  YESD  I       + E  +  + TI+++  +   D    ++ +     S   L   G  +AFQ+ G+C+ +  V V+Y  C   + NF  FP T  G ES +  +  G C+         D  I  YC  +G W        C C +G E  D+   C  C    +K  QG+E C+ CP N+ S +  S  C+C  GYY          C   P  PRN++    ++  +IL W+ P      E V  NI           C +C + + F+P         +V+ +L +   Y F++ +VN V   S Y      +D ++++ +    P+       +  + +    I LSW QP  P  I+    + +  R Y K  DL  A+S      TNT+    +L T  +Y V +VR R   G+G++S                          +   F T+TD KT+     + + ++   +   V  ++ ++ +   C          R    N       PT         LP     K Y +P TYED + A+ +F KEID   +    +IG GEFG VY+G L +P      VA+K LK G SEK+R DFL EAS MGQF + N+++LEGV+T S   MI+TEFM NG+L +FLR    + T IQL+ M+  +A GMKYLS + ++HRDLAARNIL++ NLVCKV+DFGLSR L +  +D  YT+   GK+P++ T+PEAI + KF+ ASDVWS+G+V WEV+S+GE+PYW  SN +VI+AI+  YRLP P++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   44 NTIRTYQVCNVFESSQNNWLLTTFIQRRAAQRVYVEMRFTVRDCSSIPRVPGS---CKETFNLYYYESDQVIATKGTAFWMEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLSKNGFYLAFQDYGACMSLLSVRVFYKKCPSVVQNFAVFPETMTGAESTSLVIARGMCIPN---SEEVDVPIKLYCNGDGEWMVP--IGSCTCKAGFE-PDNGNICRACPPGTFKSSQGTELCLQCPPNSRSTSEASTICVCRNGYYRADGDLPDTPCTSVPSGPRNVI-SIVNETSVILEWHPPRETGGREDVVYNIVCKKCRADRRSCSHCDDNVDFVPRQLGLTDNRVVISNLWAHTLYTFEIQAVNGVTNKSPYPAQHVSIDITTNQAAPSMVPI-------MHQVSSTMRSITLSWPQPEQPNGII----LDYELRYYEK--DLTEANSTILRSQTNTA-RVDSLRTGTMY-VVQVRARTVAGFGKYS--------------------------SKMCFQTLTDGKTYRSELREQLPLIAGSAAAAVVFIVSLVAISIVCKLS------LRPDLSNCHSSMGCPT---------LPGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSTVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLAEASIMGQFDHPNIIRLEGVVTKSRPVMIVTEFMENGALDSFLRQNDGQFTVIQLVGMMRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQEDTSDPTYTSSLGGKIPVRWTSPEAIAFRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPAPMDCPTALHQLMLDCWQKDRNARPRFTDIVNTLDKL 871          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Cavefish
Match: ENSAMXT00000021869.2 (EPH receptor A5 [Source:NCBI gene;Acc:103045667])

HSP 1 Score: 459.914 bits (1182), Expect = 3.510e-143
Identity = 306/946 (32.35%), Postives = 473/946 (50.00%), Query Frame = 3
Query:  159 WIISWLWIMDLINL----FYCEKVLLLNTSIS----GWNNWKKNTKTYEGWRIQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYES-DSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL---GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLIECIN-----CPNKLVFLPS-SKTKETKVIVLGSLPSREYDFKVSSVNDVS-------QYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            W+  W+ ++ L  L        +V LL++       GW  + KN     G   +N  P     Y VC+V   + N+WL++ +I  +    + +++ FT+R+C + P    L  C+ETF +  YES D    N+H  E  +  I TI+++  +   D  + ++ +      V  L   G  +AFQ+ G+C+ +  V V+Y  C   + N   FP T  G +S     V G CV   +    +DE    +C A G W     +  C C +G E  +   SC  C   FY+    +  C  CP ++++ T  S +C C QGYY        + C KPP  PRN +  + ++  + L W++P      + V+ +I    I         C + + +LP  S  + + V+V+  L    Y F+V +VN VS       QYVT     +Q++        P+  ++K K     T K+ I +SW +P  P  I+ EYE        YF+     + ++ + +  +  +    + +     ++ ++R R   G+G FS              +   ++ +     T     +  +  F+++                               R+  ++  +Q  + EK          ++     P      Y +P+TYED + A+H+F KEID   +T   +IG GEFG V  G L +P     +VA+K LK G +EK+R DFL EAS MGQF + N++ LEGV+T S   MIITE+M NGSL TFL+    + T IQL+ ML  +A+GM+YLS +G++HRDLAARNIL++ NLVCKV+DFGLSR L D D +  YT +  GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW+ SN +VI A++  YRLP P++CP  +++LM+ CW  + + RP F  I
Sbjct:    9 WVKVWILVLSLAALETRSIPSNEVNLLDSRSVMGDLGWIAYPKNGWEEIGEVDENYAP--IHTYQVCKVMEHNQNNWLQTNWILNEGAQRVFVELKFTLRDCNSLPG--GLGTCKETFNVYYYESNDEDGRNVH--ESQYTKIDTIAADESFTELDLGDRVMKLNTEVRDVGPLTKKGFYLAFQDLGACIALVSVRVFYKKCPFVVRNLALFPDTITGSDSSQLLEVSGTCVNNSL----ADELPRMHCSAEGEWLVPIGR--CMCQAGHE--EVNGSCQVCKPGFYRSALQTRTCSKCPPHSFTKTEASTACQCEQGYYRKDTDPTNMACTKPPSAPRNAI-SNVNETSVFLEWSAPEETGGRKDVTYSILCRKISADEGHYEPCGSHVRYLPQRSGLRNSSVMVVDLLAHTNYTFEVEAVNGVSELTKPLRQYVTLNVTTNQAAPS------PITVVKKGK-----TAKNSIAVSWQEPDRPNGIILEYEI------KYFEK----DQETSYTIIKSKETEVVADGLKPSSAYIFQIRARTSAGYGGFSRRFEFETSPYLSASRDQGQVPVIAVAVTVGIILLALVTGFLLSG------------------------------RRCGYSKAKQDPEEEKMH-------FHNGHIKFPG--VRTYIDPHTYEDPNQAVHEFAKEIDVSCITIERVIGAGEFGEVCSGPLRLPGKREIMVAIKTLKAGYTEKQRRDFLGEASIMGQFDHPNIIHLEGVVTKSKPVMIITEYMENGSLDTFLKKNDGQFTVIQLVGMLRGIASGMRYLSDMGYVHRDLAARNILVNSNLVCKVSDFGLSRVLED-DPEAAYTTR-GGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWEMSNQDVIKAVEESYRLPGPMDCPTALYHLMMDCWQKDRNSRPKFEEI 877          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Cavefish
Match: epha7 (EPH receptor A7 [Source:NCBI gene;Acc:103040681])

