SMED30030668

Overview
NameSMED30030668
Smed IDSMED30030668
Length (bp)1551
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030668

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30030668h1SMcG0005770 Contig27358uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30030668h1SMcG0005770 Contig27358newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30030668 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001906:29856..31406 +7728
v31.001906:21536..23086 +7692
Homology
BLAST of SMED30030668 vs. Ensembl Celegans
Match: mrck-1 (Serine/threonine-protein kinase mrck-1 [Source:UniProtKB/Swiss-Prot;Acc:O01583])

HSP 1 Score: 50.447 bits (119), Expect = 3.191e-6
Identity = 37/120 (30.83%), Postives = 57/120 (47.50%), Query Frame = 3
Query:  630 NLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILME--MLENPNLRQPDELELSRKLNQNYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIETL 983
            ++A F +AE ++AIDSLH     HR + P +V  D++GH++L D    L   RIL +  +  N  +  PD           Y+ PE+   +   E     Y  +C  D + +GI   E L
Sbjct:  182 SMAKFYIAEMVLAIDSLHRLGYVHRDVKPDNVLLDMQGHIRLADFGSCL---RILADGSVASNVAVGTPD-----------YISPEILRAM---EDGRGRYGKEC--DWWSLGICMYEML 282          
BLAST of SMED30030668 vs. Ensembl Celegans
Match: mrck-1 (Serine/threonine-protein kinase mrck-1 [Source:UniProtKB/Swiss-Prot;Acc:O01583])

HSP 1 Score: 50.447 bits (119), Expect = 3.191e-6
Identity = 37/120 (30.83%), Postives = 57/120 (47.50%), Query Frame = 3
Query:  630 NLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILME--MLENPNLRQPDELELSRKLNQNYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIETL 983
            ++A F +AE ++AIDSLH     HR + P +V  D++GH++L D    L   RIL +  +  N  +  PD           Y+ PE+   +   E     Y  +C  D + +GI   E L
Sbjct:  182 SMAKFYIAEMVLAIDSLHRLGYVHRDVKPDNVLLDMQGHIRLADFGSCL---RILADGSVASNVAVGTPD-----------YISPEILRAM---EDGRGRYGKEC--DWWSLGICMYEML 282          
BLAST of SMED30030668 vs. Ensembl Celegans
Match: mrck-1 (Serine/threonine-protein kinase mrck-1 [Source:UniProtKB/Swiss-Prot;Acc:O01583])

HSP 1 Score: 50.447 bits (119), Expect = 3.218e-6
Identity = 37/120 (30.83%), Postives = 57/120 (47.50%), Query Frame = 3
Query:  630 NLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILME--MLENPNLRQPDELELSRKLNQNYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIETL 983
            ++A F +AE ++AIDSLH     HR + P +V  D++GH++L D    L   RIL +  +  N  +  PD           Y+ PE+   +   E     Y  +C  D + +GI   E L
Sbjct:  182 SMAKFYIAEMVLAIDSLHRLGYVHRDVKPDNVLLDMQGHIRLADFGSCL---RILADGSVASNVAVGTPD-----------YISPEILRAM---EDGRGRYGKEC--DWWSLGICMYEML 282          
BLAST of SMED30030668 vs. Ensembl Celegans
Match: mrck-1 (Serine/threonine-protein kinase mrck-1 [Source:UniProtKB/Swiss-Prot;Acc:O01583])

HSP 1 Score: 50.447 bits (119), Expect = 3.218e-6
Identity = 37/120 (30.83%), Postives = 57/120 (47.50%), Query Frame = 3
Query:  630 NLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILME--MLENPNLRQPDELELSRKLNQNYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIETL 983
            ++A F +AE ++AIDSLH     HR + P +V  D++GH++L D    L   RIL +  +  N  +  PD           Y+ PE+   +   E     Y  +C  D + +GI   E L
Sbjct:  182 SMAKFYIAEMVLAIDSLHRLGYVHRDVKPDNVLLDMQGHIRLADFGSCL---RILADGSVASNVAVGTPD-----------YISPEILRAM---EDGRGRYGKEC--DWWSLGICMYEML 282          
BLAST of SMED30030668 vs. Ensembl Fly
Match: sti (gene:FBgn0002466 transcript:FBtr0075970)

