Microtubule-associated proteins 1A/1B light chain 3C

Overview
NameMicrotubule-associated proteins 1A/1B light chain 3C
Smed IDSMED30030670
Length (bp)604
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Microtubule-associated proteins 1A/1B light chain 3C (SMED30030670) t-SNE clustered cells

Violin plots show distribution of expression levels for Microtubule-associated proteins 1A/1B light chain 3C (SMED30030670) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Microtubule-associated proteins 1A/1B light chain 3C (SMED30030670) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Microtubule-associated proteins 1A/1B light chain 3C (SMED30030670) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030670

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30030670SMESG000067960.1 SMESG000079855.1 SMESG000037170.1 dd_Smed_v4_2838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030670SMESG000067960.1 SMESG000079855.1 SMESG000037170.1 dd_Smed_v4_2838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030670SMESG000067960.1 SMESG000079855.1 SMESG000037170.1 dd_Smed_v4_2838_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Human
Match: MAP1LC3C (microtubule associated protein 1 light chain 3 gamma [Source:HGNC Symbol;Acc:HGNC:13353])

HSP 1 Score: 147.132 bits (370), Expect = 9.064e-45
Identity = 66/116 (56.90%), Postives = 92/116 (79.31%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            PFK +K+   R  E   I+++FPNKIP++VERY +E  LP LDKTK+LVPQELT++QF+ I+R+RM +++ +  YLL+NNKS+V+MS+T+++IY   KD DGF+YMTYASQE FG 
Sbjct:   12 PFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFGC 127          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Human
Match: MAP1LC3B (microtubule associated protein 1 light chain 3 beta [Source:HGNC Symbol;Acc:HGNC:13352])

HSP 1 Score: 135.961 bits (341), Expect = 1.162e-40
Identity = 57/114 (50.00%), Postives = 87/114 (76.32%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK ++TF QR+ + + I+ + P KIP+I+ERY  EK LP+LDKTK+LVP  + +S+ + I+R R+++ ++Q  +LL+N  SMV++S+ +S++YE +KD DGFLYM YASQE FG
Sbjct:    7 FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG 120          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Human
Match: MAP1LC3B (microtubule associated protein 1 light chain 3 beta [Source:HGNC Symbol;Acc:HGNC:13352])

HSP 1 Score: 135.961 bits (341), Expect = 1.162e-40
Identity = 57/114 (50.00%), Postives = 87/114 (76.32%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK ++TF QR+ + + I+ + P KIP+I+ERY  EK LP+LDKTK+LVP  + +S+ + I+R R+++ ++Q  +LL+N  SMV++S+ +S++YE +KD DGFLYM YASQE FG
Sbjct:    7 FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG 120          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Human
Match: MAP1LC3A (microtubule associated protein 1 light chain 3 alpha [Source:HGNC Symbol;Acc:HGNC:6838])

HSP 1 Score: 134.42 bits (337), Expect = 4.469e-40
Identity = 58/115 (50.43%), Postives = 84/115 (73.04%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            PFK +++F  R  E + I+ + P+KIP+I+ERY  EK LP+LDKTK+LVP  + +S+ V I+R R+++   Q  +LL+N  SMV++S+ ++ IYE +KD DGFLYM YASQE FG
Sbjct:    6 PFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 120          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Human
Match: MAP1LC3A (microtubule associated protein 1 light chain 3 alpha [Source:HGNC Symbol;Acc:HGNC:6838])

HSP 1 Score: 134.42 bits (337), Expect = 4.469e-40
Identity = 58/115 (50.43%), Postives = 84/115 (73.04%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            PFK +++F  R  E + I+ + P+KIP+I+ERY  EK LP+LDKTK+LVP  + +S+ V I+R R+++   Q  +LL+N  SMV++S+ ++ IYE +KD DGFLYM YASQE FG
Sbjct:    6 PFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 120          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Celegans
Match: lgg-2 (pep chromosome:WBcel235:IV:10934201:10935903:-1 gene:WBGene00002981.1 transcript:ZK593.6a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lgg-2)

HSP 1 Score: 114.39 bits (285), Expect = 1.619e-32
Identity = 52/128 (40.62%), Postives = 92/128 (71.88%), Query Frame = 3
Query:  135 GSRRSTVDSVFIP-FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            G+R  +  S  +P FK ++ F++R  + + I+S+ PNK+P+I+ER+  E++LPL+D+ K+LVP+ +T+++ + I+R R+++   Q  +LL+N +SMV+ S ++S +Y  ++DPDGF+YM Y SQ  FG
Sbjct:   15 GNRGGSYISGIVPSFKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG 142          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Celegans
Match: lgg-2 (pep chromosome:WBcel235:IV:10934186:10935914:-1 gene:WBGene00002981.1 transcript:ZK593.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lgg-2)

HSP 1 Score: 114.39 bits (285), Expect = 1.619e-32
Identity = 52/128 (40.62%), Postives = 92/128 (71.88%), Query Frame = 3
Query:  135 GSRRSTVDSVFIP-FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            G+R  +  S  +P FK ++ F++R  + + I+S+ PNK+P+I+ER+  E++LPL+D+ K+LVP+ +T+++ + I+R R+++   Q  +LL+N +SMV+ S ++S +Y  ++DPDGF+YM Y SQ  FG
Sbjct:   15 GNRGGSYISGIVPSFKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG 142          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Celegans
Match: lgg-1 (pep chromosome:WBcel235:II:6346960:6347719:-1 gene:WBGene00002980.1 transcript:C32D5.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lgg-1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.334e-22
Identity = 41/115 (35.65%), Postives = 73/115 (63.48%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            +K +  F +R  E   I+ ++P++IP+IVE+  K K L  LDK KYLVP +LT+ QF  ++R R++++ +  ++  +NN    TM +T+ Q+Y+   + D FLY+ Y+ + ++G 
Sbjct:    5 YKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSK-LHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTM-TTMGQLYQDHHEEDLFLYIAYSDESVYGG 117          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Celegans
Match: lgg-2 (pep chromosome:WBcel235:IV:10934201:10935825:-1 gene:WBGene00002981.1 transcript:ZK593.6b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lgg-2)

HSP 1 Score: 69.707 bits (169), Expect = 5.463e-16
Identity = 31/74 (41.89%), Postives = 54/74 (72.97%), Query Frame = 3
Query:  294 LDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            +D+ K+LVP+ +T+++ + I+R R+++   Q  +LL+N +SMV+ S ++S +Y  ++DPDGF+YM Y SQ  FG
Sbjct:    1 MDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG 74          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Celegans
Match: lgg-2 (pep chromosome:WBcel235:IV:10934201:10935825:-1 gene:WBGene00002981.1 transcript:ZK593.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lgg-2)

HSP 1 Score: 69.707 bits (169), Expect = 5.463e-16
Identity = 31/74 (41.89%), Postives = 54/74 (72.97%), Query Frame = 3
Query:  294 LDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            +D+ K+LVP+ +T+++ + I+R R+++   Q  +LL+N +SMV+ S ++S +Y  ++DPDGF+YM Y SQ  FG
Sbjct:    1 MDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG 74          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Fly
Match: Atg8b (gene:FBgn0038539 transcript:FBtr0346730)