HSP 1 Score: 454.521 bits (1168), Expect = 4.271e-141
Identity = 295/899 (32.81%), Postives = 456/899 (50.72%), Query Frame = 3
Query:  282 GWR-IQNLPPNADEV--YGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNI-YETSI--SVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFE-SYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYS-FTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPS-SKTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSS---SKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            GW  I  L  N   +  Y VC+V  P+ N+WLR+ +I +     + I++ FT+R+C + P    +  C+ETF L   E+D  +   +  E  +  I TI+++  +   D  E  + +  E  I   + R G  +AFQ+ G+C+ +  V VYY  C   + N   FP T  G E S    V G CV     +  +D     +C A G W     K +C+ G   +G+    +C  C   FYK      +C  CP ++Y+   GS  C C  GYY   +    + C +PP  P+N++ +  +Q  + L W  P    +     ++++Y +I         EC+ C   + + P  S   +T+V +   L    Y F+V +VN VS       D+ ++    + +S+ T      +  ++   +  +H + LSW +P  P  ++ EYE      + Y K+      D I+    + ++ + +N +     +V ++R     G+G F             +L++ T+   +   T             I++ E++ V++I    +   ++L+ ++      RR   ++   Q+   E +             +  P      Y +P TYED + A+H F KE+D   +    +IG GEFG V  G L +P      VA+K LK G ++K+R DFL EAS MGQF + NV+ LEGV+T     MI+ E+M NGSL  FLR    + T IQL+ ML  +A GM+YLS +G++HRDLAARN+L++ NLVCKV+DFGLSR + D D + +YT    GK+P++ TA EAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN +VI AI+ GYRLP P++CPP +H LML CW  +   RP F  I
Sbjct:   53 GWEEISGLDENFTPIRTYQVCQVMEPNQNNWLRTNWIEKGDAQRIFIELKFTLRDCNSLPG--VVGTCKETFNLYYQETDVEVGR-NIRESQYVKIDTIAADESFTQGDLGERKMKLNTEVRIIGPLSRRGFYLAFQDVGACIALVSVKVYYKKCWSIIENLATFPDTVTGSEFSSLVEVEGVCVSDA--EEEADNSPKMHCSAEGEWLVPIGKCICKAGFHQKGD----ACEPCGRGFYKSSSQDLQCSRCPAHSYNDREGSWRCDCEDGYYRALSDPPSIACTRPPSAPQNLVYNI-NQTTVTLEWRPP----ADTGGRNDVTYRIICRRCSWEPEECVPCGGNVAYTPQQSGLTDTEVTISELLAHANYTFEVEAVNGVS-------DLSRTQRLFAAVSIATSQAAPSQVSEVIKERVQEHSVQLSWQEPEQPNGVITEYE-----IKYYEKD----QKDRIYSTVKSKSTSATVNNLKPSTAYVFQIRAFTAAGYGMFGP-----------RLEVTTREESSGAAT-------------IVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELY-----------FQFKFPGTK--TYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVPVAIKTLKVGYTDKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEYMENGSLDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLSDMGYVHRDLAARNVLVNSNLVCKVSDFGLSRVIDD-DPEAVYTTT-GGKIPVRWTATEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPPGLHQLMLDCWQKDRADRPKFDQI 882          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010247.1 (pep scaffold:Pmarinus_7.0:GL476398:264473:324965:1 gene:ENSPMAG00000009246.1 transcript:ENSPMAT00000010247.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 479.174 bits (1232), Expect = 3.854e-151
Identity = 312/940 (33.19%), Postives = 475/940 (50.53%), Query Frame = 3
Query:  195 NLFYCEKVLLLN----TSISGWNNWKKNTKTYEGWRIQNLPPNAD---EVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL------GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSSKTKETKVIVLGSLPSR-EYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNT-SCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            N+   EK   LN    T++ G   WK    T  GW    +  N     + + VC +   + N+WLR+ +I+RD    +++++ FT+R+C +     S   C+ETF L  YE+DS  E    ++  FA +GTI+S+  +   D+T+ I  + + +  VR L      G  +AFQ+ G+CV +  V VYY  C   +     FP T  G +S     V G CV   V   + D ++  +C  +G W     + VC  G    G++    C +C   ++K+L G E C PCP ++Y+ +  S  C+C   +Y          C +PP   RN++  S ++  +IL W+ P   + S    D +SY L+          C  C + + FLP  +      + +  L +   Y F++ ++N VS+    P      +  +SL T      +   L + +  K  + LSW  P  P  ++ +YE          K  ++   D+ +++  T   S S   L  DL+Y   +VR R   G+G+ S+   I   ++   +  P  +     + +  F  +  I   ++                              +RR+   N+  +  + E+F    P ++          +T   Y +P TYED + A+ DF +EI+P W+    +IG GE G V +G L VP      VA+K LK G SEK+R DFL EAS MGQF + ++++LEGV+T S   MIITE+M NGSL  FLR    + +  QL+ ML  +A GMKYLS + +IHRDLAARN+L++  LVCKV+DFGLSR L D D   +YT    GK+PI+ TAPEAI + KF+ ASDVWSFGV+ WEV+SYGE+PYW  +N +VI +I+ GYRLP P++CPP +H LML CW     +RP F  I   ++++
Sbjct:   22 NILQAEKSRELNLMDTTTVMGELGWKSTPST--GWEELTIMLNQTTPVQTFQVCNMGS-NQNNWLRTRWIARDPAQRVYVEIKFTLRDCGSMAGVAST--CKETFNLYYYEADSGAE---IDDGKFAKVGTIASDMIF---DKTDVIDRVLKLNTEVRELPPLSWPGFYLAFQDVGACVALVSVRVYYKKCPAVVRELASFPDTVTGTDSSPLVEVRGSCVPNAV--ASGDPRM--HCSTDGEWLVPIGQCVCRPGYEAAGHE----CRECGTGYFKVLAGEENCTPCPNHSYTTSETSTECVCESDFYRAEGDGPASPCTRPPSAARNVI-SSVNETSVILEWSPP---QDSGGRGD-VSYRLVCQTCGGGRSPCAPCGDSVRFLPRREGLAVPGVTIAHLLAHTNYTFRIEALNGVSRLSPAP----PKAVSVSLTTNQAAPSKIDSLNADRPTKDTVQLSWPAPVKPNGVILDYE---------VKYYEVGQRDTSYNILHTKVPSASIEGLRPDLVYGF-EVRARTAAGYGKPSDPVEIDTSEDGF-VTHPGALTQVLVIASCVFVAVVLIVLALVY-----------------------------VRRRRSRNIAARGDEEEQF-PIKPNEVHL--------RTKRNYVDPFTYEDPNKAVQDFAREIEPSWIIIEKVIGSGESGDVCRGRLRVPGQAEAPVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPSIIRLEGVVTKSKPVMIITEYMENGSLDGFLRGNDGQFSVGQLVGMLRGIAAGMKYLSDMNYIHRDLAARNVLVNSKLVCKVSDFGLSRGLED-DPQAVYTTH-GGKIPIRWTAPEAIAFRKFTSASDVWSFGVLMWEVMSYGERPYWDMNNQDVIQSIEEGYRLPEPMDCPPALHQLMLDCWQKERTERPNFAQILAYLDKL 882          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007292.1 (pep scaffold:Pmarinus_7.0:GL476471:161062:207122:1 gene:ENSPMAG00000006520.1 transcript:ENSPMAT00000007292.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 476.093 bits (1224), Expect = 7.421e-150
Identity = 315/931 (33.83%), Postives = 469/931 (50.38%), Query Frame = 3
Query:  219 LLLNTSISGWNNWKKNTKTYEGWRIQNLPPNAD---EVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL------GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAA-GFESYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSSKTKETKVIVLGSLPSR-EYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSI----QTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            LL  T+I G   W+    T  GW    +  N     + Y VC V  P+ N+WLR+ +I+RD    +++++ FT+R+C +     S   C+ETF L  YE+DS   + + +E  FA +GTI++++ ++  D  + +L +   +  VR L      G  +AFQ+ G+CV +    VYY  C   + +   FP T A    S    V G CV   V    +D ++  +C  +G W       +C C +G E   S+  C  C   +YK   G + C  CP  +++    S  C C  GYY          C +PP   RN++  S ++  +IL W+ P   + S    D +SY L+          C  C + + FLP  +      + +  L +   Y F++ ++N VS+    P      +  +SL T         K++S+    QT  H + LSW QP  P  I+ +YE          K  +    D+ +++  T    + I  +   I +  +VR R   G+G+ S+   I   +           ++T  V +  F+  ++     +     V+++                    CIRR   F +           + +  + +Y      PN+    Y +P TYED + A+ +F +EI+P W+T   +IG GE G V +G L VP      VA+K LK G SEK+R DFL EAS MGQF + ++++LEGV+T S   MIITEFM NGSL  FLR    +    QL+ ML  +A GMKYLS + +IHRDLAARN+L+D  LVCKV+DFGLSR L D D   +YT    GK+PI+ TAPEAI + KF+ ASDVWSFGV+ WEV+SYGE+PYW  +N +VI AI+ GYRLP P++CPP +H LML CW     +RP F  I   ++++
Sbjct:   34 LLDTTNIFGQLGWEATPTT--GWEEMAIQINQTALIQAYQVCNVVKPNQNNWLRTRWIARDPAQRVYVEIKFTLRDCGSMAGVAST--CKETFNLYYYEADSG-SSANMDESLFAKVGTIAADSNFDNVDVKDRVLKL---NTEVRELPPLSWPGFYLAFQDVGACVALVSARVYYKKCPAVVRDLARFPDTVANALSSPLVEVRGSCVPNAVAA--TDPRM--HCSTDGEWLVP--IGLCVCHAGYEAAGSQ--CRACGLGYYKNTTGGQPCDLCPPESFTTRLASTHCGCKAGYYRAEADPVSSPCTRPPSAARNVI-SSVNETSVILEWSPP---QDSGGRGD-VSYRLVCQTCGGGRSPCAPCGDSVRFLPRREGLAVPGVTIAHLLAHTNYTFRIEALNGVSRLSPAP----PKAVSVSLTTN---QAAPSKIRSLWYEMQTKDH-VKLSWFQPDQPNGIILDYE---------IKYYEKGQRDTSYNILHTKVPSASIEGLRAKIVYGFEVRARTAAGFGKPSDPVEINTDQYR---------KVTLVVCSGGFTEHSNTTRVAVIVVCAVILLAFIVFT------------VVCIRRSCFFLL----------PSIAGDENVYMK-LKFPNRR--NYVDPFTYEDPNKAVQEFAREIEPSWITIEKVIGSGESGEVCRGRLRVPGQAEAPVAIKTLKAGYSEKQRRDFLSEASIMGQFEHPSIIRLEGVVTKSKPVMIITEFMENGSLDAFLRGNDGQFNVGQLVGMLRGIAAGMKYLSDMNYIHRDLAARNVLVDSKLVCKVSDFGLSRGLED-DPQAVYTTH-GGKIPIRWTAPEAIAFRKFTSASDVWSFGVLMWEVMSYGERPYWDMNNQDVIQAIEEGYRLPAPMDCPPALHQLMLDCWQKERTERPNFAQILAYLDKL 890          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Sea Lamprey
Match: EPHB2 (EPH receptor B2 [Source:HGNC Symbol;Acc:HGNC:3393])