HSP 1 Score: 51.6026 bits (122), Expect = 1.767e-6
Identity = 34/116 (29.31%), Postives = 56/116 (48.28%), Query Frame = 3
Query:  630 NLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILMEMLENPNLRQPDELELSRKLNQNYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIE 977
            +LA F LAE  VA+ +LHE    HR + P+++  D  GH+KL D   +   DR    +  +P +  PD           Y+ PE+   +   +  ++ + + C  D + +GII  E
Sbjct:  207 DLARFYLAELTVALHTLHEMGYVHRDIKPENILIDRFGHIKLADFGNAAALDRDGHVLSLSP-VGTPD-----------YIAPELLQTISTYKLSKSMHDVSC--DYWSMGIIGYE 308          
BLAST of SMED30030668 vs. Ensembl Fly
Match: trc (gene:FBgn0003744 transcript:FBtr0074922)

HSP 1 Score: 49.2914 bits (116), Expect = 6.522e-6
Identity = 30/110 (27.27%), Postives = 56/110 (50.91%), Query Frame = 3
Query:  432 KMSHLIKNCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRKDLIDSESICNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGD 761
            +++H+      L++ +  W+V +      PV NL++ +      ++  L+    ++KD +  E       F ++E  +AIDS+H+    HR + P ++  D RGHLKL D
Sbjct:  134 QVAHVRAERDVLVEADHQWVVKMYYSFQDPV-NLYLIMEFLPGGDMMTLL----MKKDTLSEEG----TQFYISETALAIDSIHKLGFIHRDIKPDNLLLDARGHLKLSD 234          
BLAST of SMED30030668 vs. Ensembl Fly
Match: trc (gene:FBgn0003744 transcript:FBtr0332154)

HSP 1 Score: 48.9062 bits (115), Expect = 7.876e-6
Identity = 30/110 (27.27%), Postives = 56/110 (50.91%), Query Frame = 3
Query:  432 KMSHLIKNCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRKDLIDSESICNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGD 761
            +++H+      L++ +  W+V +      PV NL++ +      ++  L+    ++KD +  E       F ++E  +AIDS+H+    HR + P ++  D RGHLKL D
Sbjct:  134 QVAHVRAERDVLVEADHQWVVKMYYSFQDPV-NLYLIMEFLPGGDMMTLL----MKKDTLSEEG----TQFYISETALAIDSIHKLGFIHRDIKPDNLLLDARGHLKLSD 234          
BLAST of SMED30030668 vs. Ensembl Zebrafish
Match: stk38l (serine/threonine kinase 38 like [Source:ZFIN;Acc:ZDB-GENE-040426-798])

HSP 1 Score: 49.6766 bits (117), Expect = 7.004e-6
Identity = 53/222 (23.87%), Postives = 100/222 (45.05%), Query Frame = 3
Query:  387 SGSI-AVEIVRNVS---AAKMSHLIKNCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRKDLIDSESICNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADR-----ILMEMLENP-------NLRQPDELELSRKLNQNYLDPEVYHYLVNKEYI--EAYYQL--DCLSDIFCIGIITIETLSNY 992
            +G I A++I+R        +++H+      L++ + +W+V +    +    NL++ +      ++  L+    ++KD +  E+      F +AE ++AIDS+H+    HR + P ++  D RGH+KL D     G  +         +  NP       N+    + E  +K N+  L    Y  +   +YI  E + Q   + L D + +G+I  E L  Y
Sbjct:  112 TGHIYAMKILRKADMLEKEQVAHIRAERDILVEADGAWVVKMF-YSFQDKRNLYLIMEFLPGGDMMTLL----MKKDTLSEEA----TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKK-NRRQL---AYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGY 320          
BLAST of SMED30030668 vs. Ensembl Zebrafish
Match: stk38l (serine/threonine kinase 38 like [Source:ZFIN;Acc:ZDB-GENE-040426-798])

HSP 1 Score: 49.6766 bits (117), Expect = 7.004e-6
Identity = 53/222 (23.87%), Postives = 100/222 (45.05%), Query Frame = 3
Query:  387 SGSI-AVEIVRNVS---AAKMSHLIKNCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRKDLIDSESICNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADR-----ILMEMLENP-------NLRQPDELELSRKLNQNYLDPEVYHYLVNKEYI--EAYYQL--DCLSDIFCIGIITIETLSNY 992
            +G I A++I+R        +++H+      L++ + +W+V +    +    NL++ +      ++  L+    ++KD +  E+      F +AE ++AIDS+H+    HR + P ++  D RGH+KL D     G  +         +  NP       N+    + E  +K N+  L    Y  +   +YI  E + Q   + L D + +G+I  E L  Y
Sbjct:  112 TGHIYAMKILRKADMLEKEQVAHIRAERDILVEADGAWVVKMF-YSFQDKRNLYLIMEFLPGGDMMTLL----MKKDTLSEEA----TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKK-NRRQL---AYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGY 320          
BLAST of SMED30030668 vs. Ensembl Zebrafish
Match: stk38l (serine/threonine kinase 38 like [Source:ZFIN;Acc:ZDB-GENE-040426-798])