HSP 1 Score: 85.1149 bits (209), Expect = 3.129e-21
Identity = 38/114 (33.33%), Postives = 71/114 (62.28%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            +K   +F++R  E   I+ ++P+++P+IVE+  K +    LDK KYLVP +LT+ QF  ++R R+ ++ D  ++  +NN  +   S+T+  +Y+   D D FLY++Y  + ++G
Sbjct:    7 YKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTR-YAELDKKKYLVPADLTVGQFYFLIRKRINLRPDDALFFFVNN-VIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 118          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Fly
Match: Atg8b (gene:FBgn0038539 transcript:FBtr0083533)

HSP 1 Score: 85.1149 bits (209), Expect = 3.129e-21
Identity = 38/114 (33.33%), Postives = 71/114 (62.28%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            +K   +F++R  E   I+ ++P+++P+IVE+  K +    LDK KYLVP +LT+ QF  ++R R+ ++ D  ++  +NN  +   S+T+  +Y+   D D FLY++Y  + ++G
Sbjct:    7 YKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTR-YAELDKKKYLVPADLTVGQFYFLIRKRINLRPDDALFFFVNN-VIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 118          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Fly
Match: Atg8a (gene:FBgn0052672 transcript:FBtr0071498)

HSP 1 Score: 84.3445 bits (207), Expect = 6.939e-21
Identity = 36/114 (31.58%), Postives = 71/114 (62.28%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            +K +  F +R  E   I+ ++P+++P+IVE+  K + +  LDK KYLVP +LT+ QF  ++R R+ ++ +  ++  +NN  +   S+T+  +Y+   + D FLY+ Y+ + ++G
Sbjct:    5 YKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKAR-IGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNN-VIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYG 116          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Fly
Match: Atg8a (gene:FBgn0052672 transcript:FBtr0346376)

HSP 1 Score: 63.1586 bits (152), Expect = 6.269e-13
Identity = 31/90 (34.44%), Postives = 56/90 (62.22%), Query Frame = 3
Query:  246 IPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            I +IVE+  K + +  LDK KYLVP +LT+ QF  ++R R+ ++ +  ++  +NN    T S+T+  +Y+   + D FLY+ Y+ + ++G
Sbjct:   15 IQVIVEKAPKAR-IGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPT-SATMGSLYQEHHEEDYFLYIAYSDENVYG 102          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Fly
Match: Atg8a (gene:FBgn0052672 transcript:FBtr0346375)

HSP 1 Score: 62.7734 bits (151), Expect = 6.640e-13
Identity = 29/88 (32.95%), Postives = 55/88 (62.50%), Query Frame = 3
Query:  252 IIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            +IVE+  K + +  LDK KYLVP +LT+ QF  ++R R+ ++ +  ++  +NN  +   S+T+  +Y+   + D FLY+ Y+ + ++G
Sbjct:    6 VIVEKAPKAR-IGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNN-VIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYG 91          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Zebrafish
Match: map1lc3c (microtubule-associated protein 1 light chain 3 gamma [Source:ZFIN;Acc:ZDB-GENE-040426-1080])

HSP 1 Score: 150.599 bits (379), Expect = 1.410e-46
Identity = 69/115 (60.00%), Postives = 89/115 (77.39%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            PFK +K+   R  E   I+++FP KIP+I+ERY +EK LP LDKTK+LVPQELT++QFV I+RNRM +  +Q  YLLINN  + +MS T++Q+Y+  KD DGFLYMTYASQEMFG
Sbjct:   12 PFKQRKSLATRKQEVAGIRTKFPTKIPVIIERYQREKFLPPLDKTKFLVPQELTMTQFVTIIRNRMTLMPNQAFYLLINNSGIASMSMTMAQLYKDHKDEDGFLYMTYASQEMFG 126          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Zebrafish
Match: map1lc3cl (microtubule-associated protein 1 light chain 3 gamma, like [Source:ZFIN;Acc:ZDB-GENE-140819-1])

HSP 1 Score: 145.976 bits (367), Expect = 9.247e-45
Identity = 63/117 (53.85%), Postives = 92/117 (78.63%), Query Frame = 3
Query:  168 IPFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            +PFK +K    R  E   I+S+FPNK+P+IVERY +EK LPLLDK+K+LVP ELTL QFV +LR+++ +++ Q +YLL++ K+M  +S+++ ++Y   +DPDGFLYMTYASQ+MFG+
Sbjct:   11 MPFKQRKCLATRKDEVCTIRSKFPNKLPVIVERYLREKKLPLLDKSKFLVPNELTLGQFVSLLRSKIALEASQALYLLVSGKNMSCLSASMGEVYSQFRDPDGFLYMTYASQDMFGS 127          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Zebrafish
Match: map1lc3cl (microtubule-associated protein 1 light chain 3 gamma, like [Source:ZFIN;Acc:ZDB-GENE-140819-1])

HSP 1 Score: 145.206 bits (365), Expect = 1.483e-44
Identity = 63/116 (54.31%), Postives = 91/116 (78.45%), Query Frame = 3
Query:  168 IPFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            +PFK +K    R  E   I+S+FPNK+P+IVERY +EK LPLLDK+K+LVP ELTL QFV +LR+++ +++ Q +YLL++ K+M  +S+++ ++Y   +DPDGFLYMTYASQ+MFG
Sbjct:   11 MPFKQRKCLATRKDEVCTIRSKFPNKLPVIVERYLREKKLPLLDKSKFLVPNELTLGQFVSLLRSKIALEASQALYLLVSGKNMSCLSASMGEVYSQFRDPDGFLYMTYASQDMFG 126          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Zebrafish
Match: map1lc3b (microtubule-associated protein 1 light chain 3 beta [Source:ZFIN;Acc:ZDB-GENE-030131-1145])

HSP 1 Score: 139.043 bits (349), Expect = 3.205e-42
Identity = 58/114 (50.88%), Postives = 88/114 (77.19%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK ++TF QR+ + + I+ + PNKIP+I+ERY  EK LP+LDKTK+LVP  + +S+ + I+R R+++ S+Q  +LL+N  SMV++S+ +S++YE ++D DGFLYM YASQE FG
Sbjct:    7 FKQRRTFEQRVEDVRLIREQHPNKIPVIIERYKGEKQLPILDKTKFLVPDHVNMSELIKIIRRRLQLNSNQAFFLLVNGHSMVSVSTAISEVYERERDEDGFLYMVYASQETFG 120          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Zebrafish
Match: map1lc3a (microtubule-associated protein 1 light chain 3 alpha [Source:ZFIN;Acc:ZDB-GENE-040426-2232])