HSP 1 Score: 454.907 bits (1169), Expect = 1.922e-142
Identity = 292/897 (32.55%), Postives = 450/897 (50.17%), Query Frame = 3
Query:  309 NADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIEN---IHYNERTFAIIGTISSNNKWETKD---RTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNT-YSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLIE-----CINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMF--NMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            N    Y VC V   + N+WLR+ FI R     +++++ FT+R+C + P+ P S   C+ETF L  YE+D  +       + E  +  + TI+ +  +   D   R   I N   +   + + G  +AFQ+ G C+ +  V V++  C   + +F  FP T  G ES +  +  G C+   +     +  I  YC  +G W        C C  G E +  +++C  C    +K  QG  +C  CP  +  S  G  SC+C  G++  P+    + C   P  PR + M S ++  ++L W++P        ++ N+   L       C  C   + F P     ++T+V+V   +    Y F+V +VN VS+    P      S  +++ T          +  + ++   I LSW QP  P  I+    + +  R Y K+ D  NA   F    TNT  + ++ +     +V +VR R   G+G++S     +T         LK ++P        +  ++ +TI  I                          +++I + YC +R        Y  K +      ++P   +Y   ++        Y++PN       A+ +F +EID   +T   +IG GEFG V +G L +P      VA+K LK   +EK+R DFL EAS MGQF + N+++LEGV+T S   MI+TEFM NGSL +FLR    + T IQL+ ML  +A GMKYLS + ++HRDLAARNIL++ NLVCKV+DFGLSR L +   D  YT+   GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  +N +VI+A++  YRLP P++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   12 NTIRTYQVCNVFEANQNNWLRTKFIERKGAQRVYVEMKFTVRDCSSIPNVPGS---CKETFNLYYYETDGDVATKTKPFWMENPYIKVDTIAPDESFSQVDLGGRMMKINNELRSFGPLSKNGFYLAFQDFGGCMSLISVRVFFRKCPPVVQSFAAFPETLTGPESTSLVIARGSCI---LNAEEVNVPIKLYCNGDGEWMVPIGG--CTCKPGYEPSGGRSTCNACPLGTFKPQQGEHECQQCPPGSRMSSVGGTSCVCRNGHFRAPSDPPDMPCTSTPSAPRGV-MSSVNETSVVLEWSAPLDSGRRSDLAYNVLCRLCRKDRQVCTRCNEAVRFEPRQLGLRQTRVLVSELMAHTPYTFEVQAVNGVSEQSPYP----PQSVAVNITTNQAAPSSVPIIHQVTSSVTSITLSWPQPEQPNGII----LDYELRYYEKSQDERNAS--FMRSQTNT--ARVDGLQPGTIYVFQVRARTVSGFGRYSGKMYFQTLEEGSYPERLKEQLP-------LIAGSAAATIVFIVA------------------------VVVIAIVYCRKRSYGRPDPEYTDKLQQYHTGHSTPGMKMYIDPFT--------YEDPNE------AIREFAREIDISCVTIEQVIGSGEFGEVCRGRLRMPGKREMYVAIKTLKSAYTEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIVTEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSDMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLENDPTDPTYTSGMGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNEDVINAVEQDYRLPAPMDCPAALHQLMLDCWQKSRNDRPKFGQIVSTLDKM 842          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002245.1 (pep scaffold:Pmarinus_7.0:GL476603:2572:131951:1 gene:ENSPMAG00000001992.1 transcript:ENSPMAT00000002245.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 414.075 bits (1063), Expect = 3.018e-127
Identity = 278/867 (32.06%), Postives = 417/867 (48.10%), Query Frame = 3
Query:  324 YGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVI------VAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNR-NVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSF-TGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------------------ECINCPNKLVFLP-SSKTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIV-EYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKI-PTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPP 2828
            Y VC V  PS N+WLR+ +IS      ++I++ FT+R+C + P       C+ETF L  YESDS   + H +E  F  I TI+++  +   D    I+ +   +  VR +G +      +AFQ+ G+C+ +  V VYY  C   +     FP T  G +S +   V G CV+    K    E    +C A+G W     +  C CG G E      +C  C   FYK + G + C  CP ++ S   GS  C C++ YY      + + C +    P   L    D  +  L W++P        ++ +++  +                       C+ C  ++ F P  S   E +V V G      Y F+V + N VS+    P      S+ I L   P    + L ++  + +K  I LSW++P  P  ++ +YE ++F  ++           S ++  T       IN +     +  +VR R   G+GQ+S+          L +   P++  +           +  I  F++                            YC   +   N    K   + F+   P   +Y               +P TYED   A+H+F +EID  ++    ++G GEFG V +G L +P      VA+K LK G +E++R DFL EAS MGQF + N+++LEGV+T S   MI+TE+M NGSL +FLR    + T+IQL+ ML  +A GMKYLS + ++HRDLAARNIL++ NLVCKV+DFGLSR L D D +  YT K  G++P++ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  SN ++      G + PPP
Sbjct:   17 YQVCHVMEPSQNNWLRTNWISCGGAQRIYIELKFTLRDCSSIPGVAGT--CKETFNLHYYESDSD-SSAHVDENQFFKIDTIAADESFTQVDLGGRIMKL---NTEVRDVGPLAKKGFHLAFQDVGACIALVSVRVYYKRCPRTVRGLAVFPDTVTGADSSSLIEVRGACVDNSAEK----EAPRMFCSADGEWLVPIGR--CVCGPGYE-EVVVGACRACGIGFYKEIAGEQMCSKCPPHSLSHRAGSYDCECDESYYRAKADPKSMACTRSTWSPSEGLTSVKDPTQ-TLEWSAPSDTGGRRVLNYSVACRVCAPAEPLPASGDDGSSGAAGSPRCLPCGAEVRFAPRQSGVTERRVTVTGLAAHTNYTFEVRATNGVSELTRAP----PQSASIRLTMNPAAPGQILDVRQNRISKDAIALSWSEPKHPNSVILDYE-ITFSEKEQ-TEISYTTVKSKWNTIT-------INGLKPSTIYTFQVRTRTTAGYGQYSKPFHFQTSNEPLDISSDPSQSTIVWLSVATGIIVVLIIVCFLLKGR-------------------------YCGYSKAKQNCDEDK---QHFQVKLPGLKMYI--------------DPFTYEDPCEAVHEFAREIDVSYIKIEGVVGAGEFGEVCRGRLRLPGKGEASVAIKTLKAGYTEEQRRDFLCEASIMGQFDHPNIIRLEGVITKSIPVMIVTEYMENGSLDSFLRKNDGQFTSIQLVGMLRGIAAGMKYLSDMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLED-DPEAAYTAK-GGRIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDITRVYDEGEKAPPP 812          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010328.1 (pep scaffold:Pmarinus_7.0:GL478135:2434:69706:1 gene:ENSPMAG00000009330.1 transcript:ENSPMAT00000010328.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 335.495 bits (859), Expect = 1.085e-100
Identity = 215/671 (32.04%), Postives = 331/671 (49.33%), Query Frame = 3
Query:  954 CIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLIECINCPNK-----------LVFLP-SSKTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLT-KPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVW--SFGVVCWEVLSYGEKPYWQWSNH--EVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHI 2912
            C  C   FYK   G   C  CP ++ +   G+ASC C +GY+      Q + C +PP  P N++ + ++ + + L W+ P        VS     Y I C  CP++           + FLP  ++   T V+V   L    Y F+V   N VS+    P      +   +     P+ +++K  +     ++  I+L+W +P  P  I+    + +  + Y K+      +S +    +N + + I  +   + +  ++R R   G+G +S   ++  K +   +  P++ +    +    F+ I             VV++++ +  ++              RR+  ++  +Q +  EK          +S    LP      Y +P+TYED + A+H+F KEID   +    +IG GEFG V  G L  P  +   VA+K LK G +E++R DFL EAS MGQF + N+++LEGV+T S   MIITEFM NGSL  FLR    + T IQL+ ML  +A GMKYLS + ++HRDLAARNIL++ NLVCKV+DFGLSR L D D +  YT + +      C         + + A   W  ++G+V W  + YGE+ Y+  S H  EVI AI+ GYRLP P++CP  +H LML CW      RP F  I
Sbjct:    1 CAACERGFYKEFAGDNSCSKCPPHSSARARGAASCSCEEGYFRPRTDPQSVACARPPSAPGNVISNVNETS-VTLEWSPPGETGGRRDVS-----YSIVCRRCPSEPAGACAPCGAAVRFLPRQARLLNTSVVVRDLLAHTNYTFEVHGNNGVSELSGVPSRFAAVNVTTNQAAPSPITDVQKGLI-----SEDAIILNWAEPKQPNGII----LDYEVKYYEKD----QKESKYTTLRSNVTSTTITGLKPAVVYALQIRARTAAGYGDYS--PAVEFKTSPDYVASPSEQKQDTLIWAFVFAVI-------------VVLLLITAFFIIK-------------RRRCGYSKAKQDYDEEKTR-------FHSGHVKLPG--LKMYIDPHTYEDPNQAVHEFAKEIDASCVKIERVIGAGEFGEVCSGYLKHPGKKEVCVAIKTLKAGYTEQQRRDFLCEASIMGQFDHPNIIRLEGVITKSKPVMIITEFMENGSLDLFLRKNDGQFTVIQLVGMLRGIAAGMKYLSDMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLED-DPEAAYTTRNEKTKHRHCNVEPQAFKTRMAIADTYWTKTYGIVMWRHVKYGERLYFNTSTHAQEVIKAIEEGYRLPAPMDCPLPLHQLMLDCWQKERSDRPKFGQI 614          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 106.686 bits (265), Expect = 1.221e-23
Identity = 85/296 (28.72%), Postives = 150/296 (50.68%), Query Frame = 3
Query: 2160 IIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEA-----STMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCT----APEAILYGK-FSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAI----QSGYRLPPPVNCPPIM----HNLMLHCWNLNSDKRPT----FPHISYEIEQI----SSQLCVTIKKNE 2969
            +IG+G FG VY  +     +   +  V+V K  +S+ E     VEA     ST+    + N+++  G    ++ Y +  E++  GS+ + +R+         +  + + V  G+ YL S G +HRD+ A N+LLD++ +CK++DFG+SR+     + DIY+N     + ++ T    APE +   + +S   D+WS G +  E+ + G++P   WSN EV+ A+    +S    P P +  P++     N +  C+ +N +KRPT      H   E+ +     S++L   IK N+
Sbjct: 1180 MIGKGSFGAVYLCLNVTTGEMMAVKQVEVPK-YSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMY-GRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRK-----SKDIYSN---SDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFA-GKRP---WSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSHPFSEVNETFNFKSTRLAKFIKSND 1461          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 96.2857 bits (238), Expect = 1.764e-20
Identity = 75/280 (26.79%), Postives = 131/280 (46.79%), Query Frame = 3
Query: 2160 IIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQISSQLCVTIKKNETDRKDFKNCE 2999
            +IG+G +G VY+ +    +   ++VA+K +    +++E ND + E S +    + N++K  G +  S    I+ E+  NGSL   +      L+  +    ++    G+KYL   G IHRD+ A NILL  +   K+ADFG+S  ++        T        +   APE +     S  SD+WS G    E+L+    PY   ++  +  A+++    PP     P + + +  C+  N  KRPT   +   +  I+S   V + K    ++DF + +
Sbjct:   30 VIGRGSYGVVYKAI---NKHTDQVVAIKEVV-YENDEELNDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAGT--------LNWMAPEILGNRGASTLSDIWSLGATVVEMLT-KNPPYHNLTDANIYYAVENDTYYPPSSFSEP-LKDFLSKCFVKNMYKRPTADQLLKHV-WINSTENVKVDKLNKFKEDFTDAD 294          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Yeast
Match: FRK1 (Protein kinase of unknown cellular role; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; interacts with rRNA transcription and ribosome biogenesis factors and the long chain fatty acyl-CoA synthetase Faa3p; FRK1 has a paralog, KIN4, that arose from the whole genome duplication [Source:SGD;Acc:S000006062])

HSP 1 Score: 82.0333 bits (201), Expect = 3.524e-16
Identity = 59/217 (27.19%), Postives = 101/217 (46.54%), Query Frame = 3
Query: 2157 TIIGQGEFGHVYQG----------VLFVPEDERKIVAVKVLK-DGASEKERNDFLV--EASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKC-----TAPEAILYGKFSHA--SDVWSFGVVCWEVLS 2747
            + +G+GEFG V  G            F   D  K VA+K++K D  S   R +  +  E + +    + N++KLE V+  S    I+ E+   G    +++ KK  L  +   ++ S + +G+ Y+ S G +HRDL   N+LLD+N    + DFG   E   ++            +   C      APE ++  +   A  +D+WS GV+ + +L+
Sbjct:   45 STLGEGEFGKVKLGWPKNFSNSSNSTF---DFPKQVAIKLIKRDSISNDYRKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQ-KKRRLKEMNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNE----------LMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILA 247          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 78.9518 bits (193), Expect = 1.736e-15
Identity = 65/237 (27.43%), Postives = 108/237 (45.57%), Query Frame = 3
Query: 2139 KWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFL-RIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAIL--YGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCP 2840
            K  +  + IG+G FG VY+ V  V ++   IVA+KV+    S+++      E   + +  +  +      M    S  I+ E+   GS    L R   N L   ++  ++  V  G+KYL     IHRD+ A NILL+E  + K+ DFG+S  +      D +   P         APE +      ++  +D+WS G+  +E+L  G  P  ++   +V+  +    R PP +  P
Sbjct:   16 KLYSIQSCIGRGNFGDVYKAVDRVTQE---IVAIKVVNLEHSDEDIELLAQEIFFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTLKRDTFVGTP------YWMAPEVVCCEVDGYNEKADIWSLGITTYELLK-GLPPLSKYDPMKVMTNLPK--RKPPKLQGP 240          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Yeast
Match: SSK2 (MAP kinase kinase kinase of HOG1 mitogen-activated signaling pathway; interacts with Ssk1p, leading to autophosphorylation and activation of Ssk2p which phosphorylates Pbs2p; also mediates actin cytoskeleton recovery from osmotic stress; a HOG-independent function of Ssk2p mediates the calcium-sensitive phenotype of the ptp2 msg5 double disruptant; SSK2 has a paralog, SSK22, that arose from the whole genome duplication [Source:SGD;Acc:S000005314])

HSP 1 Score: 79.7221 bits (195), Expect = 2.448e-15
Identity = 79/285 (27.72%), Postives = 123/285 (43.16%), Query Frame = 3
Query: 2049 PNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVL--KDGASEKERNDFLVEASTMGQFMNE-NVLKLEGVMTGSDSYMIITEFMVNGSLLTFL---RIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSREL---------------SDKDADDI--------YTNKPDGKLPIKCT----APEAI----LYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVI 2792
            P+QT     + +      V+L      +  +W      IG G FG VY  V     D  +I+AVK +  +D  S ++    + E  ++ + +N  N++   GV    D   I  E+   GSL   L   RI+   +T +  L++L     G+ YL   G +HRD+   NILLD N V K  DFG ++++               +D + +D+          N  +  L +  T    APE+I      GK   A DVWS G V  E+++ G +P+    N   I
Sbjct: 1235 PHQTGKVIDDSDKGNKYLVSLASSISNVSMRW-QKRNFIGGGTFGRVYSAVDL---DNGEILAVKEINIQDSKSMQKIFPLIKEEMSVLEILNHPNIVSYYGVEVHRDKVNIFMEYCEGGSLAALLEHGRIEDEMVTQVYTLQLLE----GLAYLHESGIVHRDVKPENILLDFNGVIKYVDFGAAKKIANNGTRLASMNKIENADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITGSTTKGKLG-ADDVWSLGCVVLEMIT-GRRPWANLDNEWAI 1509          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Nematostella
Match: EDO40994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5K8])

HSP 1 Score: 326.25 bits (835), Expect = 6.183e-101
Identity = 152/303 (50.17%), Postives = 206/303 (67.99%), Query Frame = 3
Query: 2025 IYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            +  S   LP      Y +P+ Y D   AL +F KE+D +WL    +IG GEFG VY+G L  P +    VA+K LK G++ K R DFL EAS MGQF + NV+ LEGV++ +   MI+TEFM NGSL  FL+   ++L+ IQL+ M   +A+GMKYLS + F+HRDLAARNIL+ E LVCKVADFGLSREL D   +        GK+P++ TAPEAI Y KFS +SDVWS+G++ WE  S+ E+PYW WSN EV+D +++GYRLPPP++CP ++H +ML CW+ +  KRP+F  I  +++ +
Sbjct:   18 VLVSEVDLPTCGQRVYIDPSNYNDPEEALRNFAKELDKRWLKLEKVIGGGEFGDVYKGTLKRPGENTIPVAIKTLKQGSTSKNRGDFLSEASVMGQFCDPNVIFLEGVVSKTHPLMIVTEFMSNGSLDNFLKKMDSKLSLIQLMGMARGIASGMKYLSEMNFVHRDLAARNILVTETLVCKVADFGLSRELEDSAYE-----TSGGKIPVRWTAPEAIKYRKFSTSSDVWSYGILLWETFSFAERPYWDWSNFEVMDRVETGYRLPPPMSCPKVIHQIMLECWDADRTKRPSFALIVKQLDSL 315          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Nematostella
Match: EDO33736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD7])