HSP 1 Score: 49.2914 bits (116), Expect = 7.520e-6
Identity = 53/222 (23.87%), Postives = 100/222 (45.05%), Query Frame = 3
Query:  387 SGSI-AVEIVRNVS---AAKMSHLIKNCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRKDLIDSESICNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADR-----ILMEMLENP-------NLRQPDELELSRKLNQNYLDPEVYHYLVNKEYI--EAYYQL--DCLSDIFCIGIITIETLSNY 992
            +G I A++I+R        +++H+      L++ + +W+V +    +    NL++ +      ++  L+    ++KD +  E+      F +AE ++AIDS+H+    HR + P ++  D RGH+KL D     G  +         +  NP       N+    + E  +K N+  L    Y  +   +YI  E + Q   + L D + +G+I  E L  Y
Sbjct:  112 TGHIYAMKILRKADMLEKEQVAHIRAERDILVEADGAWVVKMF-YSFQDKRNLYLIMEFLPGGDMMTLL----MKKDTLSEEA----TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKK-NRRQL---AYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGY 320          
BLAST of SMED30030668 vs. Ensembl Xenopus
Match: pus1 (pseudouridylate synthase 1 [Source:Xenbase;Acc:XB-GENE-963672])

HSP 1 Score: 50.0618 bits (118), Expect = 8.937e-6
Identity = 32/119 (26.89%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  630 NLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILMEMLENPNLRQPDELELSRKLNQ-NYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIETL 983
            ++A F LAE ++AIDS+H+ +  HR + P +V  D++GH++L D    L              ++    +E S  +   +Y+ PE+   +   E  +  Y ++C  D + +G+   E L
Sbjct:  176 DMARFYLAEMVLAIDSIHQLNYVHRDIKPDNVLIDLKGHIRLADFGSCL-------------KMKPDGTVESSVAVGTPDYISPEILQAM---EDGKGKYGIEC--DWWSLGVSMYELL 276          
BLAST of SMED30030668 vs. Ensembl Xenopus
Match: pus1 (pseudouridylate synthase 1 [Source:Xenbase;Acc:XB-GENE-963672])

HSP 1 Score: 50.0618 bits (118), Expect = 9.452e-6
Identity = 32/119 (26.89%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  630 NLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILMEMLENPNLRQPDELELSRKLNQ-NYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIETL 983
            ++A F LAE ++AIDS+H+ +  HR + P +V  D++GH++L D    L              ++    +E S  +   +Y+ PE+   +   E  +  Y ++C  D + +G+   E L
Sbjct:  176 DMARFYLAEMVLAIDSIHQLNYVHRDIKPDNVLIDLKGHIRLADFGSCL-------------KMKPDGTVESSVAVGTPDYISPEILQAM---EDGKGKYGIEC--DWWSLGVSMYELL 276          
BLAST of SMED30030668 vs. Ensembl Xenopus
Match: pus1 (pseudouridylate synthase 1 [Source:Xenbase;Acc:XB-GENE-963672])

HSP 1 Score: 50.0618 bits (118), Expect = 9.620e-6
Identity = 32/119 (26.89%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  630 NLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILMEMLENPNLRQPDELELSRKLNQ-NYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIETL 983
            ++A F LAE ++AIDS+H+ +  HR + P +V  D++GH++L D    L              ++    +E S  +   +Y+ PE+   +   E  +  Y ++C  D + +G+   E L
Sbjct:  176 DMARFYLAEMVLAIDSIHQLNYVHRDIKPDNVLIDLKGHIRLADFGSCL-------------KMKPDGTVESSVAVGTPDYISPEILQAM---EDGKGKYGIEC--DWWSLGVSMYELL 276          
BLAST of SMED30030668 vs. Ensembl Xenopus
Match: pus1 (pseudouridylate synthase 1 [Source:Xenbase;Acc:XB-GENE-963672])