HSP 1 Score: 137.887 bits (346), Expect = 9.334e-42
Identity = 59/116 (50.86%), Postives = 85/116 (73.28%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            PFK +++F  R  E + I+ + PNKIP+I+ERY  EK LP+LDKTK+LVP  + +S+ V I+R R+++   Q  +LL+N  SMV++S+ +S+IYE ++D DGFLYM YASQE FG 
Sbjct:    6 PFKQRRSFADRCKEVQQIREQHPNKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPISEIYEQERDEDGFLYMVYASQETFGC 121          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Xenopus
Match: map1lc3c (microtubule associated protein 1 light chain 3 gamma [Source:NCBI gene;Acc:733779])

HSP 1 Score: 149.443 bits (376), Expect = 4.244e-46
Identity = 68/115 (59.13%), Postives = 90/115 (78.26%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            PFK +K+   R  E   IK++FP KIP+IVERY +EK LPLLDKTK+LVP++L++ QF+ I+RNRM + + Q  YLL+NNKS+ +MS T++++Y   KD DGFLYMTYASQEMFG
Sbjct:   10 PFKQRKSLASRKEEVIGIKAKFPTKIPVIVERYRREKYLPLLDKTKFLVPKDLSMMQFINIIRNRMNLSATQAFYLLVNNKSLASMSLTMAELYRDHKDEDGFLYMTYASQEMFG 124          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Xenopus
Match: map1lc3a (microtubule associated protein 1 light chain 3 alpha [Source:NCBI gene;Acc:493344])

HSP 1 Score: 138.272 bits (347), Expect = 1.130e-41
Identity = 60/115 (52.17%), Postives = 84/115 (73.04%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            PFK ++TF +R  E + I+ + PNKIP+I+ERY  EK LP+LDKTK+LVP  + +S+ V I+R R+++   Q  +LL+N  SMV++S+ +  IYE +KD DGFLYM YASQE FG
Sbjct:    6 PFKHRRTFAERCAEVRQIREQHPNKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPILDIYEQEKDEDGFLYMVYASQETFG 120          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Xenopus
Match: wrnip1 (Werner helicase interacting protein 1 [Source:Xenbase;Acc:XB-GENE-985080])

HSP 1 Score: 134.035 bits (336), Expect = 2.233e-39
Identity = 57/117 (48.72%), Postives = 87/117 (74.36%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA*Y 524
            FK +++  QR+ + + I+ + P KIP+I+ERY  EK LP+LDKTK+LVP  + +S+ + I+R R+++ S+Q  +LL+N  SMV++S+ +S++YE +KD DGFLYM YASQE FG  Y
Sbjct:   58 FKQRRSLEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNSNQAFFLLVNGHSMVSVSTPISEVYEREKDEDGFLYMVYASQETFGVKY 174          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Xenopus
Match: galt (galactose-1-phosphate uridylyltransferase [Source:Xenbase;Acc:XB-GENE-6453444])

HSP 1 Score: 113.62 bits (283), Expect = 7.180e-32
Identity = 47/114 (41.23%), Postives = 81/114 (71.05%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK +K  + R+ E   ++SRFP KIP+IVER  +EK LP L+K K+LVP E+T+ QFV  +R ++ +    ++ ++++ + + +++ T+SQ+Y  ++D DGFLY++Y SQ++FG
Sbjct:   18 FKQRKCLDSRIHEVNRVRSRFPYKIPVIVERSPQEKRLPQLEKIKFLVPPEITMGQFVNTIRCKLPLPPSHSLCVMVSGRQVASLAMTMSQVYSENRDQDGFLYLSYMSQDVFG 131          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Xenopus
Match: or3a1 (olfactory receptor family 3 subfamily A member 1 [Source:Xenbase;Acc:XB-GENE-6039050])

HSP 1 Score: 98.9821 bits (245), Expect = 2.006e-26
Identity = 44/115 (38.26%), Postives = 79/115 (68.70%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            FK   +   R  ES  I++++P+++P+IVE+ S  + + + DK KYLVP ++T++QF+ I+R R+++ S++ I+L + +K++   S T+ Q+YE +KD DGFLY+ Y+ +  FG 
Sbjct:    5 FKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDI-DKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFV-DKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGV 117          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Mouse
Match: Map1lc3a (microtubule-associated protein 1 light chain 3 alpha [Source:MGI Symbol;Acc:MGI:1915661])

HSP 1 Score: 134.42 bits (337), Expect = 3.068e-40
Identity = 58/115 (50.43%), Postives = 84/115 (73.04%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            PFK +++F  R  E + I+ + P+KIP+I+ERY  EK LP+LDKTK+LVP  + +S+ V I+R R+++   Q  +LL+N  SMV++S+ ++ IYE +KD DGFLYM YASQE FG
Sbjct:    6 PFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 120          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Mouse
Match: Map1lc3b (microtubule-associated protein 1 light chain 3 beta [Source:MGI Symbol;Acc:MGI:1914693])

HSP 1 Score: 134.035 bits (336), Expect = 3.578e-40
Identity = 55/114 (48.25%), Postives = 87/114 (76.32%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK +++F QR+ + + I+ + P KIP+I+ERY  EK LP+LDKTK+LVP  + +S+ + I+R R+++ ++Q  +LL+N  SMV++S+ +S++YE ++D DGFLYM YASQE FG
Sbjct:    7 FKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFG 120          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Mouse
Match: Map1lc3b (microtubule-associated protein 1 light chain 3 beta [Source:MGI Symbol;Acc:MGI:1914693])

HSP 1 Score: 117.087 bits (292), Expect = 5.777e-33
Identity = 55/149 (36.91%), Postives = 87/149 (58.39%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPI-----------------------------------IVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK +++F QR+ + + I+ + P KIP+                                   I+ERY  EK LP+LDKTK+LVP  + +S+ + I+R R+++ ++Q  +LL+N  SMV++S+ +S++YE ++D DGFLYM YASQE FG
Sbjct:    7 FKQRRSFEQRVEDVRLIREQHPTKIPVGSPAARGDPNPIGAPRSPGKPQAPDLSRGKRGRRVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFG 155          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Mouse
Match: Gabarapl2 (gamma-aminobutyric acid (GABA) A receptor-associated protein-like 2 [Source:MGI Symbol;Acc:MGI:1890602])

HSP 1 Score: 98.9821 bits (245), Expect = 1.786e-26
Identity = 44/114 (38.60%), Postives = 79/114 (69.30%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK   +   R  ES  I++++P+++P+IVE+ S  + + + DK KYLVP ++T++QF+ I+R R+++ S++ I+L + +K++   S T+ Q+YE +KD DGFLY+ Y+ +  FG
Sbjct:    5 FKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDI-DKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFV-DKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG 116          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Mouse
Match: Gabarapl1 (gamma-aminobutyric acid (GABA) A receptor-associated protein-like 1 [Source:MGI Symbol;Acc:MGI:1914980])