HSP 1 Score: 302.753 bits (774), Expect = 1.588e-92
Identity = 147/289 (50.87%), Postives = 193/289 (66.78%), Query Frame = 3
Query: 2070 YQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDK-DADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            Y +P+ Y D   AL    KEI+   L    IIG GEF  VY+GVL   +  ++ VAVK+LK G+S K R DF VEAS MGQF + NV+ L+GV+T +   MIITEF+ NGSL  FL+     LTT+QL+ +   VA GM YLS + FIHRDLAARNIL+ +NL  KV+DFGLSREL D  + +        GK+P++ TAPEAI Y KFS ASDVWS+G++ WE++S+GE+PYW W N +V+D ++ GYRLP P+ CP ++HNLML CW+     RP F  I    +++
Sbjct:    2 YIDPSNYGDPMEALMSVAKEINKDDLKLEIIIGGGEFADVYRGVLTNEDKTQEKVAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPMKCPKVIHNLMLDCWDKEKTSRPKFADIVRRFDEV 290          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Nematostella
Match: EDO33732 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD3])

HSP 1 Score: 267.314 bits (682), Expect = 1.201e-81
Identity = 133/255 (52.16%), Postives = 174/255 (68.24%), Query Frame = 3
Query: 2070 YQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDK-DADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPV 2831
            Y +P+ Y D   AL    KEI+   L    +IG GEF  VY+GVL   +  ++ VAVK+LK G+S K R DF VEAS MGQF + NV+ L+GV+T +   MIITEF+ NGSL  FL+     LTT+QL+ +   VA GM YLS + FIHRDLAARNIL+ +NL  KV+DFGLSREL D  + +        GK+P++ TAPEAI Y KFS ASDVWS+G++ WE++S+GE+PYW W N +V+D ++ GYRLP P+
Sbjct:    3 YIDPSNYGDPMEALMSVAKEINKDDLKLEIVIGGGEFADVYRGVLTNEDKTQEKVAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLENFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPM 257          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Nematostella
Match: EDO33731 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD2])

HSP 1 Score: 265.388 bits (677), Expect = 7.610e-81
Identity = 133/255 (52.16%), Postives = 173/255 (67.84%), Query Frame = 3
Query: 2070 YQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDK-DADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPV 2831
            Y +P+ Y D   AL     EI+   L    IIG GEF  VY+GVL   +  ++ VAVK+LK G+S K R DF VEAS MGQF + NV+ L+GV+T +   MIITEF+ NGSL  FL+     LTT+QL+ +   VA GM YLS + FIHRDLAARNIL+ +NL  KV+DFGLSREL D  + +        GK+P++ TAPEAI Y KFS ASDVWS+G++ WE++S+GE+PYW W N +V+D ++ GYRLP P+
Sbjct:    5 YIDPSNYGDPMEALMSVAMEINKDDLKLEIIIGGGEFADVYRGVLTNEDKTQEKVAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPM 259          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Nematostella
Match: EDO28980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4Y3])

HSP 1 Score: 261.151 bits (666), Expect = 1.915e-78
Identity = 120/227 (52.86%), Postives = 159/227 (70.04%), Query Frame = 3
Query: 2256 GASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDK-DADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            G+S K R DF VEAS MGQF + NV+ L+GV+T +   MIITEF+ NGSL  FL+     LTT+QL+ +   VA GM YLS + FIHRDLAARNIL+ +NL  KV+DFGLSREL D  + +        GK+P++ TAPEAI Y KFS ASDVWS+G++ WE++S+GE+PYW W N +V+D ++ GYRLP P+ CP ++HNLML CW+     RP F  I   ++++
Sbjct:    1 GSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPMKCPKVIHNLMLDCWDKEKTSRPKFADIVRRLDEV 227          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Medaka
Match: ephb1 (ephrin type-B receptor 1-B [Source:NCBI gene;Acc:101173092])

HSP 1 Score: 475.322 bits (1222), Expect = 3.533e-149
Identity = 308/949 (32.46%), Postives = 473/949 (49.84%), Query Frame = 3
Query:  198 LFYCEKVLLLNTSIS----GWNNWKKNTKTYEGWRIQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIEN---IHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL---GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSAS-CICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVS-------QYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFN--MYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            LF+   + L++T ++    GW  +  +         +NL  N    Y VC V  PS N+WL + FI R     +++++ FT+R+C + P+ P S   C+ETF L  YE+D+ I       + E  +  + TI+++  +   D    ++ +     S   L   G  +AFQ+ G+C+ +  V V+Y  C   + NF  FP T  G ES +  +  G C+         D  I  YC  +G W        C C +G E  D+   C  C    +K  QG   C+ CP N+ S   +A+ C+C  GYY     +    C   P  PRN++    ++  +IL W+SP          D++ Y ++          C +C + + F+P      ET+V +   L    Y F++ +VN VS       Q+VT     +Q++  I  +           +  I +  +   LSW QP  P  I+    + +  R Y K+    N+ ++       T+ + +  +     +V +VR R   G+G++S     +T +    K+EL+ ++P        +  ++ + +  I + I                          +   C R++      +Y  K ++      SP   IY               +P TYED + A+ +F KEID   +    +IG GEFG VY+G L +P      VA+K LK G  EK+R DFL EAS MGQF + N+++LEGV+T S   MI+TEFM NG+L +FLR    + T IQL+ M+  +A GMKYLS + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+P++ TAPEAI Y KF+ ASDVWS+G+V WEV+S+GE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:    7 LFFLCLITLMDTRVATAELGWTAYPNSGWEEVSGYDENL--NTIRTYQVCNVFEPSQNNWLLTTFIDRKGAQRIYVEIRFTVRDCSSIPNVPGS---CKETFNLYYYETDAVIATKGTAFWMEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLSKNGFYLAFQDYGACMSLLSVRVFYKKCPSVVQNFAVFPETMTGAESTSLVIARGNCIPN---SEEVDVPIKLYCNGDGEWMVP--IGSCTCKAGFE-PDNGNVCRACPPGTFKSTQGPSLCLQCPLNSRSTAEAATVCVCRNGYYRGDADQPDEPCTSVPSSPRNVI-SIVNETSVILEWHSP----RETGGRDDVVYNIVCKKCRADRRSCSHCDDNVDFVPRQLGLTETRVFISNLLSHTLYSFEIQAVNGVSNKSPYPAQHVTIDITTNQAAPSIVPI-----------MHQISSTMNSFTLSWPQPEQPNGII----LDYELRYYEKDHAEINSTTL----RCQTNTARVEGLRPGTVYVVQVRARTVAGFGRYSSKMCFQTLTDDDFKSELREQLP-------LIAGSAAAGVVFIVSLI-------------------------AISIVCSRKRAYTKEAVYSDKLQHYSTGRGSPGMKIYI--------------DPFTYEDPNEAVREFAKEIDVSTVKIEEVIGAGEFGEVYKGRLKLPGKREIFVAIKTLKAGYVEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENGALDSFLRQNDGQFTVIQLVGMMRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPSYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNVRPRFSDIVSTLDKM 874          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Medaka
Match: ephb1 (ephrin type-B receptor 1-B [Source:NCBI gene;Acc:101173092])

HSP 1 Score: 475.322 bits (1222), Expect = 9.368e-149
Identity = 301/906 (33.22%), Postives = 458/906 (50.55%), Query Frame = 3
Query:  309 NADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIEN---IHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRL---GVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSAS-CICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVS-------QYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFS-----ETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            N    Y VC V  PS N+WL + FI R     +++++ FT+R+C + P+ P S   C+ETF L  YE+D+ I       + E  +  + TI+++  +   D    ++ +     S   L   G  +AFQ+ G+C+ +  V V+Y  C   + NF  FP T  G ES +  +  G C+         D  I  YC  +G W        C C +G E  D+   C  C    +K  QG   C+ CP N+ S   +A+ C+C  GYY     +    C   P  PRN++    ++  +IL W+SP          D++ Y ++          C +C + + F+P      ET+V +   L    Y F++ +VN VS       Q+VT     +Q++  I  +           +  I +  +   LSW QP  P  I+    + +  R Y K+    N+ ++       T+ + +  +     +V +VR R   G+G++S     +T +    K+EL+ ++P        +  ++ + +  I + I      + ++           +    L  Y   R++     R    N       PT    S    +       Y +P TYED + A+ +F KEID   +    +IG GEFG VY+G L +P      VA+K LK G  EK+R DFL EAS MGQF + N+++LEGV+T S   MI+TEFM NG+L +FLR    + T IQL+ M+  +A GMKYLS + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+P++ TAPEAI Y KF+ ASDVWS+G+V WEV+S+GE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:   54 NTIRTYQVCNVFEPSQNNWLLTTFIDRKGAQRIYVEIRFTVRDCSSIPNVPGS---CKETFNLYYYETDAVIATKGTAFWMEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLSKNGFYLAFQDYGACMSLLSVRVFYKKCPSVVQNFAVFPETMTGAESTSLVIARGNCIPN---SEEVDVPIKLYCNGDGEWMVP--IGSCTCKAGFE-PDNGNVCRACPPGTFKSTQGPSLCLQCPLNSRSTAEAATVCVCRNGYYRGDADQPDEPCTSVPSSPRNVI-SIVNETSVILEWHSP----RETGGRDDVVYNIVCKKCRADRRSCSHCDDNVDFVPRQLGLTETRVFISNLLSHTLYSFEIQAVNGVSNKSPYPAQHVTIDITTNQAAPSIVPI-----------MHQISSTMNSFTLSWPQPEQPNGII----LDYELRYYEKDHAEINSTTL----RCQTNTARVEGLRPGTVYVVQVRARTVAGFGRYSSKMCFQTLTDDDFKSELREQLP-------LIAGSAAAGVVFIVSLIA-----ISIVCSRKRAYTKEAVYSDKLQHYSTGRELSL---RADMSNCPSPLGCPTHFSGSPGMKI-------YIDPFTYEDPNEAVREFAKEIDVSTVKIEEVIGAGEFGEVYKGRLKLPGKREIFVAIKTLKAGYVEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENGALDSFLRQNDGQFTVIQLVGMMRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPSYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNVRPRFSDIVSTLDKM 904          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Medaka
Match: ephb2a (ephrin type-B receptor 2-like [Source:NCBI gene;Acc:101156311])

HSP 1 Score: 473.781 bits (1218), Expect = 1.881e-148
Identity = 315/942 (33.44%), Postives = 474/942 (50.32%), Query Frame = 3
Query:  174 LWIMDLINLFYCEKVLLLNTSISGWNNWKKNTKTYEGWR-IQNLPPNADEV--YGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIENIHY---NERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSF-TGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLI---------ECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            LWI  L +++  E+VL+ +T+ +    W       +GW  +     N   +  Y VC V   S N+W+R+ +I R     +H+ + F++R+C + P+ P S   C+ETF L  YESDS +    +    E  +  + TI+++  +   D    I+ I     S   V R G  +AFQ+ G+C+ +  V V+Y  C   + N   FP T +G ES +     G CV  G      D  I  YC  +G W     +  C C +G E  ++ T C  C + F+K  QG ++C  CP N+ +   G+ +CIC   YY   +   ++ C   P  P+N++    ++  + L WN P          D++ Y +I          C  C + + F+P       T+V +   L   +Y F++ +VN VS    +P+    +S  I+        +  +   S   N   I LSW+QP  P  ++    + +  + Y KN   +N+  I     TNT+    NL    IY V +VR R   G+G+FS                  K+           STI +    II      V+                    + I   ++  + R +  +++ E+    ++ + ++    +     Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L  P     +VA+K LK G +E++R DFL EAS MGQF + N++ LEGV+T S   MIITEFM NGSL +FLR    + T IQL+ ML  +A GMKYL  + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+PI+ TAPEAI Y KF+ +SD WS+G+V WEV+SYGE+PYW  SN +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:    7 LWI--LPSVWAAEEVLMDSTTATAELGWI--IYPSQGWEEVSGYDENMSTIRTYQVCNVFDNSQNNWIRTKYIRRRGAQRIHVLMKFSVRDCSSIPNVPGS---CKETFNLYYYESDSDVATKTFPPWMENPWVKVDTIAADESFSHVDLGGRIMKINSEVRSFGPVSRSGFYLAFQDYGACMSLIAVRVFYRKCPRVVQNGAVFPETLSGAESTSLVAARGVCVPNG---EEVDVPIKLYCNGDGEWMVPIGR--CMCKAGYEALENGTVCKACLSGFFKSAQGDDRCRQCPINSRTIHEGATNCICRNSYYRTDSDPPQMPCTTIPSTPQNVI-SIVNETSLRLEWNPP----QESGGRDDVVYNIICKSCGSGRGLCTRCGDNVQFVPRQLGLTNTQVYISDLLAHTQYTFEIQAVNGVSD--QSPYSPQYASVNITTNQAAPSAVSIIHQVSRTPNT--ITLSWSQPDQPNGVI----LDYELQYYEKNQAEWNSSLIRS--QTNTAV-VQNLKPGSIY-VFQVRARTVAGFGRFS-----------------GKMYFQTMTDEEYNSTIQEKLPLIIGSSAAGVV--------------------FIIAITVVITVCRGRRNSDRPESEYADKLQHYTSGHKVSPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGNLRQPGKREILVAIKTLKAGYTERQRRDFLSEASIMGQFDHPNIIHLEGVVTKSSPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLCDMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSSSDCWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNNRPKFSQIVANLDKM 882          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Medaka
Match: ephb2b (ephrin type-B receptor 2 [Source:NCBI gene;Acc:101165974])