HSP 1 Score: 50.0618 bits (118), Expect = 9.838e-6
Identity = 32/119 (26.89%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  630 NLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILMEMLENPNLRQPDELELSRKLNQ-NYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIETL 983
            ++A F LAE ++AIDS+H+ +  HR + P +V  D++GH++L D    L              ++    +E S  +   +Y+ PE+   +   E  +  Y ++C  D + +G+   E L
Sbjct:  176 DMARFYLAEMVLAIDSIHQLNYVHRDIKPDNVLIDLKGHIRLADFGSCL-------------KMKPDGTVESSVAVGTPDYISPEILQAM---EDGKGKYGIEC--DWWSLGVSMYELL 276          
BLAST of SMED30030668 vs. TrEMBL
Match: A0A1V8SSJ7 (Uncharacterized protein OS=Rachicladosporium antarcticum OX=1507870 GN=B0A48_11707 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 3.382e-6
Identity = 88/347 (25.36%), Postives = 137/347 (39.48%), Query Frame = 3
Query:  432 KMSHLIKNCKALLDIECSWLVNLI------GCVYLPVENL----FMTLMENCSMNLSFLIQEIHLRKDLIDSESICNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLG--------ADRILMEML------ENP-NLRQPDE-------LELSRKLNQ-------------NYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIETLSNYNFVSFQTRSDEAGPPLLYSCADSFYLKPETQENLER--------ELTKHCGFISEGFYSLILLMLQPKRDRMRGLRMNVQRHRYSRKSGCEYKLRLELLERHPAFDNLELDSIVF 1313
            ++ H++     L   +  WLV L+        +YL +E +    F TL+ N  +        +H R            A F ++E  + +D+LH+    HR L P++   D  GH+KL D   + G        + RI +E +       NP NL QP E        E  R L +             +Y+ PEV   L  +EY       D   D + +G +  E L+ Y             PP   +  D      ET +NL+R        E      F+S   + LI  ++  K +R++G++  VQ H Y R+   E +LR E     P  D+ E D+  F
Sbjct:  314 EVRHVLTERDILTTAKSDWLVRLLYSFQDDSSIYLAMEYVPGGDFRTLLNNTGV--------LHNRH-----------ARFYISEMFLCVDALHQLGYIHRDLKPENFLIDGTGHVKLTDFGLAAGFLAPAKIESMRIKLESVGNMPSSANPFNLNQPTESRSIRERREGYRSLRERDKNYAKSIVGSPDYMAPEV---LKGEEY-------DSTVDYWSLGCMLFEALAGY-------------PPFAGASVD------ETWQNLKRWQSVLRKPEYEDPSYFLSRRTWDLITRLIAVKANRLQGMKQ-VQMHDYFREVSWE-RLRSERAPFVPELDS-ETDAGYF 609          
BLAST of SMED30030668 vs. Ensembl Cavefish
Match: stk38l (serine/threonine kinase 38 like [Source:ZFIN;Acc:ZDB-GENE-040426-798])

HSP 1 Score: 48.9062 bits (115), Expect = 8.403e-6
Identity = 53/222 (23.87%), Postives = 100/222 (45.05%), Query Frame = 3
Query:  387 SGSI-AVEIVRNVS---AAKMSHLIKNCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRKDLIDSESICNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADR-----ILMEMLENP-------NLRQPDELELSRKLNQNYLDPEVYHYLVNKEYI--EAYYQL--DCLSDIFCIGIITIETLSNY 992
            +G I A++I+R        +++H+      L++ + +W+V +    +    NL++ +      ++  L+    ++KD +  E+      F +AE ++AIDS+H+    HR + P ++  D RGH+KL D     G  +         +  NP       N+    + E  +K N+  L    Y  +   +YI  E + Q   + L D + +G+I  E L  Y
Sbjct:  107 TGHIYAMKILRKADMLEKEQVAHIRAERDILVEADGAWVVKMF-YSFQDKRNLYLIMEFLPGGDMMTLL----MKKDTLSEEA----TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKK-NRRQL---AYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGY 315          
BLAST of SMED30030668 vs. Ensembl Sea Lamprey
Match: stk38l (serine/threonine kinase 38 like [Source:ZFIN;Acc:ZDB-GENE-040426-798])