HSP 1 Score: 90.1225 bits (222), Expect = 4.171e-23
Identity = 39/114 (34.21%), Postives = 74/114 (64.91%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            +K    F  R  E + I+ ++P+++P+IVE+  K + +P LDK KYLVP +LT+ QF  ++R R+ ++ +  ++  +NN ++   S+T+ Q+YE + + D FLY+ Y+ + ++G
Sbjct:    5 YKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKAR-VPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNN-TIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG 116          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. UniProt/SwissProt
Match: sp|Q9BXW4|MLP3C_HUMAN (Microtubule-associated proteins 1A/1B light chain 3C OS=Homo sapiens OX=9606 GN=MAP1LC3C PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 4.353e-44
Identity = 66/116 (56.90%), Postives = 92/116 (79.31%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            PFK +K+   R  E   I+++FPNKIP++VERY +E  LP LDKTK+LVPQELT++QF+ I+R+RM +++ +  YLL+NNKS+V+MS+T+++IY   KD DGF+YMTYASQE FG 
Sbjct:   12 PFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFGC 127          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. UniProt/SwissProt
Match: sp|Q9GZQ8|MLP3B_HUMAN (Microtubule-associated proteins 1A/1B light chain 3B OS=Homo sapiens OX=9606 GN=MAP1LC3B PE=1 SV=3)

HSP 1 Score: 135.961 bits (341), Expect = 5.579e-40
Identity = 57/114 (50.00%), Postives = 87/114 (76.32%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK ++TF QR+ + + I+ + P KIP+I+ERY  EK LP+LDKTK+LVP  + +S+ + I+R R+++ ++Q  +LL+N  SMV++S+ +S++YE +KD DGFLYM YASQE FG
Sbjct:    7 FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG 120          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. UniProt/SwissProt
Match: sp|O41515|MLP3B_BOVIN (Microtubule-associated proteins 1A/1B light chain 3B OS=Bos taurus OX=9913 GN=MAP1LC3B PE=1 SV=4)

HSP 1 Score: 134.806 bits (338), Expect = 1.568e-39
Identity = 56/114 (49.12%), Postives = 86/114 (75.44%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK ++TF QR+ + + I+ + P KIP+I+ERY  EK LP+LDKTK+LVP  + +S+ + I+R R+++ ++Q  +LL+N  SMV++S+ + ++YE +KD DGFLYM YASQE FG
Sbjct:    7 FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPICEVYESEKDEDGFLYMVYASQETFG 120          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. UniProt/SwissProt
Match: sp|Q2HJ23|MLP3A_BOVIN (Microtubule-associated proteins 1A/1B light chain 3A OS=Bos taurus OX=9913 GN=MAP1LC3A PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 2.055e-39
Identity = 58/115 (50.43%), Postives = 84/115 (73.04%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            PFK +++F  R  E + I+ + P+KIP+I+ERY  EK LP+LDKTK+LVP  + +S+ V I+R R+++   Q  +LL+N  SMV++S+ ++ IYE +KD DGFLYM YASQE FG
Sbjct:    6 PFKQRRSFADRCKEVQQIREQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 120          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. UniProt/SwissProt
Match: sp|Q6XVN8|MLP3A_RAT (Microtubule-associated proteins 1A/1B light chain 3A OS=Rattus norvegicus OX=10116 GN=Map1lc3a PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 2.146e-39
Identity = 58/115 (50.43%), Postives = 84/115 (73.04%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            PFK +++F  R  E + I+ + P+KIP+I+ERY  EK LP+LDKTK+LVP  + +S+ V I+R R+++   Q  +LL+N  SMV++S+ ++ IYE +KD DGFLYM YASQE FG
Sbjct:    6 PFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 120          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. TrEMBL
Match: A0A4Y6HRP0 (ATG8/LC3-like protein OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 2.272e-100
Identity = 145/150 (96.67%), Postives = 148/150 (98.67%), Query Frame = 3
Query:   69 MTSGEKYQENINGKEEMDGYSEGSRRSTVDSVFIPFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            MTSGEKYQEN+NGKE+MD YSEGSRRSTVDSVFIPFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKS+QTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 
Sbjct:    1 MTSGEKYQENVNGKEDMDNYSEGSRRSTVDSVFIPFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSEQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGV 150          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. TrEMBL
Match: R7T5W5 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_2981 PE=3 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.859e-50
Identity = 76/122 (62.30%), Postives = 101/122 (82.79%), Query Frame = 3
Query:  153 VDSVFIPFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            +DSV   FK +KTF QR  E   I+++FP K+P+IVERY KE +LP+LDKTK+LVPQELT+SQFV I+RNRM + ++Q  YL++NNKS+ +MS+T+++IY+ +KD DGFLYMTYASQEMFGA
Sbjct:    5 IDSVGRTFKQRKTFAQRKDEVAGIRTKFPTKVPVIVERYHKETHLPILDKTKFLVPQELTMSQFVTIIRNRMSLSANQAFYLIVNNKSIASMSTTLAEIYKDEKDEDGFLYMTYASQEMFGA 126          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. TrEMBL
Match: A0A2G8LR20 (Putative microtubule-associated proteins 1A/1B light chain 3C OS=Stichopus japonicus OX=307972 GN=BSL78_00366 PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 8.533e-50
Identity = 76/129 (58.91%), Postives = 102/129 (79.07%), Query Frame = 3
Query:  129 SEGSRRSTVDSVFIPFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            S+ S+++ V      FK +KTF+QR  E   I+++FPNKIP+IVERY KE  LPLLDKTK+LVPQELT+SQFV I+RNRM++ + Q  YL++NNKS+ +MS+T++++Y  +KD DGFLYM YASQEMFG
Sbjct:    3 SDSSKQTEVPEAQKSFKQRKTFSQRKEEVAGIRAKFPNKIPVIVERYYKETQLPLLDKTKFLVPQELTMSQFVTIVRNRMQLNATQAFYLIVNNKSLASMSTTLAEVYREEKDEDGFLYMVYASQEMFG 131          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. TrEMBL
Match: W4XZT2 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.316e-49
Identity = 76/134 (56.72%), Postives = 104/134 (77.61%), Query Frame = 3
Query:  135 GSRRSTVDS------VFIPFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            G+ + T+++      V+  FK +KTF+QR  E   I+++FPNK+P+IVERY KE  LPLLDKTK+LVPQELT+SQFV I+RNRM++ + Q  YL++NNKS+ +MS+T+++IY  +KD DGFLYM YASQEMFG 
Sbjct:    2 GTDKKTIEAEEKDAKVYKSFKQRKTFSQRKEEVAGIRAKFPNKVPVIVERYYKEVQLPLLDKTKFLVPQELTMSQFVTIIRNRMQLTATQAFYLIVNNKSLASMSTTLAEIYRDEKDEDGFLYMVYASQEMFGC 135          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. TrEMBL
Match: A7RZW6 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g241851 PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 9.954e-49
Identity = 74/118 (62.71%), Postives = 96/118 (81.36%), Query Frame = 3
Query:  165 FIPFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            F PFK +K+F  R  E   I+++FP+KIP+IVERY KEK+LPLLDKTK+LVPQELT+SQFV I+RNRM + S Q  YL++NNKS+ +MS T++++Y  +KD DGFLYM YASQEMFG+
Sbjct:   11 FKPFKQRKSFVSRRDEVAGIRAKFPSKIPVIVERYHKEKDLPLLDKTKFLVPQELTMSQFVTIIRNRMSLSSTQAFYLIVNNKSLASMSMTMAELYREEKDEDGFLYMVYASQEMFGS 128          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Cavefish
Match: map1lc3cl (microtubule-associated proteins 1A/1B light chain 3C-like [Source:NCBI gene;Acc:103035726])