HSP 1 Score: 472.241 bits (1214), Expect = 7.776e-148
Identity = 313/942 (33.23%), Postives = 478/942 (50.74%), Query Frame = 3
Query:  174 LWIMDLI-NLFYCEKVLLLNTSIS---GWNNWKKNTKTYEGWR-IQNLPPNADEV--YGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIENIH---YNERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNI-----SYYLIECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            LWI+  I  +   E+ L+ +T+ +   GW  +  +  +   W  +     N + +  Y VC V   + N+W+R+ +I R     +H+++ F++R+C + P+ P S   C+ETF L  YESDS   N +   + E  +  + TI+++  +   D    ++ I     S   V + G  +AFQ+ G C+ +  V V+Y  C   ++N   F  T +G ES +     G C+         D  I  YC  +G W     +  C C +G E  ++ T C  C + F+K  QG + C+ CP N+ + + G+ +C+C  GYY   +   ++ C   P  P+ ++  S ++  ++L W SP      E V  NI           C  C + + F+P      E++V +   L   +Y F+V +VN VS    +P+    +S  I+        +  +    +  +   I LSW+QP  P  ++    + +  + Y K+    NA +I     + T+   I  +     +V +VR R   G+G++S  K   +   E +     + +L   + +A+   +  I   +I                          +  C RR          F     E T   Q  Y+S +  P      Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L +P      VA+K LK G +EK+R DFL EAS MGQF + NV+ LEGV+T S   MIITEFM NGSL TFLR    + T IQL+ ML  +A+GMKYL+ + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  +N +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:    4 LWILWTIPAVIAVEETLMDSTTATAELGWTVYPVSGTSDNSWEEVSGYDENMNTIRTYQVCNVFDSNQNNWVRTKYIRRRGAQRIHVEMKFSVRDCSSIPNVPGS---CKETFNLYYYESDSDTANRNSPPWMENPWIKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSKNGFYLAFQDYGGCMSLIAVRVFYRKCPRIITNGALFQETLSGAESTSLVAARGVCIPNA---EEVDVPIKLYCNGDGEWMVPIGR--CMCKAGNEAVENGTVCRACPSGFFKSTQGDQLCLQCPINSRTTSEGAINCVCRNGYYRTDSDPLQMPCTTVPSAPQAVI-SSVNETSVMLEWMSPRDSGGREDVVYNIICKSCGGGRGGCTRCGDNVQFVPRQLGLTESRVYISDLLAHTQYTFEVQAVNGVSD--QSPYSPQYASVNITTNQAAPSTVSIMH--QVSRSVDSITLSWSQPDQPNGVI----LDYELQYYEKDLSEHNASTI----RSQTNTVVIRGLKPGSIYVFQVRARTVAGFGRYS-GKLYFQTMTEEEYNTSIQEKLPLIIGSAAAGLVFLIALVVI--------------------------IIVCNRR---------GFDRHDSEYTDKLQH-YTSGHMTPGMKI--YIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGNLKLPGKREMFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSSPVMIITEFMENGSLDTFLRQNDGQFTVIQLVGMLRGIASGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNNRPKFSQIVNNLDKM 885          
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Medaka
Match: ephb2b (ephrin type-B receptor 2 [Source:NCBI gene;Acc:101165974])

HSP 1 Score: 471.085 bits (1211), Expect = 2.111e-147
Identity = 310/939 (33.01%), Postives = 477/939 (50.80%), Query Frame = 3
Query:  180 IMDLINLFYCEKVLLLNTSIS---GWNNWKKNTKTYEGWR-IQNLPPNADEV--YGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPD-PKSLRHCEETFTLLKYESDSPIENIH---YNERTFAIIGTISSNNKWETKDRTENILNIYETSIS---VRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVV-GKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFT-GSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNI-----SYYLIECINCPNKLVFLPSS-KTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            + D + L +  + L+ +T+ +   GW  +  +  +   W  +     N + +  Y VC V   + N+W+R+ +I R     +H+++ F++R+C + P+ P S   C+ETF L  YESDS   N +   + E  +  + TI+++  +   D    ++ I     S   V + G  +AFQ+ G C+ +  V V+Y  C   ++N   F  T +G ES +     G C+         D  I  YC  +G W     +  C C +G E  ++ T C  C + F+K  QG + C+ CP N+ + + G+ +C+C  GYY   +   ++ C   P  P+ ++  S ++  ++L W SP      E V  NI           C  C + + F+P      E++V +   L   +Y F+V +VN VS    +P+    +S  I+        +  +    +  +   I LSW+QP  P  ++    + +  + Y K+    NA +I     + T+   I  +     +V +VR R   G+G++S  K   +   E +     + +L   + +A+   +  I   +I                          +  C RR+         F     E T   Q  Y+S +  P      Y +P TYED + A+ +F KEID   +    +IG GEFG V  G L +P      VA+K LK G +EK+R DFL EAS MGQF + NV+ LEGV+T S   MIITEFM NGSL TFLR    + T IQL+ ML  +A+GMKYL+ + ++HRDLAARNIL++ NLVCKV+DFGLSR L D  +D  YT+   GK+PI+ TAPEAI Y KF+ ASDVWS+G+V WEV+SYGE+PYW  +N +VI+AI+  YRLPPP++CP  +H LML CW  + + RP F  I   ++++
Sbjct:    1 MFDRLFLCWSTETLMDSTTATAELGWTVYPVSGTSDNSWEEVSGYDENMNTIRTYQVCNVFDSNQNNWVRTKYIRRRGAQRIHVEMKFSVRDCSSIPNVPGS---CKETFNLYYYESDSDTANRNSPPWMENPWIKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSKNGFYLAFQDYGGCMSLIAVRVFYRKCPRIITNGALFQETLSGAESTSLVAARGVCIPNA---EEVDVPIKLYCNGDGEWMVPIGR--CMCKAGNEAVENGTVCRACPSGFFKSTQGDQLCLQCPINSRTTSEGAINCVCRNGYYRTDSDPLQMPCTTVPSAPQAVI-SSVNETSVMLEWMSPRDSGGREDVVYNIICKSCGGGRGGCTRCGDNVQFVPRQLGLTESRVYISDLLAHTQYTFEVQAVNGVSD--QSPYSPQYASVNITTNQAAPSTVSIMH--QVSRSVDSITLSWSQPDQPNGVI----LDYELQYYEKDLSEHNASTI----RSQTNTVVIRGLKPGSIYVFQVRARTVAGFGRYS-GKLYFQTMTEEEYNTSIQEKLPLIIGSAAAGLVFLIALVVI--------------------------IIVCNRRR--------GFDRHDSEYTDKLQH-YTSGHMTPGMKI--YIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGNLKLPGKREMFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSSPVMIITEFMENGSLDTFLRQNDGQFTVIQLVGMLRGIASGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNNRPKFSQIVNNLDKM 880          
BLAST of Ephrin type-A receptor 4-B vs. Planmine SMEST
Match: SMESG000077240.1 (SMESG000077240.1)

HSP 1 Score: 2275.36 bits (5895), Expect = 0.000e+0
Identity = 1116/1132 (98.59%), Postives = 1123/1132 (99.20%), Query Frame = 3
Query:  153 MNWIISWLWIMDLINLFYCEKVLLLNTSISGWNNWKKNTKTYEGWRIQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLIECINCPNKLVFLPSSKTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQISSQLCVTIKKNETDRKDFKNCETAHLLMHCSDLNKDPVYDVTAPQPPPRNLILDVKGSKIGPEMNNLFSMYPRKSFGCLNNPGSNDLTNTSPKIEDGSQTISLTRMNHQNIFHQPYQYFQNKTFYQPCLSQGYHESHSFVPDFFSSKFPEIPPHRNTLSRTKLTRIPIEDFLNNLHLSHFIPNFLKNGY-----ITQIKYPKLKL 3533
            MNWIISWLWIMDLINLFYCEKVLLLNTSISGWNNWKKNTKTYEGWRIQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVI+AFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTW+SPFYIESSEAVSDNISYYLIECINCPNKLVFLPSSKTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELK+KIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMILGSILLVAVLLIIIILVTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGS+SYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIK TAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQISSQLCVTIKKNETDRKDFKNCETAHLLMHCSDLNKDPVYDVTAPQPPPRNLILDVKGSKIGPEMNNLFSMYPRKSFGCLNNPGSNDLTNTSPKIEDGSQTISLTRMNHQNIFHQPYQYFQNKTFYQPCLSQGYHESHSFVPDFFSSKFPEIPPHRNTLSRTKLTRIPIEDFLNNLHLSHFIPNFLKNG      I+QIK  +LK+
Sbjct:    1 MNWIISWLWIMDLINLFYCEKVLLLNTSISGWNNWKKNTKTYEGWRIQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIIAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWSSPFYIESSEAVSDNISYYLIECINCPNKLVFLPSSKTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKMKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMILGSILLVAVLLIIIILVTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSNSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKWTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQISSQLCVTIKKNETDRKDFKNCETAHLLMHCSDLNKDPVYDVTAPQPPPRNLILDVKGSKIGPEMNNLFSMYPRKSFGCLNNPGSNDLTNTSPKIEDGSQTISLTRMNHQNIFHQPYQYFQNKTFYQPCLSQGYHESHSFVPDFFSSKFPEIPPHRNTLSRTKLTRIPIEDFLNNLHLSHFIPNFLKNGIYYTDQISQIKTDQLKM 1132          

HSP 2 Score: 82.4185 bits (202), Expect = 1.637e-15
Identity = 40/42 (95.24%), Postives = 40/42 (95.24%), Query Frame = 2
Query: 3488 KKWIYYTDQISQIKTDQLKMIGILSVNDQKKIIRAVQPPMYC 3613
            K  IYYTDQISQIKTDQLKMIGILSVNDQKKIIRAVQPPMYC
Sbjct: 1113 KNGIYYTDQISQIKTDQLKMIGILSVNDQKKIIRAVQPPMYC 1154          
BLAST of Ephrin type-A receptor 4-B vs. Planmine SMEST
Match: SMESG000077240.1 (SMESG000077240.1)