HSP 1 Score: 48.9062 bits (115), Expect = 1.753e-6
Identity = 48/222 (21.62%), Postives = 95/222 (42.79%), Query Frame = 3
Query:  387 SGSI-AVEIVRNVS---AAKMSHLIKNCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRKDLIDSESICNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRI-LMEMLENPNLRQPDELELSRKLNQNYLDPEVYH---------------YLVNKEYIEAYYQLDCLSDIFCIGIITIETLSNY 992
            +G I A++++R        +++H+      L++ +  W+V +      P +NL++ +      ++  L+    ++KD +  E       F +AE ++AIDS+H+    HR + P ++  D +GH+KL D     G  +    E   +    QP +   S K   +    E +                Y+  + +++  Y   C  D + +G+I  E L  Y
Sbjct:    9 TGHIYAMKVLRKADMLEKEQVAHIRAERDILVEADNLWVVKMFYSFQDP-KNLYLIMEFLPGGDMMTLL----MKKDTLTEEE----TQFYIAESILAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRDLTQAQPSDFSTSSKPMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFLQTGYNKLC--DWWSLGVIMFEMLIGY 219          
BLAST of SMED30030668 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005559.1 (pep scaffold:Pmarinus_7.0:GL476474:6865:57025:1 gene:ENSPMAG00000004999.1 transcript:ENSPMAT00000005559.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 3.268e-6
Identity = 35/118 (29.66%), Postives = 54/118 (45.76%), Query Frame = 3
Query:  630 NLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFES--LGADRILMEMLENPNLRQPDELELSRKLNQNYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIE 977
            ++  F LAE ++A  SLH+    HR L P++V  D  GH+KL D   +  L A++++   L   +   PD           Y+ PEV      K      Y  +C  D + +G+I  E
Sbjct:  195 SMVRFYLAELVLATQSLHQMGYVHRDLKPENVLVDRTGHIKLADFGSAAKLNANKMVSSKLPEGS---PD-----------YIAPEVLSSFSGK----GSYGPEC--DWWSVGVIAYE 292          
BLAST of SMED30030668 vs. Ensembl Yeast
Match: DBF20 (Ser/Thr kinase involved in late nuclear division; one of the mitotic exit network (MEN) proteins; necessary for the execution of cytokinesis; also plays a role in regulating the stability of SWI5 and CLB2 mRNAs; DBF20 has a paralog, DBF2, that arose from the whole genome duplication [Source:SGD;Acc:S000006315])

HSP 1 Score: 48.1358 bits (113), Expect = 2.714e-6
Identity = 35/132 (26.52%), Postives = 60/132 (45.45%), Query Frame = 3
Query:  432 KMSHLIKNCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRKDLIDSESI-CNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILMEMLENPNLR 824
            + +H++     L      WLV L+     P E+L++ +           +     R  LI++  +    A F ++E   A+++LHE   THR L P++   D  GH+KL D    L A  +  E +E+  +R
Sbjct:  210 ETNHVLTERDILTTTRSDWLVKLLYAFQDP-ESLYLAME---------FVPGGDFRTLLINTRILKSGHARFYISEMFCAVNALHELGYTHRDLKPENFLIDATGHIKLTDF--GLAAGTVSNERIESMKIR 329          
BLAST of SMED30030668 vs. Ensembl Yeast
Match: DBF2 (Ser/Thr kinase involved in transcription and stress response; functions as part of a network of genes in exit from mitosis; localization is cell cycle regulated; activated by Cdc15p during the exit from mitosis; also plays a role in regulating the stability of SWI5 and CLB2 mRNAs; phosphorylates Chs2p to regulate primary septum formation and Hof1p to regulate cytokinesis; DBF2 has a paralog, DBF20, that arose from the whole genome duplication [Source:SGD;Acc:S000003324])

HSP 1 Score: 46.595 bits (109), Expect = 7.262e-6
Identity = 33/129 (25.58%), Postives = 60/129 (46.51%), Query Frame = 3
Query:  441 HLIKNCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRKDLIDSESI-CNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILMEMLENPNLR 824
            H++     L      WLV L+   +  +++L++ +           +     R  LI++  +    A F ++E   A+++LH+   THR L P++   D +GH+KL D    L A  I  E +E+  +R
Sbjct:  221 HVLTERDILTTTRSEWLVKLL-YAFQDLQSLYLAME---------FVPGGDFRTLLINTRCLKSGHARFYISEMFCAVNALHDLGYTHRDLKPENFLIDAKGHIKLTDF--GLAAGTISNERIESMKIR 337          
BLAST of SMED30030668 vs. Ensembl Nematostella
Match: EDO32008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW88])

HSP 1 Score: 50.0618 bits (118), Expect = 9.137e-7
Identity = 34/117 (29.06%), Postives = 53/117 (45.30%), Query Frame = 3
Query:  633 LALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILMEMLENPNLRQPDELELSRKLNQNYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIETL 983
             A F  AE ++A+D++H     HR + P ++  D  GHLKL D    +  DR  M +  +  +  PD           Y+ PEV    +  +  E YY  +C  D + +G+   E L
Sbjct:  165 WAKFYCAEVVLALDAIHTMGFVHRDVKPDNMLLDGEGHLKLADFGTCMRMDRDGM-VRSDTAVGTPD-----------YISPEV----LKSQGGEGYYGREC--DWWSVGVFLYEML 263          
BLAST of SMED30030668 vs. Ensembl Nematostella
Match: EDO37677 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF23])