HSP 1 Score: 153.295 bits (386), Expect = 1.078e-47
Identity = 65/116 (56.03%), Postives = 92/116 (79.31%), Query Frame = 3
Query:  168 IPFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            +PFK +K    R  E   I+S+FPNK+P+IVERY +EK LPLLDKTK+LVP ELT+ QF+ +LRN++ +++ Q ++LLI+ KSM  M++++++IY   +DPDGFLYMTYASQ+MFG
Sbjct:   11 MPFKQRKCLATRKDEVCTIRSKFPNKLPVIVERYIQEKQLPLLDKTKFLVPHELTMGQFLCLLRNKIVLEASQALFLLISGKSMCCMTASMAEIYSQHRDPDGFLYMTYASQDMFG 126          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Cavefish
Match: map1lc3c (microtubule associated protein 1 light chain 3 gamma [Source:NCBI gene;Acc:103038765])

HSP 1 Score: 152.91 bits (385), Expect = 1.834e-47
Identity = 70/115 (60.87%), Postives = 90/115 (78.26%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            PFK +K+F  R  E   I+S+FP K+P+I+ERY++EK LP LDKTK+LVPQELT++QFV I+RNRM +   Q  YLLINN  + +MS T++Q+Y+  KD DGFLYMTYASQEMFG
Sbjct:   12 PFKQRKSFATRKQEVAGIRSKFPTKVPVIIERYNREKYLPPLDKTKFLVPQELTMTQFVTIIRNRMTLMPSQAFYLLINNSGIASMSLTMAQLYKDHKDEDGFLYMTYASQEMFG 126          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Cavefish
Match: map1lc3a (microtubule associated protein 1 light chain 3 alpha [Source:NCBI gene;Acc:103031430])

HSP 1 Score: 137.887 bits (346), Expect = 7.910e-42
Identity = 59/116 (50.86%), Postives = 85/116 (73.28%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            PFK +++F  R  E + I+ + PNKIP+I+ERY  EK LP+LDKTK+LVP  + +S+ V I+R R+++   Q  +LL+N  SMV++S+ +S+IYE ++D DGFLYM YASQE FG 
Sbjct:    6 PFKQRRSFADRCKEVQQIREQHPNKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPISEIYEQERDEDGFLYMVYASQETFGC 121          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Cavefish
Match: gabarapl2 (GABA(A) receptor-associated protein like 2 [Source:ZFIN;Acc:ZDB-GENE-040718-336])

HSP 1 Score: 98.2117 bits (243), Expect = 3.575e-26
Identity = 44/114 (38.60%), Postives = 79/114 (69.30%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK   +   R  ES  I++++P+++P+IVE+ S  + + + DK KYLVP ++T++QF+ I+R R+++ S++ I+L + +K++   S T+ Q+YE +KD DGFLY+ Y+ +  FG
Sbjct:   22 FKEDHSLEHRCVESAKIRNKYPDRVPVIVEKVSGSQIVDI-DKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFV-DKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG 133          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Cavefish
Match: ENSAMXT00000014245.2 (gamma-aminobutyric acid receptor-associated protein [Source:NCBI gene;Acc:103044705])

HSP 1 Score: 87.8113 bits (216), Expect = 2.939e-22
Identity = 37/114 (32.46%), Postives = 75/114 (65.79%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            +K +  F +R +E + I+ ++P+++P+IVE+  K + +  LDK KYLVP +LT+ QF  ++R R+ ++++  ++  +NN  +   S+T+ Q+Y+   + D FLY+ Y+ + ++G
Sbjct:    5 YKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKAR-IGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNN-VIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Sea Lamprey
Match: map1lc3a (microtubule-associated protein 1 light chain 3 alpha [Source:ZFIN;Acc:ZDB-GENE-040426-2232])

HSP 1 Score: 134.035 bits (336), Expect = 6.847e-41
Identity = 55/114 (48.25%), Postives = 88/114 (77.19%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK +++F +R+ + + I+S+ PNKIP+I+ERY  EK LP+LDKTK+LVP  + +S+ V I+R R+++  +Q  +LL+N +SMV++++ + ++YE ++D DGFLYM YASQE FG
Sbjct:    7 FKQRRSFTERVKDVELIRSQHPNKIPVIIERYRGEKQLPMLDKTKFLVPDHVNMSELVKIIRRRLQLNPNQAFFLLVNQRSMVSVAAPICEVYEQERDDDGFLYMVYASQETFG 120          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Sea Lamprey
Match: map1lc3a (microtubule-associated protein 1 light chain 3 alpha [Source:ZFIN;Acc:ZDB-GENE-040426-2232])

HSP 1 Score: 129.798 bits (325), Expect = 3.654e-39
Identity = 56/107 (52.34%), Postives = 82/107 (76.64%), Query Frame = 3
Query:  198 QRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            +R  + + I+S+ PNKIP+I+ERY  EK LP+LDKTK+LVP  + +S+ V ILR R+++  +Q  +LL+N +SMV+++  +SQ+YE +KD DGFLYM YASQE FG+
Sbjct:   19 ERQRDVEQIRSQHPNKIPVIIERYRGEKQLPMLDKTKFLVPDHVNISELVKILRRRLQLSPNQAFFLLVNQRSMVSVAVPISQVYEQEKDEDGFLYMVYASQETFGS 125          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Sea Lamprey
Match: gabarapl2 (GABA(A) receptor-associated protein like 2 [Source:ZFIN;Acc:ZDB-GENE-040718-336])

HSP 1 Score: 100.523 bits (249), Expect = 8.219e-28
Identity = 44/114 (38.60%), Postives = 79/114 (69.30%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK   +F  R  ES  I++++P+++P++VE+    + +  +DK KYLVP ++T++QF+ I+R R+++ SD+ I+L I +K++   S+++ Q+YE  KD DGFLY+ Y+ +  FG
Sbjct:   18 FKEDHSFEHRRAESNKIRNKYPDRVPVVVEKVPGSQ-IGDIDKRKYLVPADITVAQFMWIIRKRVQLPSDKAIFLFI-DKTVPQSSASIGQLYEDQKDEDGFLYVAYSGENTFG 129          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000656.1 (pep scaffold:Pmarinus_7.0:GL480241:29776:33219:-1 gene:ENSPMAG00000000595.1 transcript:ENSPMAT00000000656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 1.031e-11
Identity = 26/52 (50.00%), Postives = 37/52 (71.15%), Query Frame = 3
Query:  204 LTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILR 359
            + +S  I++   NKIP+I+ER   EK+LP LDKTK+LVP  + +S+ V ILR
Sbjct:   19 IADSTQIRALHTNKIPVIIERCKGEKHLPKLDKTKFLVPDHVNMSELVKILR 70          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Yeast
Match: ATG8 (Component of autophagosomes and Cvt vesicles; regulator of Atg1p, targets it to autophagosomes; binds the Atg1p-Atg13p complex, triggering its vacuolar degradation; unique ubiquitin-like protein whose conjugation target is lipid phosphatidylethanolamine (PE); Atg8p-PE is anchored to membranes, is involved in phagophore expansion, and may mediate membrane fusion during autophagosome formation; deconjugation of Atg8p-PE is required for efficient autophagosome biogenesis [Source:SGD;Acc:S000000174])