HSP 1 Score: 2253.79 bits (5839), Expect = 0.000e+0
Identity = 1106/1122 (98.57%), Postives = 1113/1122 (99.20%), Query Frame = 3
Query:  183 MDLINLFYCEKVLLLNTSISGWNNWKKNTKTYEGWRIQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLIECINCPNKLVFLPSSKTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQISSQLCVTIKKNETDRKDFKNCETAHLLMHCSDLNKDPVYDVTAPQPPPRNLILDVKGSKIGPEMNNLFSMYPRKSFGCLNNPGSNDLTNTSPKIEDGSQTISLTRMNHQNIFHQPYQYFQNKTFYQPCLSQGYHESHSFVPDFFSSKFPEIPPHRNTLSRTKLTRIPIEDFLNNLHLSHFIPNFLKNGY-----ITQIKYPKLKL 3533
            MDLINLFYCEKVLLLNTSISGWNNWKKNTKTYEGWRIQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVI+AFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTW+SPFYIESSEAVSDNISYYLIECINCPNKLVFLPSSKTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELK+KIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMILGSILLVAVLLIIIILVTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGS+SYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIK TAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQISSQLCVTIKKNETDRKDFKNCETAHLLMHCSDLNKDPVYDVTAPQPPPRNLILDVKGSKIGPEMNNLFSMYPRKSFGCLNNPGSNDLTNTSPKIEDGSQTISLTRMNHQNIFHQPYQYFQNKTFYQPCLSQGYHESHSFVPDFFSSKFPEIPPHRNTLSRTKLTRIPIEDFLNNLHLSHFIPNFLKNG      I+QIK  +LK+
Sbjct:    1 MDLINLFYCEKVLLLNTSISGWNNWKKNTKTYEGWRIQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIIAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWSSPFYIESSEAVSDNISYYLIECINCPNKLVFLPSSKTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKMKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMILGSILLVAVLLIIIILVTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSNSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKWTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQISSQLCVTIKKNETDRKDFKNCETAHLLMHCSDLNKDPVYDVTAPQPPPRNLILDVKGSKIGPEMNNLFSMYPRKSFGCLNNPGSNDLTNTSPKIEDGSQTISLTRMNHQNIFHQPYQYFQNKTFYQPCLSQGYHESHSFVPDFFSSKFPEIPPHRNTLSRTKLTRIPIEDFLNNLHLSHFIPNFLKNGIYYTDQISQIKTDQLKM 1122          

HSP 2 Score: 82.8037 bits (203), Expect = 1.411e-15
Identity = 40/42 (95.24%), Postives = 40/42 (95.24%), Query Frame = 2
Query: 3488 KKWIYYTDQISQIKTDQLKMIGILSVNDQKKIIRAVQPPMYC 3613
            K  IYYTDQISQIKTDQLKMIGILSVNDQKKIIRAVQPPMYC
Sbjct: 1103 KNGIYYTDQISQIKTDQLKMIGILSVNDQKKIIRAVQPPMYC 1144          
BLAST of Ephrin type-A receptor 4-B vs. Planmine SMEST
Match: SMESG000008191.1 (SMESG000008191.1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 350/930 (37.63%), Postives = 529/930 (56.88%), Query Frame = 3
Query:  180 IMDLINLFYCEKVLLLNTSISGWNNWKKNTKTYEGWRIQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIE-NIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVVGKCVEGG-VRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNIS-YYLIECINCPN--KLVFLPSSKTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQ--TNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTD---LIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNFVTTASF-STITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKI-VAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 2933
            +  ++N      V LLNT  S WN+W KN+  Y+GWR QN+PPNA  VYG+C +   S ++WLRSPFI RD  +S+ I++SFTMR CK+ P+ +   +CE+T  L+ YE+DS  +    +N+R +  +  IS +  W    + ENI+N+   SI  RR G  +A ++ G+C M+K + +YY+AC      F  + R     +   RNV G CV+G  +       Q++  CQ  G W   +    C C  G    DSK  CIKC +N YK  +GSEKCI CP+ +YS  G+  C+CN+G + I +    ++C +P   PRN+  + +D+ ++ L+W++   I+ S ++ ++   ++ I CI+C +  +L F P     ++ V++      + Y F V+S++ VS ++ N    + SS+ +S+ TKP +   +L    +Q   NK  + +SW+  +    I+ YE +         ++ +FN DS       N    F     D   +  +  KVR R+   WG F  +K               +I L + V   +F   I +  T++ +  K  +M+I    +   ++LI I L  YC R     +M  +K KN     ++   +   S     + T   Y +P+ YED S  + +F  EIDP+ +   T+IG+GEFG V +G L   E  +KI VA+K LK G SEKER +FL+EA+ MGQF + N+++LEG++T +   MIIT+F+  GSL TFLR KK + +T+QLL ML  + +GMKYLS + ++HRDLAARNIL+D++L CKV+DFGLSRE+   + +  YT K  G +PI+ TAPEAI Y +F+ +SDVWSFG+V WEV+SYGE+PYW W N +V+ +I+SGYRLP P  CPP +H LML CW     +RP F  I + I  +
Sbjct:   12 VFSIVNCRVPNYVELLNTETSRWNDWVKNSGKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQR--LNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDVRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRIRNVKGICVDGAELISLEKRPQLI--CQPTGQWHISDFM-FCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDASHIIDPSISIENSFKVHFRIICISCKDSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVS-HLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQ----NVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSK---------------QINLKDLVKLKAFDGGIDESNTYLSSQNK--LMIISVFGMGFILMLIAIPLCFYC-RYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIHIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLVMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISAL 912          
BLAST of Ephrin type-A receptor 4-B vs. Planmine SMEST
Match: SMESG000018920.1 (SMESG000018920.1)

HSP 1 Score: 419.853 bits (1078), Expect = 1.592e-127
Identity = 301/966 (31.16%), Postives = 479/966 (49.59%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWRIQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVVGKCVEGGVRKHNSDEQIVN-YCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSASCICNQGYY-------EIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLIECINCP-NKLVFLPSSKTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPF-DMDQSSSKISLLTKPLENIEKLKLKSIQTNKHG-IVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNA----DSIFHVFTTNTSCSFINLM--TDLIYFVAKVRPRNYKGWGQFSE--TKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTK---YQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLS-RELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQ----ISSQLCVTIKKNETDRKDFKNCETAHLLMHCS 3026
            E ++LL+T    W  WK N+  Y GWR QN PP+ D+VYG+C V     ++WL SP I   +  S+ I+  FTMR C+NYPDP  L+ CE+T  LL YE++   E+ + N R F  +  +   NKW   +  ++ +N ++ SI V+ L                 V V YLAC   +++F  F RT +  +    NVVGKCV+G V+K    +Q+ + +CQ+NGLW D      C CG G        SCI C++  +K + G  +C  CP+ + S +G +SC C + Y+       E+P+M     C + P+ P+++  D +D +++ILTW  P   +S++   D+I YY + C  C   +L F+P      T V +LG    + Y F V+SV  +S Y  N   +  QSS ++ L   P  N ++L    I    +G  ++SW +P +  + VE   V  G      N  + NA        +++T    C +  ++  TD+    A+V+ ++   W +FS     +I   +N            T+ V  + F  I         P  DV+ +    +  V + +II+ +V   I++ +  ++ R    N K +  S  +   SS  S+   + ++   Y   +++++++  +     EI P+ +   T+   G+F  VY G +  P      + + V K    ++ R   L +   + QF +EN++ + G  T S   M+I EF  NG L  FL+  +  +  +QLL+ L N+A GM YLS   FIH+ L+  N+ ++E+LVCK++   LS  E  + D    + ++      +   APE +    +S +SDVW++GV  WEVLSYGEKPYW W+   V   I  GYRLPPP NC   +H LML CW L+   RP+F  +   ++Q    I +QL V +   +     FK+ E  H   H S
Sbjct:   13 ENIVLLDTMKDDWRGWKTNSGKYSGWRTQNTPPDGDKVYGLCMVHRADNDNWLYSPIIPTGEANSIIIETYFTMRNCRNYPDPNKLKICEDTIHLLAYETNDLQESTNQNNRLFKQVAVLFPQNKWSKDNSEQSAMNSHKKSIPVKGL-----------------VRVLYLACPSIVNSFTEFSRTVSKQDFDLVNVVGKCVKGAVQKVGQADQLQSRFCQSNGLWHDMGTVN-CHCGPGFTATADWKSCIPCASGTFKSIAGPIRCSYCPKYSQSESGQSSCTCEKDYFKKIIHAKEVPDM----ICLRLPNAPKDLRADITDGSKVILTWEFPSTSDSND--HDSIEYYHVFCYQCLFERLQFIPGINVTGTSVTILGLNFGQSYVFSVTSVASISNYSRNIHPNPSQSSVRLFL---PKSNPQRLNPVKITKQTNGTFLISWTEPDT-INPVEMYLVQIG------NVIMSNATGYQSRYQYIYTRRPHCLYKPILRSTDI---YARVKYKSNNIWSEFSPDILSNIIFPENSFNEN-------TSKVNRSVFPWI---------PNLDVIFL---CVTSVVITVIIVSVVIILIQKYVYASLKRT--NNRKLKDLSLVENTKSSYASITASSPSRGRSYFYLSSFDNLTPTVQKSLNEIQPELVIMKTLSRSGKFFDVYSGSIKQPRRLAMNITLYVFKIELQDEIRTKMLEDCINISQFQHENLINILGFCTVSSPKMVILEFTENGCLHDFLKKNEELINMLQLLEFLRNIACGMHYLSERKFIHKKLSTHNVFINESLVCKISICLLSWSEDPEVDIGCKFIDENKCYDAVSWMAPEILRENTYSTSSDVWAYGVTMWEVLSYGEKPYWDWTVEYVSKVILEGYRLPPPKNCHQNLHLLMLTCWVLDPTLRPSFLTLLRSLDQLINYIENQL-VCLNNVDKSNDAFKSNELIHECTHSS 919          
BLAST of Ephrin type-A receptor 4-B vs. Planmine SMEST
Match: SMESG000018920.1 (SMESG000018920.1)