HSP 1 Score: 50.0618 bits (118), Expect = 1.306e-6
Identity = 36/120 (30.00%), Postives = 57/120 (47.50%), Query Frame = 3
Query:  630 NLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFES--LGADRILMEMLENPNLRQPDELELSRKLNQNYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIETL 983
            ++A F LAE ++AI SLH     HR + P +V  D  GH+KL D   S  L AD+ +   +    +  P+           Y+ PEV   L + +     Y ++C  D + +G++  E L
Sbjct:  181 DMARFYLAEIVMAIHSLHTMGFVHRDVKPDNVLIDRTGHIKLADFGSSARLSADKKVFSKMP---VGTPE-----------YIAPEV---LTSMDGSGGAYGVEC--DWWSLGVVAYEML 281          
BLAST of SMED30030668 vs. Ensembl Medaka
Match: stk38l (serine/threonine kinase 38 like [Source:NCBI gene;Acc:101163624])

HSP 1 Score: 49.6766 bits (117), Expect = 5.848e-6
Identity = 53/222 (23.87%), Postives = 100/222 (45.05%), Query Frame = 3
Query:  387 SGSI-AVEIVRNVS---AAKMSHLIKNCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRKDLIDSESICNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADR-----ILMEMLENP-------NLRQPDELELSRKLNQNYLDPEVYHYLVNKEYI--EAYYQL--DCLSDIFCIGIITIETLSNY 992
            +G I A++I+R        +++H+      L++ + +W+V +    +    NL++ +      ++  L+    ++KD +  E+      F +AE ++AIDS+H+    HR + P ++  D RGH+KL D     G  +         +  NP       N+    + E  +K N+  L    Y  +   +YI  E + Q   + L D + +G+I  E L  Y
Sbjct:  112 TGHIYAMKILRKADMLEKEQVAHIRAERDILVEADSAWVVKMF-YSFQDKRNLYLIMEFLPGGDMMTLL----MKKDTLSEEA----TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKK-NRRQL---AYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGY 320          
BLAST of SMED30030668 vs. Ensembl Medaka
Match: stk38l (serine/threonine kinase 38 like [Source:NCBI gene;Acc:101163624])

HSP 1 Score: 48.9062 bits (115), Expect = 8.639e-6
Identity = 53/222 (23.87%), Postives = 100/222 (45.05%), Query Frame = 3
Query:  387 SGSI-AVEIVRNVS---AAKMSHLIKNCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRKDLIDSESICNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADR-----ILMEMLENP-------NLRQPDELELSRKLNQNYLDPEVYHYLVNKEYI--EAYYQL--DCLSDIFCIGIITIETLSNY 992
            +G I A++I+R        +++H+      L++ + +W+V +    +    NL++ +      ++  L+    ++KD +  E+      F +AE ++AIDS+H+    HR + P ++  D RGH+KL D     G  +         +  NP       N+    + E  +K N+  L    Y  +   +YI  E + Q   + L D + +G+I  E L  Y
Sbjct:  112 TGHIYAMKILRKADMLEKEQVAHIRAERDILVEADSAWVVKMF-YSFQDKRNLYLIMEFLPGGDMMTLL----MKKDTLSEEA----TQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKK-NRRQL---AYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGY 320          
BLAST of SMED30030668 vs. Planmine SMEST
Match: SMESG000071998.1 (SMESG000071998.1)