HSP 1 Score: 99.3673 bits (246), Expect = 1.374e-27
Identity = 46/114 (40.35%), Postives = 77/114 (67.54%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK++  F +R  ES+ I  RF N+IP+I E+  K  ++P +DK KYLVP +LT+ QFV ++R R+ +  ++ I++ +N+ ++   ++ +S IY+  KD DGFLY+TY+ +  FG
Sbjct:    5 FKSEYPFEKRKAESERIADRFKNRIPVICEKAEKS-DIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVND-TLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG 116          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Nematostella
Match: EDO43061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZW6])

HSP 1 Score: 164.851 bits (416), Expect = 1.377e-52
Identity = 74/118 (62.71%), Postives = 96/118 (81.36%), Query Frame = 3
Query:  165 FIPFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            F PFK +K+F  R  E   I+++FP+KIP+IVERY KEK+LPLLDKTK+LVPQELT+SQFV I+RNRM + S Q  YL++NNKS+ +MS T++++Y  +KD DGFLYM YASQEMFG+
Sbjct:   11 FKPFKQRKSFVSRRDEVAGIRAKFPSKIPVIVERYHKEKDLPLLDKTKFLVPQELTMSQFVTIIRNRMSLSSTQAFYLIVNNKSLASMSMTMAELYREEKDEDGFLYMVYASQEMFGS 128          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Nematostella
Match: EDO35774 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKK3])

HSP 1 Score: 120.939 bits (302), Expect = 8.847e-36
Identity = 54/105 (51.43%), Postives = 78/105 (74.29%), Query Frame = 3
Query:  201 RLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            R  +S+ I  ++P+KIP+IVER   EKNLP+LDK KYLVP +LT+S    I+R R+++   Q  +LL+N K+MV++S+TV ++Y  ++D DGFLYM +ASQE FG
Sbjct:    5 RRRDSETITKQYPDKIPVIVERLKTEKNLPILDKIKYLVPGDLTMSSLASIIRKRLQLGPTQAFFLLVNEKNMVSISTTVGEVYRDERDEDGFLYMVFASQESFG 109          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Nematostella
Match: EDO45913 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA1])

HSP 1 Score: 97.0561 bits (240), Expect = 2.997e-26
Identity = 45/114 (39.47%), Postives = 77/114 (67.54%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK + + + R  ES  I+ ++P++IP++VE+  K   +  +DK K+LVP +LT++QF+ I+R R+++  ++ ++L + NK + T SST+  IYE  KD DGFLY+ Y+ +  FG
Sbjct:    5 FKEEHSLDSRCQESSKIRLKYPDRIPVVVEKAPKS-TIQDIDKRKFLVPSDLTVAQFMYIIRKRIQLPPEKAMFLFV-NKVLPTTSSTMGSIYEEHKDEDGFLYIAYSGENTFG 116          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Nematostella
Match: EDO42340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1K4])

HSP 1 Score: 87.4261 bits (215), Expect = 1.365e-22
Identity = 37/115 (32.17%), Postives = 73/115 (63.48%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            +K +  F +R  E + I+ ++P+++P+IVE+  K + +  LDK KYLVP +LT+ QF  ++R R+ ++ +  ++  +NN  +   S+T+ Q+Y+   + D FLY+ Y+ + ++G 
Sbjct:    5 YKEEHPFEKRRAEGEKIRKKYPDRVPVIVEKAPKAR-IGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNN-VIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGC 117          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Medaka
Match: map1lc3c (microtubule associated protein 1 light chain 3 gamma [Source:NCBI gene;Acc:101162187])

HSP 1 Score: 150.984 bits (380), Expect = 7.932e-47
Identity = 70/115 (60.87%), Postives = 89/115 (77.39%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            PFK +K+F  R  E   IKS+FPNKIP+I+ERY KE+ LP LDKTK+LVP ELT++QFV I+RNRM +   Q  YLLIN+  + +MS T++Q+Y+  +D DGFLYMTYASQEMFG
Sbjct:   13 PFKQRKSFATRKQEVAGIKSKFPNKIPVIIERYDKERFLPPLDKTKFLVPHELTMTQFVTIIRNRMALLPSQAFYLLINSSGLPSMSLTMAQVYKDHQDEDGFLYMTYASQEMFG 127          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Medaka
Match: map1lc3cl (microtubule-associated proteins 1A/1B light chain 3C [Source:NCBI gene;Acc:101159112])

HSP 1 Score: 146.362 bits (368), Expect = 6.586e-45
Identity = 66/115 (57.39%), Postives = 90/115 (78.26%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            FK +K    R  E  +I+S+FPNK+P+IVERY +EK LPLLDKTK+LVP ELTL QF+ +LRN++E+ S Q+++LL+ +K+M  MSS++  +Y   +D DGFLY+TYASQEMFGA
Sbjct:   13 FKQRKCLATRKNEVCSIRSKFPNKLPVIVERYIREKTLPLLDKTKFLVPFELTLGQFLCLLRNKIELDSSQSLFLLVADKTMSCMSSSMGDVYSRYRDADGFLYITYASQEMFGA 127          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Medaka
Match: map1lc3b (microtubule associated protein 1 light chain 3 beta [Source:NCBI gene;Acc:105354249])

HSP 1 Score: 140.969 bits (354), Expect = 5.644e-43
Identity = 59/115 (51.30%), Postives = 89/115 (77.39%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            FK ++TF QR+ + + I+ + PNKIP+I+ERY  EK LP+LDKTK+LVP  + +S+ + I+R R+++ S+Q  +LL+N  SMV++S+ +S++YE +KD DGFLYM YASQE FG+
Sbjct:    7 FKQRRTFEQRVEDVRLIREQHPNKIPVIIERYKGEKQLPILDKTKFLVPDHVNMSELIKIIRRRLQLNSNQAFFLLVNGHSMVSVSAAISELYEQEKDQDGFLYMVYASQETFGS 121          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Medaka
Match: map1lc3a (microtubule associated protein 1 light chain 3 alpha [Source:NCBI gene;Acc:101162037])

HSP 1 Score: 139.428 bits (350), Expect = 1.889e-42
Identity = 60/116 (51.72%), Postives = 85/116 (73.28%), Query Frame = 3
Query:  171 PFKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            PFK ++TF  R  E + I+ + PNKIP+I+ERY  EK LP+LDKTK+LVP  + +S+ V I+R R+++   Q  +LL+N  SMV++S+ +S+IYE ++D DGFLYM YASQE FG 
Sbjct:    6 PFKQRRTFADRCKEVQQIREQHPNKIPVIIERYKGEKQLPILDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAAFLLVNQHSMVSVSTPISEIYEQERDEDGFLYMVYASQETFGC 121          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Medaka
Match: GABARAPL2 (gamma-aminobutyric acid receptor-associated protein-like 2 [Source:NCBI gene;Acc:101171396])