HSP 1 Score: 419.853 bits (1078), Expect = 1.732e-127
Identity = 301/966 (31.16%), Postives = 479/966 (49.59%), Query Frame = 3
Query:  210 EKVLLLNTSISGWNNWKKNTKTYEGWRIQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVVGKCVEGGVRKHNSDEQIVN-YCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSASCICNQGYY-------EIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIESSEAVSDNISYYLIECINCP-NKLVFLPSSKTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPF-DMDQSSSKISLLTKPLENIEKLKLKSIQTNKHG-IVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNA----DSIFHVFTTNTSCSFINLM--TDLIYFVAKVRPRNYKGWGQFSE--TKSIARKKNELKLKIPTKIRLTNFVTTASFSTITDIKTFIINPEKDVVMMXXXXXXXXXXXXXXXXXXTYCIRRQMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTK---YQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLS-RELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQ----ISSQLCVTIKKNETDRKDFKNCETAHLLMHCS 3026
            E ++LL+T    W  WK N+  Y GWR QN PP+ D+VYG+C V     ++WL SP I   +  S+ I+  FTMR C+NYPDP  L+ CE+T  LL YE++   E+ + N R F  +  +   NKW   +  ++ +N ++ SI V+ L                 V V YLAC   +++F  F RT +  +    NVVGKCV+G V+K    +Q+ + +CQ+NGLW D      C CG G        SCI C++  +K + G  +C  CP+ + S +G +SC C + Y+       E+P+M     C + P+ P+++  D +D +++ILTW  P   +S++   D+I YY + C  C   +L F+P      T V +LG    + Y F V+SV  +S Y  N   +  QSS ++ L   P  N ++L    I    +G  ++SW +P +  + VE   V  G      N  + NA        +++T    C +  ++  TD+    A+V+ ++   W +FS     +I   +N            T+ V  + F  I         P  DV+ +    +  V + +II+ +V   I++ +  ++ R    N K +  S  +   SS  S+   + ++   Y   +++++++  +     EI P+ +   T+   G+F  VY G +  P      + + V K    ++ R   L +   + QF +EN++ + G  T S   M+I EF  NG L  FL+  +  +  +QLL+ L N+A GM YLS   FIH+ L+  N+ ++E+LVCK++   LS  E  + D    + ++      +   APE +    +S +SDVW++GV  WEVLSYGEKPYW W+   V   I  GYRLPPP NC   +H LML CW L+   RP+F  +   ++Q    I +QL V +   +     FK+ E  H   H S
Sbjct:   13 ENIVLLDTMKDDWRGWKTNSGKYSGWRTQNTPPDGDKVYGLCMVHRADNDNWLYSPIIPTGEANSIIIETYFTMRNCRNYPDPNKLKICEDTIHLLAYETNDLQESTNQNNRLFKQVAVLFPQNKWSKDNSEQSAMNSHKKSIPVKGL-----------------VRVLYLACPSIVNSFTEFSRTVSKQDFDLVNVVGKCVKGAVQKVGQADQLQSRFCQSNGLWHDMGTVN-CHCGPGFTATADWKSCIPCASGTFKSIAGPIRCSYCPKYSQSESGQSSCTCEKDYFKKIIHAKEVPDM----ICLRLPNAPKDLRADITDGSKVILTWEFPSTSDSND--HDSIEYYHVFCYQCLFERLQFIPGINVTGTSVTILGLNFGQSYVFSVTSVASISNYSRNIHPNPSQSSVRLFL---PKSNPQRLNPVKITKQTNGTFLISWTEPDT-INPVEMYLVQIG------NVIMSNATGYQSRYQYIYTRRPHCLYKPILRSTDI---YARVKYKSNNIWSEFSPDILSNIIFPENSFNEN-------TSKVNRSVFPWI---------PNLDVIFL---CVTSVVITVIIVSVVIILIQKYVYASLKRT--NNRKLKDLSLVENTKSSYASITASSPSRGRSYFYLSSFDNLTPTVQKSLNEIQPELVIMKTLSRSGKFFDVYSGSIKQPRRLAMNITLYVFKIELQDEIRTKMLEDCINISQFQHENLINILGFCTVSSPKMVILEFTENGCLHDFLKKNEELINMLQLLEFLRNIACGMHYLSERKFIHKKLSTHNVFINESLVCKISICLLSWSEDPEVDIGCKFIDENKCYDAVSWMAPEILRENTYSTSSDVWAYGVTMWEVLSYGEKPYWDWTVEYVSKVILEGYRLPPPKNCHQNLHLLMLTCWVLDPTLRPSFLTLLRSLDQLINYIENQL-VCLNNVDKSNDAFKSNELIHECTHSS 919          
The following BLAST results are available for this feature:
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPHA45.490e-15334.34EPH receptor A4 [Source:HGNC Symbol;Acc:HGNC:3388][more]
EPHA41.008e-15234.34EPH receptor A4 [Source:HGNC Symbol;Acc:HGNC:3388][more]
EPHA41.008e-15234.34EPH receptor A4 [Source:HGNC Symbol;Acc:HGNC:3388][more]
EPHB13.605e-14932.69EPH receptor B1 [Source:HGNC Symbol;Acc:HGNC:3392][more]
EPHB13.781e-14832.69EPH receptor B1 [Source:HGNC Symbol;Acc:HGNC:3392][more]
back to top
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vab-16.690e-7343.13Ephrin receptor 1 [Source:UniProtKB/Swiss-Prot;Ac... [more]
vab-16.359e-7142.45Ephrin receptor 1 [Source:UniProtKB/Swiss-Prot;Ac... [more]
src-22.422e-5639.49Tyrosine protein-kinase src-2 [Source:UniProtKB/S... [more]
abl-14.207e-5536.28Tyrosine-protein kinase abl-1 [Source:UniProtKB/S... [more]
abl-14.334e-5536.28Tyrosine-protein kinase abl-1 [Source:UniProtKB/S... [more]
back to top
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eph1.287e-9449.08gene:FBgn0025936 transcript:FBtr0301285[more]
Eph2.916e-9449.08gene:FBgn0025936 transcript:FBtr0089083[more]
Eph5.066e-9449.08gene:FBgn0025936 transcript:FBtr0089082[more]
Eph5.066e-9449.08gene:FBgn0025936 transcript:FBtr0089086[more]
Eph6.916e-9449.08gene:FBgn0025936 transcript:FBtr0089085[more]
back to top
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ephb2a4.398e-14832.91eph receptor B2a [Source:ZFIN;Acc:ZDB-GENE-070713-... [more]
ephb4b1.013e-14731.53eph receptor B4b [Source:NCBI gene;Acc:30691][more]
ephb2b3.135e-14732.84eph receptor B2b [Source:ZFIN;Acc:ZDB-GENE-050522-... [more]
AL929508.21.065e-14633.44eph receptor B2a [Source:NCBI gene;Acc:562176][more]
epha4a1.759e-14632.45eph receptor A4a [Source:NCBI gene;Acc:64271][more]
back to top
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sik13.025e-15533.37salt inducible kinase 1 [Source:Xenbase;Acc:XB-GEN... [more]
sik12.728e-15433.93salt inducible kinase 1 [Source:Xenbase;Acc:XB-GEN... [more]
sik14.151e-15433.93salt inducible kinase 1 [Source:Xenbase;Acc:XB-GEN... [more]
sik17.310e-15434.04salt inducible kinase 1 [Source:Xenbase;Acc:XB-GEN... [more]
sik17.573e-15434.04salt inducible kinase 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Epha43.295e-15134.02Eph receptor A4 [Source:MGI Symbol;Acc:MGI:98277][more]
Epha43.295e-15134.02Eph receptor A4 [Source:MGI Symbol;Acc:MGI:98277][more]
Epha43.295e-15134.02Eph receptor A4 [Source:MGI Symbol;Acc:MGI:98277][more]
Ephb12.607e-14932.98Eph receptor B1 [Source:MGI Symbol;Acc:MGI:1096337... [more]
Ephb22.422e-14633.78Eph receptor B2 [Source:MGI Symbol;Acc:MGI:99611][more]
back to top
BLAST of Ephrin type-A receptor 4-B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q07496|EPHA4_CHICK5.069e-15334.67Ephrin type-A receptor 4 OS=Gallus gallus OX=9031 ... [more]
sp|P54764|EPHA4_HUMAN4.842e-15234.34Ephrin type-A receptor 4 OS=Homo sapiens OX=9606 G... [more]
sp|Q03137|EPHA4_MOUSE2.305e-15034.02Ephrin type-A receptor 4 OS=Mus musculus OX=10090 ... [more]
sp|P09759|EPHB1_RAT4.558e-14932.80Ephrin type-B receptor 1 OS=Rattus norvegicus OX=1... [more]
sp|P54762|EPHB1_HUMAN1.731e-14832.69Ephrin type-B receptor 1 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Ephrin type-A receptor 4-B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PUI01.579e-16635.62Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3I2669.830e-16033.87ephrin type-B receptor 1-B isoform X5 OS=Lingula u... [more]
A0A1S3HZJ62.863e-15933.76ephrin type-B receptor 1-B isoform X4 OS=Lingula u... [more]
A0A1S3HZJ31.087e-15833.47ephrin type-B receptor 1-B isoform X1 OS=Lingula u... [more]
A0A1S3I0T41.604e-15833.33ephrin type-B receptor 1-B isoform X2 OS=Lingula u... [more]
back to top
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ephb2a7.840e-14733.23EPH receptor B2 [Source:NCBI gene;Acc:103031596][more]
ephb12.220e-14533.82ephrin type-B receptor 1 [Source:NCBI gene;Acc:103... [more]
ephb12.267e-14534.00ephrin type-B receptor 1 [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000021869.23.510e-14332.35EPH receptor A5 [Source:NCBI gene;Acc:103045667][more]
epha74.271e-14132.81EPH receptor A7 [Source:NCBI gene;Acc:103040681][more]
back to top
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010247.13.854e-15133.19pep scaffold:Pmarinus_7.0:GL476398:264473:324965:1... [more]
ENSPMAT00000007292.17.421e-15033.83pep scaffold:Pmarinus_7.0:GL476471:161062:207122:1... [more]
EPHB21.922e-14232.55EPH receptor B2 [Source:HGNC Symbol;Acc:HGNC:3393][more]
ENSPMAT00000002245.13.018e-12732.06pep scaffold:Pmarinus_7.0:GL476603:2572:131951:1 g... [more]
ENSPMAT00000010328.11.085e-10032.04pep scaffold:Pmarinus_7.0:GL478135:2434:69706:1 ge... [more]
back to top
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BCK11.221e-2328.72MAPKKK acting in the protein kinase C signaling pa... [more]
CDC151.764e-2026.79Protein kinase of the Mitotic Exit Network; locali... [more]
FRK13.524e-1627.19Protein kinase of unknown cellular role; green flu... [more]
SPS11.736e-1527.43Putative protein serine/threonine kinase; localize... [more]
SSK22.448e-1527.72MAP kinase kinase kinase of HOG1 mitogen-activated... [more]
back to top
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO409946.183e-10150.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337361.588e-9250.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337321.201e-8152.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337317.610e-8152.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289801.915e-7852.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ephrin type-A receptor 4-B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ephb13.533e-14932.46ephrin type-B receptor 1-B [Source:NCBI gene;Acc:1... [more]
ephb19.368e-14933.22ephrin type-B receptor 1-B [Source:NCBI gene;Acc:1... [more]
ephb2a1.881e-14833.44ephrin type-B receptor 2-like [Source:NCBI gene;Ac... [more]
ephb2b7.776e-14833.23ephrin type-B receptor 2 [Source:NCBI gene;Acc:101... [more]
ephb2b2.111e-14733.01ephrin type-B receptor 2 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Ephrin type-A receptor 4-B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077240.11.637e-1598.59SMESG000077240.1[more]
SMESG000077240.11.411e-1598.57SMESG000077240.1[more]
SMESG000008191.10.000e+037.63SMESG000008191.1[more]
SMESG000018920.11.592e-12731.16SMESG000018920.1[more]
SMESG000018920.11.732e-12731.16SMESG000018920.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030699 ID=SMED30030699|Name=Ephrin type-A receptor 4-B|organism=Schmidtea mediterranea sexual|type=transcript|length=3697bp
CAATCACAACTCGTTTAGAACAGATCTTGATATAAAAATAAAATACCTTA
CAGGGCTGATTAACGAAAATTTACGGAAGAAATTGACTAGAAAATTATTG
CCGAAAGAATTTTGGTTATTCTGCTAGTAATTTTATTCACCGAAATCACT
CCATGAATTGGATTATATCATGGCTCTGGATAATGGATTTGATAAATCTG
TTTTATTGTGAAAAAGTTTTACTTCTCAACACGTCAATTAGTGGATGGAA
TAATTGGAAGAAAAATACAAAAACATATGAAGGGTGGAGAATTCAAAACC
TTCCACCAAATGCCGATGAGGTTTATGGAGTTTGCGAAGTCGATCATCCT
TCTGCCAATAGTTGGTTAAGGTCGCCTTTTATTTCAAGAGATAAAGGGAT
AAGTTTACATATCAAAGTTTCGTTCACAATGAGAGAGTGCAAAAATTATC
CAGATCCCAAATCTTTGAGACATTGTGAAGAGACTTTTACACTTTTGAAA
TACGAATCTGATTCACCAATCGAGAATATTCACTACAACGAAAGGACATT
TGCAATAATTGGAACAATATCGTCCAACAATAAATGGGAAACTAAAGACA
GGACGGAAAACATATTGAACATTTATGAGACTAGCATATCAGTACGTAGA
TTAGGTGTCATTGTAGCGTTCCAAAATACCGGTTCCTGTGTCATGATTAA
AGAAGTTGTTGTTTATTATCTTGCATGCCAAGAGAAAATGAGCAACTTTA
TTTATTTTCCAAGAACTGCAGCAGGATTTGAAAGTTACAATCGTAACGTT
GTAGGGAAATGTGTAGAAGGAGGAGTACGAAAGCATAATTCTGACGAACA
AATTGTGAATTATTGTCAAGCAAACGGATTATGGAAAGATGATAATGTTA
AAGAAGTTTGTGAATGTGGATCAGGAATGGAAGGTAACGATAGCAAAACT
AGTTGCATAAAATGCAGTAATAATTTTTACAAACTCTTACAAGGATCAGA
AAAATGCATTCCATGTCCACAAAACACATATAGCTTTACAGGATCAGCTT
CTTGTATTTGTAACCAAGGCTACTATGAAATTCCAAATATGAAACAGAAA
TTGACATGTAAAAAACCTCCAGATAAACCAAGAAATATTCTAATGGATTC
TTCAGATCAGGCAAGAATAATCCTTACTTGGAATTCTCCGTTTTACATTG
AGTCATCGGAAGCTGTCAGTGATAACATATCATACTACTTAATAGAATGT
ATCAACTGTCCAAATAAACTTGTCTTTCTTCCATCGTCAAAGACAAAAGA
AACAAAAGTAATCGTACTTGGAAGTCTTCCTAGTCGAGAATACGATTTCA
AAGTGAGCTCAGTCAATGATGTCAGTCAGTACGTAACAAATCCTTTTGAT
ATGGATCAAAGCTCCTCCAAAATATCTTTGCTTACAAAGCCATTAGAGAA
TATTGAAAAACTGAAATTGAAATCAATTCAAACTAACAAACATGGAATCG
TTCTTTCATGGAATCAGCCAACCTCACCAACTGACATCGTGGAATACGAA
TGTGTATCTTTTGGATTTAGGGATTATTTTAAGAACACCGATTTATTCAA
CGCAGATTCAATCTTTCATGTCTTTACAACAAACACGTCTTGTTCGTTTA
TTAATCTGATGACAGATTTGATTTATTTTGTTGCAAAGGTTCGACCTCGA
AACTATAAAGGATGGGGCCAGTTCAGTGAAACAAAATCAATTGCCAGAAA
AAAAAATGAATTAAAATTGAAAATACCAACAAAAATACGATTAACCAACT
TTGTCACAACAGCTTCATTTTCAACAATAACTGATATAAAAACCTTCATT
ATTAATCCAGAAAAAGACGTGGTGATGATGATATTGGGCTCGATTTTATT
GGTAGCTGTGTTGCTTATTATTATTATATTAGTTACATATTGTATCCGAC
GACAAATGATGTTTAACATGTACAGACAAAAATTTAAAAATGAAAAGTTT
GAAGCAACGAGCCCGACTCAGATTATTTATTCTAGTGCATATTCTTTACC
AAATCAGACGTATACTAAATACCAAAATCCTAATACTTATGAAGACATTA
GTGTTGCTCTTCATGATTTTACCAAAGAAATAGATCCCAAATGGTTAACA
ACAAGCACTATCATTGGGCAAGGAGAATTTGGTCATGTTTATCAAGGTGT
GCTCTTTGTTCCGGAGGACGAGAGAAAAATAGTGGCTGTCAAGGTGTTGA
AAGATGGAGCGTCAGAAAAAGAGAGAAACGATTTTTTAGTCGAAGCAAGC
ACAATGGGACAATTTATGAATGAAAATGTGCTAAAATTAGAAGGCGTTAT
GACAGGTTCTGATTCTTACATGATTATTACCGAGTTCATGGTGAACGGAT
CATTACTTACATTTTTAAGAATTAAAAAAAATGAATTAACGACAATCCAG
TTGTTGAAAATGCTAAGCAATGTGGCGAATGGGATGAAATATTTATCTTC
TATCGGATTTATTCATCGAGATTTAGCAGCGAGAAATATATTGCTGGATG
AAAATTTGGTTTGTAAAGTCGCAGATTTTGGGTTATCAAGAGAGCTTTCT
GACAAAGATGCGGATGACATCTATACAAATAAACCTGATGGAAAACTTCC
AATTAAATGTACAGCTCCAGAAGCGATTCTTTACGGTAAATTTAGTCATG
CGTCAGATGTTTGGTCATTTGGCGTTGTTTGTTGGGAGGTTCTATCATAT
GGTGAAAAACCATATTGGCAATGGTCAAATCACGAAGTCATTGATGCAAT
CCAATCCGGATATAGACTTCCGCCCCCAGTAAATTGTCCACCAATTATGC
ATAATCTCATGTTACATTGTTGGAATCTAAATTCTGACAAACGACCGACA
TTTCCTCATATTTCTTACGAGATCGAACAAATTAGTTCTCAGCTTTGCGT
AACTATTAAAAAGAATGAAACTGATAGAAAGGATTTCAAAAATTGTGAAA
CTGCTCATTTATTAATGCATTGTAGTGATCTAAATAAAGATCCGGTTTAT
GATGTAACAGCTCCTCAGCCACCTCCGAGAAATTTGATTTTAGATGTAAA
GGGATCAAAAATTGGTCCAGAAATGAATAATCTGTTTTCCATGTATCCAA
GGAAATCTTTTGGTTGTTTAAATAACCCGGGTTCAAATGATCTAACAAAT
ACATCTCCAAAAATAGAAGATGGATCTCAAACCATTTCATTAACAAGAAT
GAATCATCAAAATATCTTTCATCAGCCGTACCAATATTTCCAAAACAAAA
CATTTTATCAACCTTGCCTCTCACAAGGATATCACGAGTCTCACTCATTT
GTTCCAGATTTCTTTTCATCAAAGTTTCCAGAAATTCCTCCGCACAGAAA
TACGTTATCTCGCACCAAACTTACCAGAATACCGATAGAAGACTTTCTTA
ACAATTTGCATTTGTCACATTTCATTCCAAACTTCCTAAAAAATGGATAT
ATTACACAGATCAAATATCCCAAATTAAAACTGACCAACTGAAAATGATC
GGAATTTTGTCTGTCAATGATCAGAAAAAGATAATTAGAGCCGTGCAACC
CCCAATGTATTGTTAGAATATCAGATTATTATTTATTTATTTGAATATTG
TAAATAAAATGTTGTTTTCAAAGAATTTTGTTTAATTTAAATTTACA
back to top

protein sequence of SMED30030699-orf-1

>SMED30030699-orf-1 ID=SMED30030699-orf-1|Name=SMED30030699-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1130bp
MNWIISWLWIMDLINLFYCEKVLLLNTSISGWNNWKKNTKTYEGWRIQNL
PPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYP
DPKSLRHCEETFTLLKYESDSPIENIHYNERTFAIIGTISSNNKWETKDR
TENILNIYETSISVRRLGVIVAFQNTGSCVMIKEVVVYYLACQEKMSNFI
YFPRTAAGFESYNRNVVGKCVEGGVRKHNSDEQIVNYCQANGLWKDDNVK
EVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSAS
CICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWNSPFYIE
SSEAVSDNISYYLIECINCPNKLVFLPSSKTKETKVIVLGSLPSREYDFK
VSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQTNKHGIV
LSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFI
NLMTDLIYFVAKVRPRNYKGWGQFSETKSIARKKNELKLKIPTKIRLTNF
VTTASFSTITDIKTFIINPEKDVVMMILGSILLVAVLLIIIILVTYCIRR
QMMFNMYRQKFKNEKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDIS
VALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKIVAVKVLK
DGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSDSYMIITEFMVNGS
LLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDE
NLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKCTAPEAILYGKFSHA
SDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMH
NLMLHCWNLNSDKRPTFPHISYEIEQISSQLCVTIKKNETDRKDFKNCET
AHLLMHCSDLNKDPVYDVTAPQPPPRNLILDVKGSKIGPEMNNLFSMYPR
KSFGCLNNPGSNDLTNTSPKIEDGSQTISLTRMNHQNIFHQPYQYFQNKT
FYQPCLSQGYHESHSFVPDFFSSKFPEIPPHRNTLSRTKLTRIPIEDFLN
NLHLSHFIPNFLKNGYITQIKYPKLKLTN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR011641Tyr-kin_ephrin_A/B_rcpt-like
IPR001090Ephrin_rcpt_lig-bd_dom
IPR003961FN3_dom
IPR020635Tyr_kinase_cat_dom
IPR027936Eph_TM
IPR008979Galactose-bd-like_sf
IPR013783Ig-like_fold
IPR008266Tyr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
IPR009030Growth_fac_rcpt_cys_sf
IPR013761SAM/pointed_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0048013ephrin receptor signaling pathway
GO:0007155cell adhesion
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007275multicellular organism development
GO:0007399nervous system development
GO:0007411axon guidance
GO:0007628adult walking behavior
GO:0008045motor neuron axon guidance
GO:0008347glial cell migration
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
GO:0021957corticospinal tract morphogenesis
GO:0043087regulation of GTPase activity
GO:0043507positive regulation of JUN kinase activity
GO:0046777protein autophosphorylation
GO:0048681negative regulation of axon regeneration
GO:0048710regulation of astrocyte differentiation
GO:0050770regulation of axonogenesis
GO:0050775positive regulation of dendrite morphogenesis
GO:0061001regulation of dendritic spine morphogenesis
GO:0072178nephric duct morphogenesis
GO:0097155fasciculation of sensory neuron axon
GO:0097156fasciculation of motor neuron axon
GO:2001108positive regulation of Rho guanyl-nucleotide exchange factor activity
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0004713protein tyrosine kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0005003ephrin receptor activity
GO:0005004GPI-linked ephrin receptor activity
GO:0005005transmembrane-ephrin receptor activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0042731PH domain binding
GO:0042802identical protein binding
GO:0046875ephrin receptor binding
GO:0097161DH domain binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005741mitochondrial outer membrane
GO:0005768endosome
GO:0005769early endosome
GO:0005783endoplasmic reticulum
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0009986cell surface
GO:0014069postsynaptic density
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030175filopodium
GO:0030424axon
GO:0030425dendrite
GO:0031594neuromuscular junction
GO:0031901early endosome membrane
GO:0042995cell projection
GO:0043197dendritic spine
GO:0043204perikaryon
GO:0043679axon terminus
GO:0044295axonal growth cone
GO:0044297cell body
GO:0045202synapse
GO:0045211postsynaptic membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 743..756
score: 53.8
coord: 851..873
score: 57.0
coord: 780..798
score: 62.58
coord: 832..842
score: 69.23
coord: 895..917
score: 42.18
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 666..921
e-value: 4.1E-90
score: 301.6
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 323..410
e-value: 0.0089
score: 25.2
coord: 431..522
e-value: 33.0
score: 7.0
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 322..431
score: 9.555
IPR003961Fibronectin type IIICDDcd00063FN3coord: 323..406
e-value: 1.41631E-5
score: 42.8687
IPR003961Fibronectin type IIICDDcd00063FN3coord: 438..530
e-value: 3.76523E-4
score: 38.6315
IPR001090Ephrin receptor ligand binding domainSMARTSM00615ephcoord: 21..192
e-value: 1.4E-18
score: 77.7
IPR001090Ephrin receptor ligand binding domainPFAMPF01404Ephrin_lbdcoord: 26..192
e-value: 8.5E-33
score: 113.9
IPR001090Ephrin receptor ligand binding domainPROSITEPS51550EPH_LBDcoord: 1..197
score: 33.798
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 665..927
e-value: 1.3E-126
score: 436.6
IPR011641Tyrosine-protein kinase ephrin type A/B receptor-likeSMARTSM01411GCC2_GCC3_2coord: 258..301
e-value: 7.7E-6
score: 35.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 322..419
e-value: 2.4E-8
score: 36.2
NoneNo IPR availableGENE3DG3DSA:2.10.50.10coord: 257..321
e-value: 7.2E-11
score: 43.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.1770coord: 196..245
e-value: 1.1E-5
score: 27.1
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 746..932
e-value: 4.9E-55
score: 187.8
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 639..745
e-value: 2.6E-29
score: 103.3
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 628..939
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 52..544
NoneNo IPR availablePANTHERPTHR24416:SF296EPHRIN TYPE-B RECEPTOR 4coord: 628..939
NoneNo IPR availablePANTHERPTHR24416:SF296EPHRIN TYPE-B RECEPTOR 4coord: 52..544
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.845
NoneNo IPR availableTMHMMTMhelixcoord: 573..595
NoneNo IPR availableTMHMMTMhelixcoord: 487..509
IPR027936Ephrin receptor, transmembrane domainPFAMPF14575EphA2_TMcoord: 577..662
e-value: 9.4E-10
score: 39.2
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 19..195
e-value: 1.4E-35
score: 124.6
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 23..190
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 786..798
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 671..697
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 665..931
score: 36.047
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 649..927
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 252..325
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 322..530