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 440/442 (99.55%), Postives = 441/442 (99.77%), Query Frame = 3
Query:    3 PSSNTAAELEYNDKLCISCENLNCLSRFQKFRLYLPRFHDQSFATIIEIPFYLSRKFAIGIENLYENCLKMRLRYHDKPLKMTMQLSLQQSRRFILISMDDQRASSIICPEDMLPLKSKYILNNPSASSGSIAVEIVRNVSAAKMSHLIKNCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRKDLIDSESICNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILMEMLENPNLRQPDELELSRKLNQNYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIETLSNYNFVSFQTRSDEAGPPLLYSCADSFYLKPETQENLERELTKHCGFISEGFYSLILLMLQPKRDRMRGLRMNVQRHRYSRKSGCEYKLRLELLERHPAFDNLELDSIVFRTSPV 1328
            PSSNTAAELEYNDKLCISCENLNCLSRFQKFRLYLPRFHDQSFATIIEIPFYLSRKFAIGIENLYENCLKMRLRYHD+PLKMTMQLSLQQSRRFILISMDDQRASSIICPEDMLPLKSKYILNNPSASSGSIAVEIVRNVSAAKMSHLIKNCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRKDLIDSESICNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILMEMLENPNLRQPDELELSRKLNQNYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIETLSNYNFVSFQTRSDEAGPPLLYSCADSFYLKPETQENLE ELTKHCGFISEGFYSLILLMLQPKRDRMRGLRMNVQRHRYSRKSGCEYKLRLELLERHPAFDNLELDSIVFRTSPV
Sbjct:    5 PSSNTAAELEYNDKLCISCENLNCLSRFQKFRLYLPRFHDQSFATIIEIPFYLSRKFAIGIENLYENCLKMRLRYHDEPLKMTMQLSLQQSRRFILISMDDQRASSIICPEDMLPLKSKYILNNPSASSGSIAVEIVRNVSAAKMSHLIKNCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRKDLIDSESICNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLKLGDMFESLGADRILMEMLENPNLRQPDELELSRKLNQNYLDPEVYHYLVNKEYIEAYYQLDCLSDIFCIGIITIETLSNYNFVSFQTRSDEAGPPLLYSCADSFYLKPETQENLEMELTKHCGFISEGFYSLILLMLQPKRDRMRGLRMNVQRHRYSRKSGCEYKLRLELLERHPAFDNLELDSIVFRTSPV 446          
The following BLAST results are available for this feature:
BLAST of SMED30030668 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030668 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mrck-13.191e-630.83Serine/threonine-protein kinase mrck-1 [Source:Un... [more]
mrck-13.191e-630.83Serine/threonine-protein kinase mrck-1 [Source:Un... [more]
mrck-13.218e-630.83Serine/threonine-protein kinase mrck-1 [Source:Un... [more]
mrck-13.218e-630.83Serine/threonine-protein kinase mrck-1 [Source:Un... [more]
back to top
BLAST of SMED30030668 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sti1.767e-629.31gene:FBgn0002466 transcript:FBtr0075970[more]
trc6.522e-627.27gene:FBgn0003744 transcript:FBtr0074922[more]
trc7.876e-627.27gene:FBgn0003744 transcript:FBtr0332154[more]
back to top
BLAST of SMED30030668 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
stk38l7.004e-623.87serine/threonine kinase 38 like [Source:ZFIN;Acc:Z... [more]
stk38l7.004e-623.87serine/threonine kinase 38 like [Source:ZFIN;Acc:Z... [more]
stk38l7.520e-623.87serine/threonine kinase 38 like [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SMED30030668 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pus18.937e-626.89pseudouridylate synthase 1 [Source:Xenbase;Acc:XB-... [more]
pus19.452e-626.89pseudouridylate synthase 1 [Source:Xenbase;Acc:XB-... [more]
pus19.620e-626.89pseudouridylate synthase 1 [Source:Xenbase;Acc:XB-... [more]
pus19.838e-626.89pseudouridylate synthase 1 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of SMED30030668 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030668 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30030668 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
A0A1V8SSJ73.382e-625.36Uncharacterized protein OS=Rachicladosporium antar... [more]
back to top
BLAST of SMED30030668 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