HSP 1 Score: 97.8265 bits (242), Expect = 3.965e-26
Identity = 44/114 (38.60%), Postives = 79/114 (69.30%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            FK   +   R  ES  I+S++P+++P+IVE+ S  + + + DK KYLVP ++T++QF+ I+R R+++ S++ I+L + +K++   S T+ Q+Y+ +KD DGFLY+ Y+ +  FG
Sbjct:    5 FKEDHSVEHRCIESAKIRSKYPDRVPVIVEKVSGSQIVDI-DKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFV-DKTVPQSSITMGQLYDKEKDEDGFLYVAYSGENTFG 116          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Planmine SMEST
Match: SMESG000033716.1 (SMESG000033716.1)

HSP 1 Score: 102.449 bits (254), Expect = 4.723e-28
Identity = 47/114 (41.23%), Postives = 81/114 (71.05%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFG 515
            F+ + +F++RL +S+ IK+++P +IPIIVE++   + L  +DK K+LVP ++T++QF+ ILR R+++ SD+ ++L +  KS+   S T+ Q+YE  +D DGFLY  Y+ +  FG
Sbjct:    5 FQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSR-LIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFV-GKSVPQASMTMGQLYEDFRDEDGFLYAAYSGENSFG 116          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Planmine SMEST
Match: SMESG000026465.1 (SMESG000026465.1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.264e-24
Identity = 40/115 (34.78%), Postives = 77/115 (66.96%), Query Frame = 3
Query:  174 FKTKKTFNQRLTESKNIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRMEIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA 518
            +K + +F++R  E + I+ ++P+++P+IVE+  K + +P LDK KYLVP +LT+ QF  ++R R++++S+  ++  +NN  +   S T+  +YE   + D FLY+ Y+ + ++GA
Sbjct:    5 YKEEHSFDKRRAEGEKIRKKYPDRVPVIVEKAPKAR-VPDLDKKKYLVPNDLTVGQFYFLIRKRIQLRSEDALFFFVNN-VIPPTSFTMGALYEEHHEEDLFLYVAYSDESVYGA 117          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Planmine SMEST
Match: SMESG000079855.1 (SMESG000079855.1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.337e-23
Identity = 51/86 (59.30%), Postives = 57/86 (66.28%), Query Frame = 3
Query:   69 MTSGEKYQENINGKEEMDGYSEGSRRSTVDSVFIPFKTKKTFNQ---------RLTESKNIKSRFPNKIPIIVERYSKEKNLPLLD 299
            MTSGEKYQENINGKEEMDGYSEGSRRSTVDSVFIPFKTKKTF+          + T+  NI++  P       + Y     LP LD
Sbjct:    1 MTSGEKYQENINGKEEMDGYSEGSRRSTVDSVFIPFKTKKTFSACKLEIPRTTKHTQRSNIQTDSPE------DYYRISLCLPFLD 80          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Planmine SMEST
Match: SMESG000037170.1 (SMESG000037170.1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.337e-23
Identity = 51/86 (59.30%), Postives = 57/86 (66.28%), Query Frame = 3
Query:   69 MTSGEKYQENINGKEEMDGYSEGSRRSTVDSVFIPFKTKKTFNQ---------RLTESKNIKSRFPNKIPIIVERYSKEKNLPLLD 299
            MTSGEKYQENINGKEEMDGYSEGSRRSTVDSVFIPFKTKKTF+          + T+  NI++  P       + Y     LP LD
Sbjct:    1 MTSGEKYQENINGKEEMDGYSEGSRRSTVDSVFIPFKTKKTFSACKLEIPRTTKHTQRSNIQTDSPE------DYYRISLCLPFLD 80          
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Planmine SMEST
Match: SMESG000037170.1 (SMESG000037170.1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.886e-23
Identity = 46/54 (85.19%), Postives = 48/54 (88.89%), Query Frame = 3
Query:   69 MTSGEKYQENINGKEEMDGYSEGSRRSTVDSVFIPFKTKKTF--NQRLTESKNI 224
            MTSGEKYQENINGKEEMDGYSEGSRRSTVDSVFIPFKTKKTF   Q L++  NI
Sbjct:    1 MTSGEKYQENINGKEEMDGYSEGSRRSTVDSVFIPFKTKKTFKIEQLLSKFTNI 54          
The following BLAST results are available for this feature:
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP1LC3C9.064e-4556.90microtubule associated protein 1 light chain 3 gam... [more]
MAP1LC3B1.162e-4050.00microtubule associated protein 1 light chain 3 bet... [more]
MAP1LC3B1.162e-4050.00microtubule associated protein 1 light chain 3 bet... [more]
MAP1LC3A4.469e-4050.43microtubule associated protein 1 light chain 3 alp... [more]
MAP1LC3A4.469e-4050.43microtubule associated protein 1 light chain 3 alp... [more]
back to top
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lgg-21.619e-3240.63pep chromosome:WBcel235:IV:10934201:10935903:-1 ge... [more]
lgg-21.619e-3240.63pep chromosome:WBcel235:IV:10934186:10935914:-1 ge... [more]
lgg-11.334e-2235.65pep chromosome:WBcel235:II:6346960:6347719:-1 gene... [more]
lgg-25.463e-1641.89pep chromosome:WBcel235:IV:10934201:10935825:-1 ge... [more]
lgg-25.463e-1641.89pep chromosome:WBcel235:IV:10934201:10935825:-1 ge... [more]
back to top
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atg8b3.129e-2133.33gene:FBgn0038539 transcript:FBtr0346730[more]
Atg8b3.129e-2133.33gene:FBgn0038539 transcript:FBtr0083533[more]
Atg8a6.939e-2131.58gene:FBgn0052672 transcript:FBtr0071498[more]
Atg8a6.269e-1334.44gene:FBgn0052672 transcript:FBtr0346376[more]
Atg8a6.640e-1332.95gene:FBgn0052672 transcript:FBtr0346375[more]
back to top
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map1lc3c1.410e-4660.00microtubule-associated protein 1 light chain 3 gam... [more]
map1lc3cl9.247e-4553.85microtubule-associated protein 1 light chain 3 gam... [more]
map1lc3cl1.483e-4454.31microtubule-associated protein 1 light chain 3 gam... [more]
map1lc3b3.205e-4250.88microtubule-associated protein 1 light chain 3 bet... [more]
map1lc3a9.334e-4250.86microtubule-associated protein 1 light chain 3 alp... [more]
back to top
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map1lc3c4.244e-4659.13microtubule associated protein 1 light chain 3 gam... [more]
map1lc3a1.130e-4152.17microtubule associated protein 1 light chain 3 alp... [more]
wrnip12.233e-3948.72Werner helicase interacting protein 1 [Source:Xenb... [more]
galt7.180e-3241.23galactose-1-phosphate uridylyltransferase [Source:... [more]
or3a12.006e-2638.26olfactory receptor family 3 subfamily A member 1 [... [more]
back to top
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map1lc3a3.068e-4050.43microtubule-associated protein 1 light chain 3 alp... [more]
Map1lc3b3.578e-4048.25microtubule-associated protein 1 light chain 3 bet... [more]
Map1lc3b5.777e-3336.91microtubule-associated protein 1 light chain 3 bet... [more]
Gabarapl21.786e-2638.60gamma-aminobutyric acid (GABA) A receptor-associat... [more]
Gabarapl14.171e-2334.21gamma-aminobutyric acid (GABA) A receptor-associat... [more]
back to top
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BXW4|MLP3C_HUMAN4.353e-4456.90Microtubule-associated proteins 1A/1B light chain ... [more]
sp|Q9GZQ8|MLP3B_HUMAN5.579e-4050.00Microtubule-associated proteins 1A/1B light chain ... [more]
sp|O41515|MLP3B_BOVIN1.568e-3949.12Microtubule-associated proteins 1A/1B light chain ... [more]
sp|Q2HJ23|MLP3A_BOVIN2.055e-3950.43Microtubule-associated proteins 1A/1B light chain ... [more]
sp|Q6XVN8|MLP3A_RAT2.146e-3950.43Microtubule-associated proteins 1A/1B light chain ... [more]
back to top
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y6HRP02.272e-10096.67ATG8/LC3-like protein OS=Dugesia japonica OX=6161 ... [more]
R7T5W51.859e-5062.30Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2G8LR208.533e-5058.91Putative microtubule-associated proteins 1A/1B lig... [more]
W4XZT21.316e-4956.72Uncharacterized protein OS=Strongylocentrotus purp... [more]
A7RZW69.954e-4962.71Predicted protein OS=Nematostella vectensis OX=453... [more]
back to top
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map1lc3cl1.078e-4756.03microtubule-associated proteins 1A/1B light chain ... [more]
map1lc3c1.834e-4760.87microtubule associated protein 1 light chain 3 gam... [more]
map1lc3a7.910e-4250.86microtubule associated protein 1 light chain 3 alp... [more]
gabarapl23.575e-2638.60GABA(A) receptor-associated protein like 2 [Source... [more]
ENSAMXT00000014245.22.939e-2232.46gamma-aminobutyric acid receptor-associated protei... [more]
back to top
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
map1lc3a6.847e-4148.25microtubule-associated protein 1 light chain 3 alp... [more]
map1lc3a3.654e-3952.34microtubule-associated protein 1 light chain 3 alp... [more]
gabarapl28.219e-2838.60GABA(A) receptor-associated protein like 2 [Source... [more]
ENSPMAT00000000656.11.031e-1150.00pep scaffold:Pmarinus_7.0:GL480241:29776:33219:-1 ... [more]
back to top
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ATG81.374e-2740.35Component of autophagosomes and Cvt vesicles; regu... [more]
back to top
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO430611.377e-5262.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357748.847e-3651.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459132.997e-2639.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423401.365e-2232.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map1lc3c7.932e-4760.87microtubule associated protein 1 light chain 3 gam... [more]
map1lc3cl6.586e-4557.39microtubule-associated proteins 1A/1B light chain ... [more]
map1lc3b5.644e-4351.30microtubule associated protein 1 light chain 3 bet... [more]
map1lc3a1.889e-4251.72microtubule associated protein 1 light chain 3 alp... [more]
GABARAPL23.965e-2638.60gamma-aminobutyric acid receptor-associated protei... [more]
back to top
BLAST of Microtubule-associated proteins 1A/1B light chain 3C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033716.14.723e-2841.23SMESG000033716.1[more]
SMESG000026465.12.264e-2434.78SMESG000026465.1[more]
SMESG000079855.12.337e-2359.30SMESG000079855.1[more]
SMESG000037170.12.337e-2359.30SMESG000037170.1[more]
SMESG000037170.17.886e-2385.19SMESG000037170.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030670 ID=SMED30030670|Name=Microtubule-associated proteins 1A/1B light chain 3C|organism=Schmidtea mediterranea sexual|type=transcript|length=604bp
ATTGAAAACTGCTTTATTTTCAATATCAGCTTTATATGTGGATTTAAACC
ATATTAAAAAGATTTATTATGACATCAGGAGAAAAATACCAGGAAAATAT
TAACGGAAAAGAGGAAATGGATGGATACAGTGAAGGCTCAAGGAGAAGCA
CTGTTGATTCGGTTTTTATTCCGTTTAAAACTAAAAAAACTTTTAATCAG
AGATTAACAGAATCCAAAAACATCAAATCTCGATTTCCAAATAAAATACC
AATAATTGTTGAAAGATATTCCAAAGAAAAGAATTTGCCACTTCTTGATA
AAACAAAATATTTAGTGCCACAAGAATTAACTTTGTCTCAGTTTGTTTTA
ATATTAAGGAATCGTATGGAAATCAAATCCGATCAGACGATCTATTTATT
AATTAATAACAAAAGCATGGTGACAATGTCGAGCACAGTGAGTCAAATCT
ATGAAGTTGACAAAGATCCTGATGGATTTCTATACATGACTTACGCGTCC
CAGGAAATGTTTGGTGCATAATATTTATCTGAAATCATAATCTTTAGCTT
CGCTATTGTAATTGTTTACTACTATTAATATTTATTAAATTTATTAGAGA
TCTA
back to top

protein sequence of SMED30030670-orf-1

>SMED30030670-orf-1 ID=SMED30030670-orf-1|Name=SMED30030670-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=151bp
MTSGEKYQENINGKEEMDGYSEGSRRSTVDSVFIPFKTKKTFNQRLTESK
NIKSRFPNKIPIIVERYSKEKNLPLLDKTKYLVPQELTLSQFVLILRNRM
EIKSDQTIYLLINNKSMVTMSSTVSQIYEVDKDPDGFLYMTYASQEMFGA
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027731MAP1A/MAP1B_LC3C
IPR004241Atg8-like
IPR029071Ubiquitin-like_domsf
Vocabulary: biological process
TermDefinition
GO:0006914autophagy
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004241Autophagy protein Atg8 ubiquitin-likePFAMPF02991Atg8coord: 44..149
e-value: 7.3E-38
score: 128.9
IPR004241Autophagy protein Atg8 ubiquitin-likePANTHERPTHR10969MICROTUBULE-ASSOCIATED PROTEINS 1A/1B LIGHT CHAIN 3-RELATEDcoord: 29..149
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 18..149
e-value: 4.7E-49
score: 167.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 9..23
NoneNo IPR availableCDDcd17236Ubl_ATG8_MAP1LC3Ccoord: 36..148
e-value: 1.6231E-56
score: 170.315
IPR027731Microtubule-associated protein 1A/1B light chain 3CPANTHERPTHR10969:SF50MICROTUBULE-ASSOCIATED PROTEINS 1A/1B LIGHT CHAIN 3Ccoord: 29..149
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 33..149