stk38l8.403e-623.87serine/threonine kinase 38 like [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SMED30030668 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
stk38l1.753e-621.62serine/threonine kinase 38 like [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000005559.13.268e-629.66pep scaffold:Pmarinus_7.0:GL476474:6865:57025:1 ge... [more]
back to top
BLAST of SMED30030668 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
DBF202.714e-626.52Ser/Thr kinase involved in late nuclear division; ... [more]
DBF27.262e-625.58Ser/Thr kinase involved in transcription and stres... [more]
back to top
BLAST of SMED30030668 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO320089.137e-729.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376771.306e-630.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30030668 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
stk38l5.848e-623.87serine/threonine kinase 38 like [Source:NCBI gene;... [more]
stk38l8.639e-623.87serine/threonine kinase 38 like [Source:NCBI gene;... [more]
back to top
BLAST of SMED30030668 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000071998.10.000e+099.55SMESG000071998.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030668 ID=SMED30030668|Name=SMED30030668|organism=Schmidtea mediterranea sexual|type=transcript|length=1551bp
TTCCATCAAGCAATACAGCTGCCGAGCTCGAATATAATGATAAATTGTGC
ATTTCATGCGAGAATTTGAACTGCTTGTCGAGGTTTCAGAAATTCCGACT
CTATCTTCCAAGATTCCACGACCAAAGTTTCGCTACGATCATTGAAATTC
CTTTTTATCTGTCTCGAAAATTTGCAATTGGAATCGAAAATTTGTATGAA
AATTGTCTTAAAATGCGGCTGAGATATCACGACAAGCCTTTGAAAATGAC
TATGCAGTTATCATTGCAGCAGTCACGGCGATTTATACTCATTTCAATGG
ATGATCAAAGGGCTAGTAGCATTATTTGTCCCGAGGATATGCTACCTCTC
AAAAGTAAATATATTCTCAACAACCCCAGTGCTAGTAGCGGAAGCATTGC
AGTTGAAATAGTTCGCAACGTGTCCGCTGCAAAGATGTCCCATCTTATCA
AAAACTGTAAAGCCCTCCTTGATATAGAATGCTCCTGGCTAGTCAATCTA
ATTGGTTGCGTTTATCTTCCAGTTGAAAATCTGTTCATGACACTGATGGA
GAATTGCAGTATGAATTTGAGCTTCCTTATTCAAGAAATTCATTTGCGAA
AAGATTTGATAGATTCTGAAAGTATTTGTAATTTGGCACTGTTTATTTTG
GCAGAGTTCTTAGTAGCTATTGATTCTCTCCATGAAAGGAGTTTAACTCA
CCGATTTTTATCTCCCAAGTCAGTCTACTTTGACGTAAGAGGTCATTTGA
AATTGGGAGACATGTTTGAAAGTTTAGGTGCTGACCGAATCCTAATGGAA
ATGCTTGAAAATCCAAATCTCCGTCAACCCGATGAATTGGAGCTTTCTAG
GAAACTGAATCAAAATTACCTTGATCCTGAAGTCTATCATTATTTGGTAA
ATAAAGAATACATTGAGGCTTACTATCAATTAGACTGTTTGAGCGACATA
TTTTGTATAGGAATCATTACTATTGAGACCTTATCCAATTATAATTTTGT
ATCGTTTCAAACAAGAAGTGATGAGGCTGGGCCTCCTTTGCTCTATTCAT
GTGCTGACAGTTTTTATCTGAAACCAGAAACTCAAGAAAATCTGGAAAGG
GAACTTACCAAACATTGCGGCTTCATTAGTGAAGGATTTTATAGCTTGAT
TTTGTTGATGTTGCAACCAAAGAGAGACCGGATGAGGGGTCTGCGAATGA
ATGTTCAGAGACATCGATATTCACGGAAATCAGGATGCGAGTATAAATTA
CGATTAGAGTTGTTGGAAAGGCATCCAGCTTTTGATAACTTAGAGCTGGA
CTCAATTGTTTTTCGGACATCTCCGGTTCTACAGTTGCTAGATATTATAA
ATTGAATCTGAATATTTAACCTAGTAAATAATATGTTTAACTTTTACAGA
TTATGTTTTGGATTCCTCACGTCTTTTGCGTTTTGCATGACTGACAATAT
GTATTAATAAAAATGCAGAAATTAAATTAACTGATAAAATGTATTTAACA
AACTTTTGTTTTGATTGGCATGGAATCATCAAAAGTATCACAATTGAAAC
A
back to top

protein sequence of SMED30030668-orf-1

>SMED30030668-orf-1 ID=SMED30030668-orf-1|Name=SMED30030668-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=451bp
PSSNTAAELEYNDKLCISCENLNCLSRFQKFRLYLPRFHDQSFATIIEIP
FYLSRKFAIGIENLYENCLKMRLRYHDKPLKMTMQLSLQQSRRFILISMD
DQRASSIICPEDMLPLKSKYILNNPSASSGSIAVEIVRNVSAAKMSHLIK
NCKALLDIECSWLVNLIGCVYLPVENLFMTLMENCSMNLSFLIQEIHLRK
DLIDSESICNLALFILAEFLVAIDSLHERSLTHRFLSPKSVYFDVRGHLK
LGDMFESLGADRILMEMLENPNLRQPDELELSRKLNQNYLDPEVYHYLVN
KEYIEAYYQLDCLSDIFCIGIITIETLSNYNFVSFQTRSDEAGPPLLYSC
ADSFYLKPETQENLERELTKHCGFISEGFYSLILLMLQPKRDRMRGLRMN
VQRHRYSRKSGCEYKLRLELLERHPAFDNLELDSIVFRTSPVLQLLDIIN
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity