Choline dehydrogenase

Overview
NameCholine dehydrogenase
Smed IDSMED30030666
Length (bp)3461
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Choline dehydrogenase (SMED30030666) t-SNE clustered cells

Violin plots show distribution of expression levels for Choline dehydrogenase (SMED30030666) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Choline dehydrogenase (SMED30030666) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Choline dehydrogenase (SMED30030666) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030666

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30030666h1SMcG0007585 Contig3337GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30030666h1SMcG0022084 Contig3337GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30030666h1SMcG0007585 Contig39829newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030666h1SMcG0007585 Contig39829uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030666h1SMcG0007585 Contig3337GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30030666h1SMcG0007585 dd_Smed_v4_2813_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030666h1SMcG0007585 dd_Smed_v4_2813_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030666h1SMcG0007585 dd_Smed_v4_2813_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030666h1SMcG0007585 dd_Smed_v4_2813_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030666h1SMcG0022084 Contig3337GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Choline dehydrogenase vs. Ensembl Human
Match: CHDH (choline dehydrogenase [Source:HGNC Symbol;Acc:HGNC:24288])

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 312/571 (54.64%), Postives = 413/571 (72.33%), Query Frame = 3
Query: 1695 RVHASTCNTNNQAVDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-------TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLENVPIWIPKYPMKQR 3386
            R  AS  + +     Y+++GAGSAGCVLA RL+ +    V L+EAGP D        +W I+MPAAL+ NLC D+YNW Y T+ Q+ L+ R +YWPRGRV GGSSSLNAMVY+RGH  DY+RW+ +GA GW YA CLPYF+KAQ HE G + YRG +GPL VSR K N  LH ++++A  +AGY  TEDMNG++QEGFG  D TI++G+RWS++ A+L P L R NL  +  T+V+++LF+G +AVG+E + KN   ++   +KE+ILSGGA+NSPQLLMLSG+G+  +LK+  I VV H+PGVG+NLQDHLE+Y+Q    +P+TL+SA  + P   + IGL+W    +G GAT+HL++GGFIRS+PGV HPD+QFHFLPS V DHGR      A+Q HVGPMR  S G + + S +P+ HP+I PNY S + D  +FR  ++LTREIF+Q A   FRG+E+ PG   QSD+++D F+R K D+AYHPSCTC+MG       VVDPQ RV+G++NLRVVDAS+MPS+VSGNLNAPT+MIAEK AD+I G   L   ++VP++ P+    QR
Sbjct:   28 RALASAGSESRDEYSYVVVGAGSAGCVLAGRLTEDPAERVLLLEAGPKDVLAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEVQRGLDGRVLYWPRGRVWGGSSSLNAMVYVRGHAEDYERWQRQGARGWDYAHCLPYFRKAQGHELGASRYRGADGPLRVSRGKTNHPLHCAFLEATQQAGYPLTEDMNGFQQEGFGWMDMTIHEGKRWSAACAYLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYV-KNGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSA--QKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAYQVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAPFRGKELQPGSHIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGQPALWD-KDVPVYKPRTLATQR 594          
BLAST of Choline dehydrogenase vs. Ensembl Human
Match: CHDH (choline dehydrogenase [Source:HGNC Symbol;Acc:HGNC:24288])

HSP 1 Score: 152.525 bits (384), Expect = 5.640e-42
Identity = 69/128 (53.91%), Postives = 89/128 (69.53%), Query Frame = 3
Query: 1695 RVHASTCNTNNQAVDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-------TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGA 2057
            R  AS  + +     Y+++GAGSAGCVLA RL+ +    V L+EAGP D        +W I+MPAAL+ NLC D+YNW Y T+ Q+ L+ R +YWPRGRV GGSSSLNAMVY+RGH  DY+RW+ +GA
Sbjct:   28 RALASAGSESRDEYSYVVVGAGSAGCVLAGRLTEDPAERVLLLEAGPKDVLAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEVQRGLDGRVLYWPRGRVWGGSSSLNAMVYVRGHAEDYERWQRQGA 155          
BLAST of Choline dehydrogenase vs. Ensembl Human
Match: CHDH (choline dehydrogenase [Source:HGNC Symbol;Acc:HGNC:24288])

HSP 1 Score: 104.76 bits (260), Expect = 1.110e-25
Identity = 48/99 (48.48%), Postives = 64/99 (64.65%), Query Frame = 3
Query: 1695 RVHASTCNTNNQAVDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-------TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGR 1970
            R  AS  + +     Y+++GAGSAGCVLA RL+ +    V L+EAGP D        +W I+MPAAL+ NLC D+YNW Y T+ Q+ L+ R +YWPRGR
Sbjct:   28 RALASAGSESRDEYSYVVVGAGSAGCVLAGRLTEDPAERVLLLEAGPKDVLAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEVQRGLDGRVLYWPRGR 126          
BLAST of Choline dehydrogenase vs. Ensembl Celegans
Match: C34C6.4 (pep chromosome:WBcel235:II:8696591:8698928:-1 gene:WBGene00007917.1 transcript:C34C6.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C34C6.4)

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 311/557 (55.83%), Postives = 402/557 (72.17%), Query Frame = 3
Query: 1740 YIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDNTW--TINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFG---DNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKIL----------NKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYS-ATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCR-VVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLENVPIW 3359
            +II+GAGSAGCVLANRL+ + +N V LIEAGP D+ W   I+MPAAL+YNLC D YNW+Y T AQK L NR  YWPRGRV GGSS+LNAM Y+RGH +DY+RWE EGA GW+YA+CLPYFKKA+T+      ++ YRG NGPL V +      LH++W+  G E   G+T DMNG KQEG    D TI+ GERWS+SKA++ P+  R NL   +    T++LFD  KA+GIE + K   +           KI    ++IL+GGA+N+PQLLMLSGVG    L+ H I +V ++PGVG+NLQDHLE+YVQ +S +PVTLY+ ++WKFPHN+I+IGL+WF  ++G+GA+SHL++GGF RS+  V HPD+QFHFLPSTV D GR   T H +Q HVGPMRSQSKG I + + DPR+ P+I+PNY     D+ EFRK IR++RE+F+  AFDEFRG+E+ PGPD QSD  +D F+++K  +AYHPSCTC+MGS      VV+P+   V G +NL+VVDASVMPSIVSGNLNAP +M+AE+ AD+I     L    +  +W
Sbjct:   40 HIIVGAGSAGCVLANRLTEDPSNRVLLIEAGPVDHKWDWRIHMPAALMYNLCSDTYNWHYHTTAQKNLGNRVFYWPRGRVWGGSSTLNAMCYVRGHAYDYNRWEKEGASGWNYANCLPYFKKAETYSDATGPNDPYRGNNGPLYVKKGDAENPLHKAWLNVGKEHPLGWTNDMNGEKQEGISTMDMTIHNGERWSASKAYVHPIRNRPNLITSSGITCTRVLFDTNKAIGIEFIRKLNFVGTDSIDSYSREKIYCQGDVILAGGAINTPQLLMLSGVGPADHLRSHEIPIVANLPGVGQNLQDHLEIYVQQESTQPVTLYNKSSWKFPHNMIKIGLEWFTNRTGLGASSHLETGGFARSDDTVTHPDIQFHFLPSTVHDDGRTNGTCHGYQVHVGPMRSQSKGYIMLQAKDPRRAPIINPNYMEEDSDWREFRKCIRVSRELFASKAFDEFRGKELAPGPDCQSDADIDRFVKEKAASAYHPSCTCKMGSENDKMAVVNPETMGVYGTENLKVVDASVMPSIVSGNLNAPVIMMAERAADLIKHKKQLLPPSDANVW 596          
BLAST of Choline dehydrogenase vs. Ensembl Celegans
Match: F45E1.4 (pep chromosome:WBcel235:X:7985979:7988981:1 gene:WBGene00018465.1 transcript:F45E1.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F45E1.4)

HSP 1 Score: 168.318 bits (425), Expect = 3.553e-46
Identity = 88/212 (41.51%), Postives = 122/212 (57.55%), Query Frame = 3
Query:  216 VVFDKDGTLLCFHSMWTTWITNLVKNINQELDKDISSAIYSILGVCSKTYRTSPGLMAEGTKDQIKNALQKVIMAECAISEKKSNEIIEKHFQNN---AANENSLKEIHNVRKLFKVIKQHGVKIGICTSDTREGTLAALQSINSLDLVDSICCGDDPNSLPKPDPFFSKTISQDLNVPVSSMAMVGDTRSDMEFGKNSGMSGRIGVLSGIG 842
            V+FDKDGTLLCFH+MW  WI +  ++I       +   I   LG+C    +  PGL+AEGT  QI N +  ++M +  I   ++ EI      N+     + + +KE+ +   LF  +KQHG KI +CT+D R+ +L AL+ +N   LVD I CGDD N+ PKP P  +  I + L V  S   MVGDTR DME   N+ +   +GVLSGIG
Sbjct:   51 VIFDKDGTLLCFHTMWIPWIQHTAQSIETSTGLVLFPKIAQSLGLCLAENKVKPGLLAEGTTGQIANEISSLLM-DNGIKSFEAREITNNSLTNSYDKILSTDLVKELADTVALFTRLKQHGTKIAVCTADNRKSSLLALKRMNVDHLVDMIVCGDDKNTAPKPSPHNAIKICKHLGVDQSKAIMVGDTRVDMEMAHNAELGAAVGVLSGIG 261          

HSP 2 Score: 102.834 bits (255), Expect = 1.230e-23
Identity = 70/231 (30.30%), Postives = 117/231 (50.65%), Query Frame = 3
Query:  978 LIIMDKDGTLTDVYLKYKKWALLLGERLKTSTSSEITELFFKIIGFDQAETFSTGSLLGESAVLQMKDIIKYLLILNGYSSEETDKIVKKVWVDT-----SVFGDEELPEFKHSLLELKSKGMKLALNSSDSRSSIDNFIKRNNIDDVFDATVSAEDSSPHFKPLPHSILKICNDLQISTKETLLIGDSQTDMLCGRSAKVGASIGVLSGLGKSQNLMGLCQLLIPNINYL 1655
            L+I DKDGTL   +  +  W     + ++TST   +     + +G   AE      LL E    Q+ + I  LL+ NG  S E  +I      ++     S    +EL +       LK  G K+A+ ++D+R S    +KR N+D + D  V  +D +   KP PH+ +KIC  L +   + +++GD++ DM    +A++GA++GVLSG+G   +L     +L+ +I +L
Sbjct:   50 LVIFDKDGTLLCFHTMWIPWIQHTAQSIETSTGLVLFPKIAQSLGLCLAENKVKPGLLAEGTTGQIANEISSLLMDNGIKSFEAREITNNSLTNSYDKILSTDLVKELADTVALFTRLKQHGTKIAVCTADNRKSSLLALKRMNVDHLVDMIVCGDDKNTAPKPSPHNAIKICKHLGVDQSKAIMVGDTRVDMEMAHNAELGAAVGVLSGIGCKDHLH-RADVLLEHIGHL 279          
BLAST of Choline dehydrogenase vs. Ensembl Celegans
Match: F09C3.2 (pep chromosome:WBcel235:I:14271893:14274213:-1 gene:WBGene00008610.1 transcript:F09C3.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F09C3.2)

HSP 1 Score: 124.405 bits (311), Expect = 1.673e-31
Identity = 65/214 (30.37%), Postives = 114/214 (53.27%), Query Frame = 3
Query:  216 VVFDKDGTLLCFHSMWTTWITNLVKNINQELDKDISSAIYSILGVCSKTYRTSPGLMAEGTKDQIKNALQKVIMAECAISEKKSNEIIEKHFQNNAANENSLKEIHNVRKLFKVIKQHGVKIGICTSDTREGTLAALQSINSLDLVDSICCGDDPNSLPKPDPFFSKTISQDLNVPVSSMAMVGDTRSDMEFGKNSGMSGRIGVLSGIGDSEIL 857
            ++FDKDGTLL FH MW  + T  V+ +    +  +  AIY  LGV     + S G +AE T   I+  +  + +    +   +++ I++      +  E  +  + ++  LF  +K  G+KI +CT+D+R  T+  +  +N +  +D I CG+D   +PKP P  +  I + L V +    MVGDT +D++ GK +G+   + V++G+G  + L
Sbjct:   11 IIFDKDGTLLDFHKMWMPYATTTVRLLEAATNLRVGPAIYKTLGVDPVAGKVSMGALAEKTLTGIREDIS-LTLQTFGLLPVEADAIVQGCVPEASPGE--MSPVCDMPALFTTLKSMGIKIAVCTADSRAATMDQMNKMNVIPFLDDIICGNDVGIVPKPSPHCAIQICKRLGVELKETLMVGDTIADLKMGKIAGLRASVAVMTGVGTRDTL 221          

HSP 2 Score: 102.449 bits (254), Expect = 6.128e-24
Identity = 65/231 (28.14%), Postives = 112/231 (48.48%), Query Frame = 3
Query:  975 KLIIMDKDGTLTDVYLKYKKWALLLGERLKTSTSSEITELFFKIIGFDQAETFSTGSLLGESAVLQMKDIIKYLLILNGYSSEETDKIVKKVWVDTSVFGDEELPEFKHSLLELKSKGMKLALNSSDSRSSIDNFIKRNNIDDVFDATVSAEDSSPHFKPLPHSILKICNDLQISTKETLLIGDSQTDMLCGRSAKVGASIGVLSGLGKSQNLMGLCQLLIPNINYLPQLL 1667
            KLII DKDGTL D +  +  +A      L+ +T+  +    +K +G D      +   L E  +  +++ I   L   G    E D IV+    + S      + +       LKS G+K+A+ ++DSR++  + + + N+    D  +   D     KP PH  ++IC  L +  KETL++GD+  D+  G+ A + AS+ V++G+G    L       + +I+ LP L+
Sbjct:    9 KLIIFDKDGTLLDFHKMWMPYATTTVRLLEAATNLRVGPAIYKTLGVDPVAGKVSMGALAEKTLTGIREDISLTLQTFGLLPVEADAIVQGCVPEASPGEMSPVCDMPALFTTLKSMGIKIAVCTADSRAATMDQMNKMNVIPFLDDIICGNDVGIVPKPSPHCAIQICKRLGVELKETLMVGDTIADLKMGKIAGLRASVAVMTGVGTRDTLAQYSDYFLEDISELPHLI 239          
BLAST of Choline dehydrogenase vs. Ensembl Fly
Match: CG45065 (gene:FBgn0266435 transcript:FBtr0344424)

HSP 1 Score: 322.783 bits (826), Expect = 4.086e-97
Identity = 219/615 (35.61%), Postives = 328/615 (53.33%), Query Frame = 3
Query: 1590 GLGKSQNLMGLCQLLIPNINYLPQLLHSRSFHTSCRVHASTCNTNNQAVDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDNTWTINMPAALIYNLCHDKYNWYYTT---KAQKY---LNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHE---FGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDG-KKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELY-VQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRS---EPGVAHPDLQFHFLPSTVKDHG----RKLATF-------------HAFQAHVGPM--RSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEI--LPGPDA-----QSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMI 3314
              G   +L+G+  LL   +N+       +S     +V   T     +  D+++IG GSAG V+ANRLS   N TV L+EAG  D T   ++PA   Y L   + +W Y T     ++Y   +     +WPRG+VLGGSS LNAMVY+RG   DY+ W S G  GW Y S L YF K++           Y    G L V  +     L  ++++AG+E GY    D+NG +Q GF     TI +G R S+ KAF++PV +R N  V  +   T+ILFD  K+A+G+E +   +  N + V +E+I S GA+N+P+LLMLSGVG    L++H+I V++ +P VG N+QDH+ L  +      P+T+    ++     I + +++ L + G    S ++   F+ +   +P V  PD+QFHF PS++   G    RK+                H+    + P+  R +S G + + S +P+  P I PNY + + D     + I+L   + +  AF  F G  +  +P P       QS+E     I++ T T YHP+ TCRMG +     VVDP+ RV G+  +RVVDAS+MP+IV+GN NAP + I EK +D+I
Sbjct:    2 AFGTMTSLLGMIPLLAIGMNFY----RYQSVDPENKVQEPT--VIRRQYDFVVIGGGSAGAVVANRLSEVRNWTVLLLEAG-GDETEISDVPALAGY-LQLTELDWKYQTTPSSTRQYCQAMKGDRCFWPRGKVLGGSSVLNAMVYVRGSKNDYNHWASLGNPGWDYDSMLKYFLKSEDVRNPYLAKTPYHETGGYLTVQEAPWRTPLSIAFLQAGIEMGYE-NRDINGAQQTGFMLTQSTIRRGARCSTGKAFIRPVRQRKNFDVLLHAEATRILFDKQKRAIGVEYMRGGR-KNVVFVRREVIASAGALNTPKLLMLSGVGPAEHLQEHNIPVISDLP-VGNNMQDHVGLGGLTFVVDAPLTVTRNRFQ----TIPVSMEYILRERGPMTFSGVEGVAFLNTKYQDPSVDWPDVQFHFCPSSINSDGGEQIRKILNLRDGFYNTVYKPLQHSETWSILPLLLRPKSTGWVRLNSRNPQHQPKIIPNYFAHQEDIDVLVEGIKLAINVSNTQAFQRF-GSRLHNIPLPGCRHLPFQSNEYWACCIKEFTFTIYHPAGTCRMGPSWDVTAVVDPRLRVYGVSGVRVVDASIMPTIVNGNPNAPVIAIGEKASDLI 600          
BLAST of Choline dehydrogenase vs. Ensembl Fly
Match: CG9518 (gene:FBgn0030590 transcript:FBtr0073983)

HSP 1 Score: 313.923 bits (803), Expect = 6.644e-93
Identity = 203/566 (35.87%), Postives = 308/566 (54.42%), Query Frame = 3
Query: 1737 DYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDNTWTINMPAALIYNLCHDKYNWYY----TTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHE---FGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFD--GKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELY-VQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSG-MGATSHLDSGGFIR---SEPGVAHPDLQFHFLPSTV-KDHGRKLATF-----HAFQAHVGP-------------MRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEIL--PGPDAQ-----SDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMI 3314
            D+I++G+GSAG V+ANRLS      V LIEAGP +N  + ++P+   Y L   K +W Y    +TKA   + N    WPRGRVLGGSS LN M+Y+RG+  DYD W S G  GW Y + L YFKK++ +      +N Y G  G L V  S  +  L  ++++AG + GY    D+NG KQ GF     TI +G R S++KAFL+P+  R N  +  N+ VT+++ +    +A  +E +   K+  +I   +E+I+S GA+N+PQL+MLSG+G    L++H I V+  +P VG+N+QDH+ +  +     KPV +    +    N   +  Q+ L + G M     ++   F+    S   +  PD+QFH  P+++  D+G ++          +Q    P             +R +S+GS+ + S +P  +PLI+ NY     D     +  ++   +     F +F G  +   P P+ +     SD  L+  +R  + T YHP  T +MG     + VVDP+ RV G+  LRV+DAS+MP+I SGN NAP +MIAEK AD+I
Sbjct:   58 DFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEIS-DVPSLAAY-LQLSKLDWAYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVLRYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYD-NRDINGAKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKHGKVY-RIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHVGMGGLTFLVDKPVAIVQDRF----NPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQF-GSRLWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLI 613          
BLAST of Choline dehydrogenase vs. Ensembl Fly
Match: CG9518 (gene:FBgn0030590 transcript:FBtr0343598)

HSP 1 Score: 313.923 bits (803), Expect = 6.644e-93
Identity = 203/566 (35.87%), Postives = 308/566 (54.42%), Query Frame = 3
Query: 1737 DYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDNTWTINMPAALIYNLCHDKYNWYY----TTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHE---FGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFD--GKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELY-VQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSG-MGATSHLDSGGFIR---SEPGVAHPDLQFHFLPSTV-KDHGRKLATF-----HAFQAHVGP-------------MRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEIL--PGPDAQ-----SDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMI 3314
            D+I++G+GSAG V+ANRLS      V LIEAGP +N  + ++P+   Y L   K +W Y    +TKA   + N    WPRGRVLGGSS LN M+Y+RG+  DYD W S G  GW Y + L YFKK++ +      +N Y G  G L V  S  +  L  ++++AG + GY    D+NG KQ GF     TI +G R S++KAFL+P+  R N  +  N+ VT+++ +    +A  +E +   K+  +I   +E+I+S GA+N+PQL+MLSG+G    L++H I V+  +P VG+N+QDH+ +  +     KPV +    +    N   +  Q+ L + G M     ++   F+    S   +  PD+QFH  P+++  D+G ++          +Q    P             +R +S+GS+ + S +P  +PLI+ NY     D     +  ++   +     F +F G  +   P P+ +     SD  L+  +R  + T YHP  T +MG     + VVDP+ RV G+  LRV+DAS+MP+I SGN NAP +MIAEK AD+I
Sbjct:   58 DFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEIS-DVPSLAAY-LQLSKLDWAYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVLRYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYD-NRDINGAKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKHGKVY-RIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHVGMGGLTFLVDKPVAIVQDRF----NPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQF-GSRLWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLI 613          
BLAST of Choline dehydrogenase vs. Ensembl Fly
Match: CG9518 (gene:FBgn0030590 transcript:FBtr0344175)

HSP 1 Score: 313.923 bits (803), Expect = 6.644e-93
Identity = 203/566 (35.87%), Postives = 308/566 (54.42%), Query Frame = 3
Query: 1737 DYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDNTWTINMPAALIYNLCHDKYNWYY----TTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHE---FGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFD--GKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELY-VQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSG-MGATSHLDSGGFIR---SEPGVAHPDLQFHFLPSTV-KDHGRKLATF-----HAFQAHVGP-------------MRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEIL--PGPDAQ-----SDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMI 3314
            D+I++G+GSAG V+ANRLS      V LIEAGP +N  + ++P+   Y L   K +W Y    +TKA   + N    WPRGRVLGGSS LN M+Y+RG+  DYD W S G  GW Y + L YFKK++ +      +N Y G  G L V  S  +  L  ++++AG + GY    D+NG KQ GF     TI +G R S++KAFL+P+  R N  +  N+ VT+++ +    +A  +E +   K+  +I   +E+I+S GA+N+PQL+MLSG+G    L++H I V+  +P VG+N+QDH+ +  +     KPV +    +    N   +  Q+ L + G M     ++   F+    S   +  PD+QFH  P+++  D+G ++          +Q    P             +R +S+GS+ + S +P  +PLI+ NY     D     +  ++   +     F +F G  +   P P+ +     SD  L+  +R  + T YHP  T +MG     + VVDP+ RV G+  LRV+DAS+MP+I SGN NAP +MIAEK AD+I
Sbjct:   58 DFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEIS-DVPSLAAY-LQLSKLDWAYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVLRYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYD-NRDINGAKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKHGKVY-RIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHVGMGGLTFLVDKPVAIVQDRF----NPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQF-GSRLWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLI 613          
BLAST of Choline dehydrogenase vs. Ensembl Fly
Match: CG9503 (gene:FBgn0030598 transcript:FBtr0073974)

HSP 1 Score: 309.301 bits (791), Expect = 4.325e-92
Identity = 214/566 (37.81%), Postives = 302/566 (53.36%), Query Frame = 3
Query: 1737 DYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDNTWTINMPAALIYNLCHDKYNWYYTTKAQK----YLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQ--THEFGDNT-YRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFD--GKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELY-VQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSG----MGATSHLDSGGFIRSEPGVAHPDLQFHFLP-STVKDHGRKLATFHA-----FQAHVGP-------------MRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEI----LPGPDAQ---SDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMI 3314
            D+I+IGAGSAG V+ANRL+   N  V L+EAG  D T   ++P    Y L   K +W Y T+        +      WPRG+VLGGSS LN M+Y+RG   DYD WE+ G   WSY   L YFKK++  T+++  NT Y    G L V  +  +  L  S+++AG+E GY    D+NG K  GF     T  +G R S+SKAFL+P   R NL +  N+ VT+I+ D   K A G+E + K++ L  +   KE++LSGG+VNSPQLLMLSGVG   EL +H I ++  +  VG+NLQDH+ L  +     +PV++    +     V    LQ+ +F  G    +G    L       +   +  PD++FHF+  ST  D G +L   H      ++A   P             +R +S G+I + S +P  +P I PNY +   D     + +++   +    A   F G  I     PG +     +D   +  +R+ T T YHP  TC+MG     D VVD + RV G+  LRV+DAS+MP +VS N NAP +MIAEK +DMI
Sbjct:   61 DFIVIGAGSAGAVVANRLTEVENWNVLLLEAG-GDETELTDVPLMAGY-LQLSKIDWQYKTEPSGTSCLAMQGGRCNWPRGKVLGGSSVLNYMLYLRGSKHDYDNWEAMGNPSWSYRDALYYFKKSEDNTNQYLANTPYHATGGYLTVGEAPYHTPLAASFVEAGVEMGYE-NRDLNGEKMTGFMIAQGTTRRGSRCSTSKAFLRPARLRPNLHISMNSHVTRIMIDPVTKLAFGVEFV-KDQKLYHVRATKEVVLSGGSVNSPQLLMLSGVGPRKELAKHRIPLIKEL-SVGENLQDHIGLGGLTFLVNQPVSIVENRFHTMSTV----LQYAVFGQGPLTILGGVEGLAYVNTKYANSSLDWPDIEFHFVSGSTNSDGGSQLRKAHGLTDAFYRAVFEPINNRDAWSIIPMLLRPRSVGNIRLRSGNPFDYPYIFPNYLTDDFDMKTLIEGVKIAVALSRTKAMQRF-GSRISSIRWPGCEQVPLFTDAFWECMVRRYTSTIYHPVGTCKMGPYWDKDAVVDAKLRVYGIRGLRVIDASIMPKLVSANTNAPVIMIAEKGSDMI 616          
BLAST of Choline dehydrogenase vs. Ensembl Zebrafish
Match: chdh (choline dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-120111-1])

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 338/578 (58.48%), Postives = 425/578 (73.53%), Query Frame = 3
Query: 1662 LLHSRSFHTSCRVHASTCNTNNQAVDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-------TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLEN--VPIWIPK 3368
            LLH R   T         N N  +  Y+I+GAGSAGCVLA+RL+ N +++V L+EAGP D        +W I+MPAAL YNLC D+YNW+Y T  Q ++++R MYWPRGRV GGSSSLNAMVYIRGH  DY+RW+SEGA GW+Y  CLPYF+KAQTHE G + YRGG+GPL+VSR K    LH ++I+AG +AGY +TEDMNG++QEG G  D TI+KG+RWS++ A+L+P L R NL+ +   MVT++LFDG +A G+E   +N  + K+   KE+ILSGGA+NSPQLL+LSGVG+  ELK   I VV H+PGVG NLQDHLELYVQH   +P+TLY A  + P  +++IGL+W L  +G GAT+HL+SGGFIRS P V HPD+QFHFLPS V DHGR  +   AFQ HVGPMRS S G + + S DPR HP++ PNY S + D  EFR+ +RLTREIF+Q AFDEFRG E+ PGP  QSD ++D F+RQK D+AYHPSCTC+MG  +    VV P+ RV G++ LRVVDASVMPS+VSGNLNAPT+MIAEK AD I G   LP L +  VP++ P+
Sbjct:   18 LLHHRYIST-------VVNKNTPSYSYVIVGAGSAGCVLASRLTENPSDSVLLLEAGPKDKHLGSTRLSWKIHMPAALTYNLCDDRYNWFYHTLPQAHMDDRVMYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWQSEGADGWNYDHCLPYFRKAQTHELGPDRYRGGDGPLHVSRGKTQNPLHYAFIQAGQQAGYPYTEDMNGFQQEGVGWMDMTIHKGQRWSTASAYLRPALSRPNLSTEVRCMVTRVLFDGARARGVE-YQQNGQIKKVFAEKEVILSGGAINSPQLLLLSGVGNADELKTLDIPVVQHLPGVGCNLQDHLELYVQHACTQPITLYRA--QKPLQMLKIGLEWLLKFTGYGATAHLESGGFIRSRPDVPHPDIQFHFLPSQVIDHGRVSSKIEAFQVHVGPMRSTSVGWLKLKSKDPRDHPILQPNYLSTETDVLEFRECVRLTREIFAQQAFDEFRGPEVQPGPAVQSDAEIDAFVRQKADSAYHPSCTCKMGRPEDRMAVVSPELRVFGVEGLRVVDASVMPSMVSGNLNAPTIMIAEKAADAIKG---LPSLHDPGVPVYQPR 582          
BLAST of Choline dehydrogenase vs. Ensembl Zebrafish
Match: chdh (choline dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-120111-1])

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 336/574 (58.54%), Postives = 427/574 (74.39%), Query Frame = 3
Query: 1680 FHTSCRVH--ASTCNTNNQAVDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-------TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLEN--VPIWIPK 3368
            F +S R+   ++  N N  +  Y+I+GAGSAGCVLA+RL+ N +++V L+EAGP D        +W I+MPAAL YNLC D+YNW+Y T  Q ++++R MYWPRGRV GGSSSLNAMVYIRGH  DY+RW+SEGA GW+Y  CLPYF+KAQTHE G + YRGG+GPL+VSR K    LH ++I+AG +AGY +TEDMNG++QEG G  D TI+KG+RWS++ A+L+P L R NL+ +   MVT++LFDG +A G+E   +N  + K+   KE+ILSGGA+NSPQLL+LSGVG+  ELK   I VV H+PGVG NLQDHLELYVQH   +P+TLY A  + P  +++IGL+W L  +G GAT+HL+SGGFIRS P V HPD+QFHFLPS V DHGR  +   AFQ HVGPMRS S G + + S DPR HP++ PNY S + D  EFR+ +RLTREIF+Q AFDEFRG E+ PGP  QSD ++D F+RQK D+AYHPSCTC+MG  +    VV P+ RV G++ LRVVDASVMPS+VSGNLNAPT+MIAEK AD I G   LP L +  VP++ P+
Sbjct:   75 FSSSTRLMYISTVVNKNTPSYSYVIVGAGSAGCVLASRLTENPSDSVLLLEAGPKDKHLGSTRLSWKIHMPAALTYNLCDDRYNWFYHTLPQAHMDDRVMYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWQSEGADGWNYDHCLPYFRKAQTHELGPDRYRGGDGPLHVSRGKTQNPLHYAFIQAGQQAGYPYTEDMNGFQQEGVGWMDMTIHKGQRWSTASAYLRPALSRPNLSTEVRCMVTRVLFDGARARGVE-YQQNGQIKKVFAEKEVILSGGAINSPQLLLLSGVGNADELKTLDIPVVQHLPGVGCNLQDHLELYVQHACTQPITLYRA--QKPLQMLKIGLEWLLKFTGYGATAHLESGGFIRSRPDVPHPDIQFHFLPSQVIDHGRVSSKIEAFQVHVGPMRSTSVGWLKLKSKDPRDHPILQPNYLSTETDVLEFRECVRLTREIFAQQAFDEFRGPEVQPGPAVQSDAEIDAFVRQKADSAYHPSCTCKMGRPEDRMAVVSPELRVFGVEGLRVVDASVMPSMVSGNLNAPTIMIAEKAADAIKG---LPSLHDPGVPVYQPR 642          
BLAST of Choline dehydrogenase vs. Ensembl Mouse
Match: Chdh (choline dehydrogenase [Source:MGI Symbol;Acc:MGI:1860776])

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 318/558 (56.99%), Postives = 419/558 (75.09%), Query Frame = 3
Query: 1740 YIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-------TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLE--NVPIWIPKYPMKQR 3386
            ++++GAGSAGCVLA+RL+ + N+ V L+EAGP D         W I+MPAAL+ NLC DKYNWYY T+ Q  +++R +YWPRGRV GGSSSLNAMVYIRGH  DY+RW  EGA GW YA CLPYF+KAQ HE G N YRGG+GPL+VSR K N  LH+++++A  +AGY FTEDMNG++QEGFG  D T+++G+RWS++ A+L PVL R NL  +  T+V+++LF+G +AVG+E + K+   +K  V++E+ILSGGA+NSPQLLMLSGVG+  +L++  I VV H+PGVG+NLQDHLE+YVQ    +P+TL+SA  + P   + IGL+W    +G GAT+HL++GGFIRS PGV HPD+QFHFLPS V DHGRK     A+Q HVG MR+ S G + + S +PR HP+I PNY S + D  +FR+ +RL+REIF+Q A   FRG+E+ PG   QSD+++D F+R K D+AYHPSCTC+MG +     VVD Q +V+G++NLRVVDAS+MPS+VSGNLNAPT+MIAEK AD+I G+   P LE  NVP++ P+    QR
Sbjct:   45 FVVVGAGSAGCVLASRLTEDPNHRVLLLEAGPKDLLMGSKRLQWKIHMPAALVSNLCDDKYNWYYHTEPQPGMDSRVLYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHREGAEGWDYAHCLPYFRKAQRHELGANMYRGGDGPLHVSRGKTNHPLHQAFLQAARQAGYPFTEDMNGFQQEGFGWMDMTVHQGKRWSTACAYLHPVLSRPNLRAEVQTLVSRVLFEGTRAVGVEYI-KDGQRHKAYVSREVILSGGAINSPQLLMLSGVGNADDLRKLDIPVVCHLPGVGQNLQDHLEVYVQQACTQPITLHSA--QKPLRKVCIGLEWLWSYTGDGATAHLETGGFIRSRPGVPHPDIQFHFLPSQVIDHGRKPTQQEAYQVHVGTMRATSVGWLKLRSANPRDHPVIHPNYLSTETDVEDFRQCVRLSREIFAQEALAPFRGKELQPGSHVQSDKEIDAFVRAKADSAYHPSCTCKMGRSSDPTAVVDAQTKVIGVENLRVVDASIMPSVVSGNLNAPTVMIAEKAADIIKGH---PALEDKNVPVYKPQTLDTQR 596          
BLAST of Choline dehydrogenase vs. Ensembl Mouse
Match: Chdh (choline dehydrogenase [Source:MGI Symbol;Acc:MGI:1860776])

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 318/558 (56.99%), Postives = 419/558 (75.09%), Query Frame = 3
Query: 1740 YIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-------TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLE--NVPIWIPKYPMKQR 3386
            ++++GAGSAGCVLA+RL+ + N+ V L+EAGP D         W I+MPAAL+ NLC DKYNWYY T+ Q  +++R +YWPRGRV GGSSSLNAMVYIRGH  DY+RW  EGA GW YA CLPYF+KAQ HE G N YRGG+GPL+VSR K N  LH+++++A  +AGY FTEDMNG++QEGFG  D T+++G+RWS++ A+L PVL R NL  +  T+V+++LF+G +AVG+E + K+   +K  V++E+ILSGGA+NSPQLLMLSGVG+  +L++  I VV H+PGVG+NLQDHLE+YVQ    +P+TL+SA  + P   + IGL+W    +G GAT+HL++GGFIRS PGV HPD+QFHFLPS V DHGRK     A+Q HVG MR+ S G + + S +PR HP+I PNY S + D  +FR+ +RL+REIF+Q A   FRG+E+ PG   QSD+++D F+R K D+AYHPSCTC+MG +     VVD Q +V+G++NLRVVDAS+MPS+VSGNLNAPT+MIAEK AD+I G+   P LE  NVP++ P+    QR
Sbjct:   45 FVVVGAGSAGCVLASRLTEDPNHRVLLLEAGPKDLLMGSKRLQWKIHMPAALVSNLCDDKYNWYYHTEPQPGMDSRVLYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHREGAEGWDYAHCLPYFRKAQRHELGANMYRGGDGPLHVSRGKTNHPLHQAFLQAARQAGYPFTEDMNGFQQEGFGWMDMTVHQGKRWSTACAYLHPVLSRPNLRAEVQTLVSRVLFEGTRAVGVEYI-KDGQRHKAYVSREVILSGGAINSPQLLMLSGVGNADDLRKLDIPVVCHLPGVGQNLQDHLEVYVQQACTQPITLHSA--QKPLRKVCIGLEWLWSYTGDGATAHLETGGFIRSRPGVPHPDIQFHFLPSQVIDHGRKPTQQEAYQVHVGTMRATSVGWLKLRSANPRDHPVIHPNYLSTETDVEDFRQCVRLSREIFAQEALAPFRGKELQPGSHVQSDKEIDAFVRAKADSAYHPSCTCKMGRSSDPTAVVDAQTKVIGVENLRVVDASIMPSVVSGNLNAPTVMIAEKAADIIKGH---PALEDKNVPVYKPQTLDTQR 596          
BLAST of Choline dehydrogenase vs. UniProt/SwissProt
Match: sp|Q6UPE0|CHDH_RAT (Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1)

HSP 1 Score: 684.871 bits (1766), Expect = 0.000e+0
Identity = 326/573 (56.89%), Postives = 425/573 (74.17%), Query Frame = 3
Query: 1689 SCRVHASTCNTNNQAVDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-------TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLENVPIWIPKYPMKQR 3386
            SC V AS  +       +I++GAGSAGCVLANRL+ + N+ V L+EAGP D         W I+MPAAL+ NLC DKYNWYY T+AQ  L+ R +YWPRGRV GGSSSLNAMVYIRGH  DY+RW  +GA GW YA CLPYF+KAQ HE G N YRGG+GPL+VSR K N  LH+++++A  +AGY FTEDMNG++QEGFG  D TI++G+RWS++ A+L+P L R NL  +  T+V+++LF+G +AVG+E + K+   +K  V++E+ILSGGA+NSPQLLMLSGVG+  +LK+  I VV H+PGVG+NLQDHLE+Y+QH   +P+TL+SA  + P   + IGL+W    +G GAT+HL++GGFIRS PGV HPD+QFHFLPS V DHGRK     A+Q HVG MR+ S G + + S +P+ HP+I+PNY S + D  +FR+ ++LTREIF+Q AF  FRG+E+ PG   QSD+++D F+R K D+AYHPSCTC+MG       VVD Q RV+G++NLRV+DAS+MPS+VSGNLNAPT+MIAEK AD+I G   L   ENVP++ P+    QR
Sbjct:   32 SCAV-ASAASGGKDEYTFIVVGAGSAGCVLANRLTEDPNHRVLLLEAGPKDLLMGSKRLQWKIHMPAALVANLCDDKYNWYYHTEAQPGLDGRVLYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHRQGAEGWDYAHCLPYFRKAQKHELGANMYRGGDGPLHVSRGKTNHPLHQAFLQAARQAGYPFTEDMNGFQQEGFGWMDMTIHQGKRWSTASAYLRPALSRPNLRAEVQTLVSRVLFEGTRAVGVEYI-KDGQSHKAYVSREVILSGGAINSPQLLMLSGVGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQHACTQPITLHSA--QKPLRKVCIGLEWLWRFTGDGATAHLETGGFIRSRPGVPHPDIQFHFLPSQVIDHGRKPTQQEAYQVHVGTMRATSVGWLKLRSTNPQDHPMINPNYLSTETDVEDFRQCVKLTREIFAQEAFAPFRGKELQPGSHVQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDQQTRVIGVENLRVIDASIMPSVVSGNLNAPTIMIAEKAADVIKGCPALGD-ENVPVYKPQTLDTQR 599          
BLAST of Choline dehydrogenase vs. UniProt/SwissProt
Match: sp|Q8BJ64|CHDH_MOUSE (Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1)

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 318/558 (56.99%), Postives = 419/558 (75.09%), Query Frame = 3
Query: 1740 YIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-------TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLE--NVPIWIPKYPMKQR 3386
            ++++GAGSAGCVLA+RL+ + N+ V L+EAGP D         W I+MPAAL+ NLC DKYNWYY T+ Q  +++R +YWPRGRV GGSSSLNAMVYIRGH  DY+RW  EGA GW YA CLPYF+KAQ HE G N YRGG+GPL+VSR K N  LH+++++A  +AGY FTEDMNG++QEGFG  D T+++G+RWS++ A+L PVL R NL  +  T+V+++LF+G +AVG+E + K+   +K  V++E+ILSGGA+NSPQLLMLSGVG+  +L++  I VV H+PGVG+NLQDHLE+YVQ    +P+TL+SA  + P   + IGL+W    +G GAT+HL++GGFIRS PGV HPD+QFHFLPS V DHGRK     A+Q HVG MR+ S G + + S +PR HP+I PNY S + D  +FR+ +RL+REIF+Q A   FRG+E+ PG   QSD+++D F+R K D+AYHPSCTC+MG +     VVD Q +V+G++NLRVVDAS+MPS+VSGNLNAPT+MIAEK AD+I G+   P LE  NVP++ P+    QR
Sbjct:   45 FVVVGAGSAGCVLASRLTEDPNHRVLLLEAGPKDLLMGSKRLQWKIHMPAALVSNLCDDKYNWYYHTEPQPGMDSRVLYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHREGAEGWDYAHCLPYFRKAQRHELGANMYRGGDGPLHVSRGKTNHPLHQAFLQAARQAGYPFTEDMNGFQQEGFGWMDMTVHQGKRWSTACAYLHPVLSRPNLRAEVQTLVSRVLFEGTRAVGVEYI-KDGQRHKAYVSREVILSGGAINSPQLLMLSGVGNADDLRKLDIPVVCHLPGVGQNLQDHLEVYVQQACTQPITLHSA--QKPLRKVCIGLEWLWSYTGDGATAHLETGGFIRSRPGVPHPDIQFHFLPSQVIDHGRKPTQQEAYQVHVGTMRATSVGWLKLRSANPRDHPVIHPNYLSTETDVEDFRQCVRLSREIFAQEALAPFRGKELQPGSHVQSDKEIDAFVRAKADSAYHPSCTCKMGRSSDPTAVVDAQTKVIGVENLRVVDASIMPSVVSGNLNAPTVMIAEKAADIIKGH---PALEDKNVPVYKPQTLDTQR 596          
BLAST of Choline dehydrogenase vs. UniProt/SwissProt
Match: sp|Q8NE62|CHDH_HUMAN (Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2)

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 312/571 (54.64%), Postives = 413/571 (72.33%), Query Frame = 3
Query: 1695 RVHASTCNTNNQAVDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-------TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLENVPIWIPKYPMKQR 3386
            R  AS  + +     Y+++GAGSAGCVLA RL+ +    V L+EAGP D        +W I+MPAAL+ NLC D+YNW Y T+ Q+ L+ R +YWPRGRV GGSSSLNAMVY+RGH  DY+RW+ +GA GW YA CLPYF+KAQ HE G + YRG +GPL VSR K N  LH ++++A  +AGY  TEDMNG++QEGFG  D TI++G+RWS++ A+L P L R NL  +  T+V+++LF+G +AVG+E + KN   ++   +KE+ILSGGA+NSPQLLMLSG+G+  +LK+  I VV H+PGVG+NLQDHLE+Y+Q    +P+TL+SA  + P   + IGL+W    +G GAT+HL++GGFIRS+PGV HPD+QFHFLPS V DHGR      A+Q HVGPMR  S G + + S +P+ HP+I PNY S + D  +FR  ++LTREIF+Q A   FRG+E+ PG   QSD+++D F+R K D+AYHPSCTC+MG       VVDPQ RV+G++NLRVVDAS+MPS+VSGNLNAPT+MIAEK AD+I G   L   ++VP++ P+    QR
Sbjct:   28 RALASAGSESRDEYSYVVVGAGSAGCVLAGRLTEDPAERVLLLEAGPKDVLAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEVQRGLDGRVLYWPRGRVWGGSSSLNAMVYVRGHAEDYERWQRQGARGWDYAHCLPYFRKAQGHELGASRYRGADGPLRVSRGKTNHPLHCAFLEATQQAGYPLTEDMNGFQQEGFGWMDMTIHEGKRWSAACAYLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYV-KNGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSA--QKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAYQVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAPFRGKELQPGSHIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGQPALWD-KDVPVYKPRTLATQR 594          
BLAST of Choline dehydrogenase vs. UniProt/SwissProt
Match: sp|Q8G1Z8|BETA_BRUSU (Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=betA PE=3 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 263/552 (47.64%), Postives = 380/552 (68.84%), Query Frame = 3
Query: 1734 VDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDNTWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLENVPIWI-PKYPMKQR 3386
             D++IIG+GSAG  +A RLS N   +V +IE G  D    I MPAAL + +  + Y+W ++++ + ++  R +  PRG+VLGGSSS+N MVY+RGH  D+D W   GA GW+YA  LPYFK+ +  + G   +RG NGPL V R K +  L  ++++AG +AG+  T+D NG KQEGFG  +QTI+ G RWS++ A+LKP LKR N+ +       KI+ +GK+AVG+EI +  +  + I   +E+I++  ++NSP+LLMLSG+G  A LK+H ID+V   PGVG+NLQDHLE+Y+Q +  +P+TLYS    F  +  RIG++W LFK+G GAT+H +S  F+RS+ GV +PD+Q+HFLP  ++  G+  A  H FQAHVGPMRS+S+GS+T+ S +PR+ P+I  NY S + D+ +FR  +RLTREIF Q+AFD +RG EI PG   Q+D+++D FIR+  ++A+HP  TC+MG+      VVDP+CRV+G++ LRV D+S+ P I +GNLN P++M+ EK +D ILG  PL +    P WI P++ +  R
Sbjct:    3 ADFVIIGSGSAGSAMAYRLSENGRYSVIVIEYGVPDVGPLIQMPAALSFPMNMETYDWGFSSEPEPHIGGRSLVTPRGKVLGGSSSINGMVYVRGHACDFDHWSQSGARGWAYADVLPYFKRMENSQGGQEGWRGTNGPLYVQRGKRDNPLFHAFVEAGHQAGFEVTDDYNGEKQEGFGPMEQTIHNGRRWSAANAYLKPALKRPNVKL-VKGFARKIVLEGKRAVGVEI-EAGRTFSTIRARREVIIAASSINSPKLLMLSGIGPAAHLKEHGIDLVADRPGVGQNLQDHLEVYIQQECTQPITLYSELNLF--SKARIGVEWLLFKTGDGATNHFESAAFVRSKAGVEYPDIQYHFLPVAIRYDGKAAAQSHGFQAHVGPMRSKSRGSVTLRSANPREKPVIKFNYMSHEDDWADFRHCVRLTREIFGQAAFDPYRGAEIQPGAHVQTDDEIDNFIREHVESAFHPCGTCKMGAVDDPMAVVDPECRVIGVEGLRVADSSIFPRITNGNLNGPSIMVGEKASDHILGRTPLARSNQEP-WINPRWQVSDR 549          
BLAST of Choline dehydrogenase vs. UniProt/SwissProt
Match: sp|B0CKN4|BETA_BRUSI (Oxygen-dependent choline dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) OX=470137 GN=betA PE=3 SV=1)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 262/552 (47.46%), Postives = 380/552 (68.84%), Query Frame = 3
Query: 1734 VDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDNTWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLENVPIWI-PKYPMKQR 3386
             D++IIG+GSAG  +A RLS +   +V +IE G  D    I MPAAL + +  + Y+W ++++ + ++  R +  PRG+VLGGSSS+N MVY+RGH  D+D W   GA GW+YA  LPYFK+ +  + G   +RG NGPL V R K +  L  ++++AG +AG+  T+D NG KQEGFG  +QTI+ G RWS++ A+LKP LKR N+ +       KI+ +GK+AVG+EI +  +  + I   +E+I++  ++NSP+LLMLSG+G  A LK+H ID+V   PGVG+NLQDHLE+Y+Q +  +P+TLYS    F  +  RIG++W LFK+G GAT+H +S  F+RS+ GV +PD+Q+HFLP  ++  G+  A  H FQAHVGPMRS+S+GS+T+ S +PR+ P+I  NY S + D+ +FR  +RLTREIF Q+AFD +RG EI PG   Q+D+++D FIR+  ++A+HP  TC+MG+      VVDP+CRV+G++ LRV D+S+ P I +GNLN P++M+ EK +D ILG  PL +    P WI P++ +  R
Sbjct:    3 ADFVIIGSGSAGSAMAYRLSEDGRYSVIVIEYGVPDVGPLIQMPAALSFPMNMETYDWGFSSEPEPHIGGRSLVTPRGKVLGGSSSINGMVYVRGHACDFDHWSQSGARGWAYADVLPYFKRMENSQGGQEGWRGTNGPLYVQRGKRDNPLFHAFVEAGHQAGFEVTDDYNGEKQEGFGPMEQTIHNGRRWSAANAYLKPALKRPNVKL-VKGFARKIVLEGKRAVGVEI-EAGRTFSTIRARREVIIAASSINSPKLLMLSGIGPAAHLKEHGIDLVADRPGVGQNLQDHLEVYIQQECTQPITLYSKLNLF--SKARIGVEWLLFKTGDGATNHFESAAFVRSKAGVEYPDIQYHFLPVAIRYDGKAAAQSHGFQAHVGPMRSKSRGSVTLRSANPREKPVIKFNYMSHEDDWADFRHCVRLTREIFGQAAFDPYRGAEIQPGAHVQTDDEIDNFIREHVESAFHPCGTCKMGAVDDPMAVVDPECRVIGVEGLRVADSSIFPRITNGNLNGPSIMVGEKASDHILGRTPLARSNQEP-WINPRWQVSDR 549          
BLAST of Choline dehydrogenase vs. TrEMBL
Match: A0A267H5C7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009934g1 PE=3 SV=1)

HSP 1 Score: 1108.59 bits (2866), Expect = 0.000e+0
Identity = 539/1138 (47.36%), Postives = 752/1138 (66.08%), Query Frame = 3
Query:   51 FEMIIKPILR------RKIQQILYHRRYSIDLVQKQILSVNKNTDILSEKLFDDRQPKFEAVVFDKDGTLLCFHSMWTTWITNLVKNINQELDKDISSAIYSILGVCSKTYRTSPGLMAEGTKDQIKNALQKVIMAECAISEKKSNEIIEKHFQNNAANENSLKEIHNVRKLFKVIKQHGVKIGICTSDTREGTLAALQSINSLDLVDSICCGDDPNSLPKPDPFFSKTISQDLNVPVSSMAMVGDTRSDMEFGKNSGMSGRIGVLSGIGDSEILQNSGATDIIRSVEDILPLLLPSCPIKLSKDTELISSQEWKLIIMDKDGTLTDVYLKYKKWALLLGERLKTSTSSEITELFFKIIGFDQAETFSTGSLLGESAVLQMKDIIKYLLILN-GYSSEETDKIVKKVWVDTSVFGDEE--------LPEFKHSLLELKSKGMKLALNSSDSRSSIDNFIKRNNIDDVFDATVSAEDSSP---HFKPLPHSILKICNDLQISTKETLLIGDSQTDMLCGRSAKVGASIGVLSGLGKSQNLMGLCQLLIPNINYLPQLLHSRSFHTSCRVHASTCNTNNQAVDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHE-FGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKIL---NKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLENVPIWIPKYPMKQRESE 3395
            F+ + +P LR        + Q+  H+  S+ L Q+Q          L +KL  +R  ++  V+FDKDGTL+CFHSMW  W   L   + +    D+++ +Y ILGVC +T R  PGL+AEGTK Q++ AL +++  E  + + K+  I+E      A +   +KE+H++ +LF+V++QHGVKI +CTSD RE T+ +L+ +    LVD + C DDP SLPKPDP  +  I   L+V      MVGDT +DM+F K +G+   +GVLSGIG    L+ +GA+ ++ +V D+LP   P  PI L++   LI+ ++W+LII DKDG+L DV  ++ +WAL +G RL  +TS  + E F+ +IGFD       G  L ES +  ++D+++ LL+L      ++   I+ +VW D S   +          +PE   +L +L+S G ++A+ +SDSR+S++ F+   ++  + D +++  +  P     K  P  +L  C    +S  + +++GD++ D+  GR A++GA++GVLSG+   + LM    LL+PN+  L  LL  R      R   ST   + +  DY+I+GAGSAGCVLANRL+ + N  V LIEAGP+D     I+MPAAL+YNLCHDKYNWYY T  QK++++R MYWPRGRVLGGSSSLNAMVY+RGH FDYDRW  EGA GWSYA CLPYF+KAQ H+    + Y GG+GPL+VSR +    LH +W+ AG EAGY  ++++ GY+QEG G  D T++ G RWS++ A+L P  KR NLTV T+ +VT ++FDG +A G+++  +         +  N+E+ILSGGA+NSPQLLMLSG+GD  +L+   I +V+H+PGVG NLQDHLELYVQ +  +P+TLYSA WKFP N++ IGL+W   ++G GATSHL++GGFIR+E GV HPD+QFHFLPS V DHGRK    HAFQ HVGPMR +S+G++ + S DPRQ PL+DPNY + +RD WE R+ IRL REIF+Q AFD++RG E+ PG +A++D QLD F+R  +D+AYHPSCTCRMG      +V+D   RV GLD LRVVDAS MPSIVSGNLN PT+M+AEK AD+I G  PLP    VP+W P  P +QR+ E
Sbjct:   18 FQGLTRPPLRWARPSSSALLQLPGHQTPSLQL-QRQ----------LHDKLVHNRSLRYRLVIFDKDGTLVCFHSMWAPWARGLANRLVKASGLDVAAKVYGILGVCEQTQRAGPGLLAEGTKAQMRVALAQMLAHE-GMDKAKATAIVEACVPEPATDAEHVKELHDLSQLFEVLRQHGVKIAVCTSDQRESTIESLRRLGVSHLVDKVVCADDPTSLPKPDPHNALMICDALSVHPKDTVMVGDTATDMQFAKQAGLGLGVGVLSGIGRKADLEAAGASTVVNTVGDVLPNFFPDQPISLTESARLIAERDWRLIICDKDGSLADVRTRWSEWALRVGNRLAEATSESVAENFYDLIGFDPDTGRILGGPLAESPLSDLRDMLESLLLLKWRVDDKQLRGILDQVWDDGSSVSNRAADSLAADGIPE---ALADLRSLGCRVAVVTSDSRASLNQFLTDFSLASLVDYSLTPAEHQPWSGACKSQP--LLAACRLAGVSPADAVVVGDTRADLSGGRRARLGATVGVLSGMSGPEALMPHADLLVPNLPGLTGLLKRRPAAELGRRSYSTSAASAE-YDYVIVGAGSAGCVLANRLTEDSNVRVLLIEAGPTDRRNLFIHMPAALMYNLCHDKYNWYYHTLPQKHMDSRVMYWPRGRVLGGSSSLNAMVYVRGHAFDYDRWAKEGAAGWSYADCLPYFRKAQHHDDLPADDYVGGDGPLHVSRGRTAHPLHSAWLAAGQEAGYPLSDNLYGYQQEGVGWLDMTVHNGRRWSTATAYLWPAAKRPNLTVVTDKLVTSLMFDGLRATGLQMQGRRGGGGDSQTVRANREVILSGGAINSPQLLMLSGIGDADQLRNLGIPLVHHLPGVGANLQDHLELYVQQRCTQPITLYSAQWKFPWNMVGIGLRWLTTQTGWGATSHLETGGFIRTEAGVPHPDVQFHFLPSVVTDHGRKSGNCHAFQVHVGPMRPESRGTLRLASADPRQAPLLDPNYMATERDRWEMRQCIRLAREIFAQPAFDQYRGSELQPGSEARTDAQLDAFVRAASDSAYHPSCTCRMGPAADPTSVLDENLRVRGLDGLRVVDASAMPSIVSGNLNGPTIMLAEKAADIIRGRQPLPPATEVPVWQPAQPERQRDGE 1137          
BLAST of Choline dehydrogenase vs. TrEMBL
Match: A0A267FYP1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009934g2 PE=3 SV=1)

HSP 1 Score: 1106.66 bits (2861), Expect = 0.000e+0
Identity = 538/1138 (47.28%), Postives = 751/1138 (65.99%), Query Frame = 3
Query:   51 FEMIIKPILR------RKIQQILYHRRYSIDLVQKQILSVNKNTDILSEKLFDDRQPKFEAVVFDKDGTLLCFHSMWTTWITNLVKNINQELDKDISSAIYSILGVCSKTYRTSPGLMAEGTKDQIKNALQKVIMAECAISEKKSNEIIEKHFQNNAANENSLKEIHNVRKLFKVIKQHGVKIGICTSDTREGTLAALQSINSLDLVDSICCGDDPNSLPKPDPFFSKTISQDLNVPVSSMAMVGDTRSDMEFGKNSGMSGRIGVLSGIGDSEILQNSGATDIIRSVEDILPLLLPSCPIKLSKDTELISSQEWKLIIMDKDGTLTDVYLKYKKWALLLGERLKTSTSSEITELFFKIIGFDQAETFSTGSLLGESAVLQMKDIIKYLLILN-GYSSEETDKIVKKVWVDTSV--------FGDEELPEFKHSLLELKSKGMKLALNSSDSRSSIDNFIKRNNIDDVFDATVSAEDSSP---HFKPLPHSILKICNDLQISTKETLLIGDSQTDMLCGRSAKVGASIGVLSGLGKSQNLMGLCQLLIPNINYLPQLLHSRSFHTSCRVHASTCNTNNQAVDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHE-FGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKIL---NKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLENVPIWIPKYPMKQRESE 3395
            F+ + +P LR        + Q+  H+  S+ L Q+Q          L +KL  +R  ++  V+FDKDGTL+CFHSMW  W   L   + +    D+++ +Y ILGVC +T R  PGL+AEGTK Q++ AL +++  E  + + K+  I+E      A +   +KE+H++ +LF+V++QHGVKI +CTSD RE T+ +L+ +    LVD + C DDP SLPKPDP  +  I   L+V      MVGDT +DM+F K +G+   +GVLSGIG    L+ +GA+ ++ +V D+LP   P  PI L++   LI+ ++W+LII DKDG+L DV  ++ +WAL +G RL  +TS  + E F+ +IGFD       G  L ES +  ++D+++ LL+L      ++   I+ +VW D S            + +PE   +L +L+S G ++A+ +SDSR+S++ F+   ++  + D +++  +  P     K  P  +L  C    +S  + +++GD++ D+  GR A++GA++GVLSG+   + LM    LL+PN+  L  LL  R      R   ST   + +  DY+I+GAGSAGCVLANRL+ + N  V LIEAGP+D     I+MPAAL+YNLCHDKYNWYY T  QK++++R MYWPRGRVLGGSSSLNAMVY+RGH FDYDRW  EGA GWSYA CLPYF+K Q H+    + Y GG+GPL+VSR +    LH +W+ AG EAGY  ++++ GY+QEG G  D T++ G RWS++ A+L P  KR NLTV T+ +VT ++FDG +A G+++  +         +  N+E+ILSGGA+NSPQLLMLSG+GD  +L+   I +V+H+PGVG NLQDHLELYVQ +  +P+TLYSA WKFP N++ IGL+W   ++G GATSHL++GGFIR+E GV HPD+QFHFLPS V DHGRK    HAFQ HVGPMR +S+G++ + S DPRQ PL+DPNY + +RD WE R+ IRL REIF+Q AFD++RG E+ PG +A++D QLD F+R  +D+AYHPSCTCRMG      +V+D   RV GLD LRVVDAS MPSIVSGNLN PT+M+AEK AD+I G  PLP    VP+W P  P +QR+ E
Sbjct:   18 FQGLTRPPLRWARSSSSALLQLPGHQAPSLQL-QRQ----------LHDKLVHNRSLRYRLVIFDKDGTLVCFHSMWAPWARGLANRLVKASGLDVAAKVYGILGVCEQTQRAGPGLLAEGTKAQMRVALAQMLAHE-GMDKAKATAIVEACVPEPATDAEHVKELHDLSQLFEVLRQHGVKIAVCTSDQRESTIESLRRLGVSHLVDKVVCADDPTSLPKPDPHNALMICDALSVHPKDTVMVGDTATDMQFAKQAGLGLGVGVLSGIGRKADLEAAGASTVVNTVGDVLPNFFPDQPISLTESARLIAERDWRLIICDKDGSLADVRTRWSEWALRVGNRLAEATSESVAENFYDLIGFDPDTGRILGGPLAESPLSDLRDMLESLLLLKWRVDDKQLRGILDQVWDDGSSASNRAADSLAADGIPE---ALADLRSLGCRVAVVTSDSRASLNQFLTDFSLASLVDYSLTPAEHQPWSGACKSQP--LLAACRLAGVSPADAVVVGDTRADLSGGRRARLGATVGVLSGMSGPEALMPHADLLVPNLPGLTGLLKRRPAAELGRRSYSTSAASAE-YDYVIVGAGSAGCVLANRLTEDSNVRVLLIEAGPTDRRNLFIHMPAALMYNLCHDKYNWYYHTLPQKHMDSRVMYWPRGRVLGGSSSLNAMVYVRGHAFDYDRWAKEGAAGWSYADCLPYFRKGQHHDDLPADDYVGGDGPLHVSRGRTAHPLHSAWLAAGQEAGYPLSDNLYGYQQEGVGWLDMTVHNGRRWSTATAYLWPAAKRPNLTVVTDKLVTSLVFDGLRATGLQMQGRRGGGGDSQTVRANREVILSGGAINSPQLLMLSGIGDADQLRNLGIPLVHHLPGVGANLQDHLELYVQQRCTQPITLYSAQWKFPWNMVGIGLRWLTTQTGWGATSHLETGGFIRTEAGVPHPDVQFHFLPSVVTDHGRKSGNCHAFQVHVGPMRPESRGTLRLASADPRQVPLLDPNYMATERDRWEMRQCIRLAREIFAQPAFDQYRGSELQPGSEARTDAQLDAFVRAASDSAYHPSCTCRMGPAADPTSVLDENLRVRGLDGLRVVDASAMPSIVSGNLNGPTIMLAEKAADIIRGRQPLPPATEVPVWQPARPERQRDGE 1137          
BLAST of Choline dehydrogenase vs. TrEMBL
Match: A0A4Z2DY40 (Choline dehydrogenase OS=Schistosoma japonicum OX=6182 GN=EWB00_004675 PE=3 SV=1)

HSP 1 Score: 1031.17 bits (2665), Expect = 0.000e+0
Identity = 526/1161 (45.31%), Postives = 748/1161 (64.43%), Query Frame = 3
Query:  135 KQILSVNKNTDILSEKLFDDRQPKFEAVVFDKDGTLLCFHSMWTTWITNLVKNINQELDKDISSAIYSILGVCSKTYRTSPGLMAEGTKDQIKNALQKVIMAECAISEKKSNEIIEKHFQNNAANENSLKEIHNVRKLFKVIKQHGVKIGICTSDTREGTLAALQSINSLDLVDSICCGDDPNSLPKPDPFFSKTISQDLNVPVSSMAMVGDTRSDMEFGKNSGMSGRIGVLSGIGDSEILQ-------NSGATD---------------IIRSVEDILPLLLPSCPIKL-------SKDTELISSQEWKLIIMDKDGTLTDVYLKYKKWALLLGERLKTSTSSEITELFFKIIGFDQAETFSTGSLLGESAVLQMKDIIKYLLILNGYSSEETDKIVKKVWVDTSVFGDEELPEFKHSLLELKSKGMKLALNSSDSRSSIDNFIKRNNIDDVFDATVSAEDSSPHFKPLPHSILKICNDLQISTKETLLIGDSQTDMLCGRSAKVGASIGVLSGLGKSQNLMGLCQLLIPNINYLPQLLHSRSFHTSCRVHASTCNTNN------------QAVDYIIIGAGSAGCVLANRLSANVNNTVN-----LIEAGPSD---NTWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLK-RNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAF-DEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTK------SND--------------TVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDP-----LPKLENVPIWIPKYPMKQRE 3389
            K+I  +N +T ++S K     +P F++V+FDKDGTL+CF+SMW  W  N+  NI +E+ ++I S I + LG C KT+  +PG++AEGTK+QI   L  ++++   I+   +  I+ +H Q        + ++H+++ +F  +K+H +   +CTSD R+ TL AL+ ++   LVD I CGDDP  LPKP P  +K I + L+V      MVGDT +D+ F +N+ +   +GVLSGIG    L+       ++GA +               I+ SV  I+PL+L    + +       +K  + +++Q++KL+I+DKDG+  +++ ++ KW   +  RL   T+ ++   F  ++G+       +  +L E ++L +++ ++ LLIL GY  + +D+IVK+VW+  S      +P    ++ +L+  G+++A+N+SD+R S D F+   N+      T+S+ED+S H KPLPH++L+I +      +ET+++GD+  D++ G+SAKVG ++G+LSG   + +L     LL+PN++YLP L           ++ ++C+ NN             A +YIIIGAGSAGCVLANRLS     T N     ++EAGP+D   + WTI MPAAL+YNL  DKYNWYY T  Q+++N+R MYWPRGRVLGGSSSLNAMVYIRGH  DYDRWESEGA GWSYA+CLPYF+KAQTHE G N +RG +GPL VSR K N  LH +WI+AG +AGY FT+D+NGY+QEG G FD TI  GER S++ A+L P LK  +NLTV+TN  VT+ILF+  +AVG++   KN  +++     E+ILSGGA+NSP LLMLSG+GD   L+   ID  +H+PGVG+NLQDHLE+YVQ   KKP+TLY A WK+PH ++ IGL+W LF+ G  AT+HL+SGGF+R+   ++HP++QFHFLPST+ DHGR++   HAFQ HVGPMR++S G I + S      P+IDPNY + + D  E R AIRL+REIF+Q A  +++ G+E+ PG D  SD QLDEF R   D+AYHPSCTCRMG         S+D               V    C+V G+DNLR+VDAS+MPSIVSGNLNAP +M+AEK ADMI+ +       LP   N   W PKYP KQR+
Sbjct:   41 KEIGLINSSTYLVSLK-----RPLFKSVIFDKDGTLVCFNSMWMPWARNIANNICREIAQNIESEILTTLGCCPKTHIINPGVLAEGTKEQIIIVLTDLLVSH-GITRSTAQIIVARHVQVPTLVPEQIVQLHDLKSMFTTLKEHSIMTAVCTSDNRKETLHALRVLDISHLVDIIVCGDDPGRLPKPHPDNAKFICKKLHVLPEETVMVGDTSTDVAFARNANLGLCVGVLSGIGQQGDLKATWFSKSDNGANNNLNEVKHSHSKAQLHIVPSVAHIMPLILTDNTLSIKQALLSNNKLYKKLTNQKFKLVIIDKDGSFVNIHPRWAKWCEKICIRLTDETTPDLANTFLNVLGYSSETRKISNGILSEGSMLFVEECLRCLLILKGYGIKGSDQIVKQVWICPSTIPSVIMPNTIETVNKLREIGLEVAINTSDNRYSCDRFLSSVNLHGHIKITMSSEDASRHPKPLPHTVLQIMDKAGCKPEETVVVGDTPADLISGQSAKVGLTVGILSGFSSASDLASYSDLLLPNLSYLPNLF---------TINKTSCDINNIKKPIVKNSDFKNAYEYIIIGAGSAGCVLANRLSLPHPKTKNSSKVLVLEAGPTDVGISRWTIKMPAALMYNLYDDKYNWYYHTVPQRHMNDRAMYWPRGRVLGGSSSLNAMVYIRGHALDYDRWESEGADGWSYANCLPYFRKAQTHELGGNQFRGSDGPLYVSRGKTNHPLHLAWIEAGKQAGYPFTDDVNGYQQEGVGYFDMTIKNGERCSAATAYLHPALKSSSNLTVETNATVTQILFENNRAVGVK-YKKNGQVHEAKAESEVILSGGAINSPHLLMLSGIGDVDYLRSVGIDAWHHLPGVGQNLQDHLEVYVQQACKKPITLYKAQWKYPHMMVGIGLKWILFRQGWAATTHLESGGFVRTSAHISHPNIQFHFLPSTIHDHGRQMGNQHAFQVHVGPMRARSSGQILLSSASSNYAPMIDPNYLACETDRDEMRAAIRLSREIFAQPALANKYAGKELAPGEDKMSDSQLDEFARSFGDSAYHPSCTCRMGKNPEGRKAGSDDKIHSGYLGNGRIEAAVTQSNCKVWGIDNLRIVDASIMPSIVSGNLNAPVIMMAEKAADMIISSRDKISVVLPADLNASYWKPKYPDKQRD 1185          
BLAST of Choline dehydrogenase vs. TrEMBL
Match: G4VTR2 (Putative choline dehydrogenase OS=Schistosoma mansoni OX=6183 GN=Smp_094500 PE=3 SV=1)

HSP 1 Score: 1001.89 bits (2589), Expect = 0.000e+0
Identity = 520/1141 (45.57%), Postives = 728/1141 (63.80%), Query Frame = 3
Query:  174 SEKLFDDRQPKFEAVVFDKDGTLLCFHSMWTTWITNLVKNINQELDKDISSAIYSILGVCSKTYRTSPGLMAEGTKDQIKNALQKVIMAECAISEKKSNEIIEKHFQNNAANENSLKEIHNVRKLFKVIKQHGVKIGICTSDTREGTLAALQSINSLDLVDSICCGDDPNSLPKPDPFFSKTISQDLNVPVSSMAMVGDTRSDMEFGKNSGMSGRIGVLSGIGDSEILQNS--------------GATD--------IIRSVEDILPLLLPSC--PIK---LSKDT--ELISSQEWKLIIMDKDGTLTDVYLKYKKWALLLGERLKTSTSSEITELFFKIIGFDQAETFSTGSLLGESAVLQMKDIIKYLLILNGYSSEETDKIVKKVWVDTSVFGDEELPEFKHSLLELKSKGMKLALNSSDSRSSIDNFIKRNNIDDVFDATVSAEDSSPHFKPLPHSILKICNDLQISTKETLLIGDSQTDMLCGRSAKVGASIGVLSGLGKSQNLMGLCQLLIPNINYLPQLLHSRSFHTSC-----RVHASTCNTNNQAVDYIIIGAGSAGCVLANRLSANVNNTVN-----LIEAGPSD---NTWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLK-RNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAF-DEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTK------SND--------------TVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDP-----LPKLENVPIWIPKYPMKQRE 3389
            SE L   R+P ++AV+FDKDGT++CF+SMW  W   + KNI+ ++ +D++  I + LG C K +  +PG++AEGT++QI  AL  ++++   I++  +   + KH +  + +   +  + +++ +   ++QH +K  ICTSD+R+GT+ AL  ++ L L+D I CGDDP   PKP P  +K I + L+V      MVGDT +D+ F KN+ +   IGVLSGIG    L+ +              GA          I+ SV  ILPL+LP    PI+   LSK+   + +S+Q++KL+I+DKDG+  +V+ ++ +W   +  RL    S ++   F  I+G+       +  +L E +++ +++ +++LLIL GY  +E+D+IV ++W+  S      + +   ++  L+  G+++A+NSSDSR + D+F+    + D  D T+SAED+  H KPLPH++++I +       ET+++GD+  D++ GRSAK                             Y  + +  R F TSC     ++     +    + +YIIIGAGSAGCVLANRLS     T N     ++EAGP+D   + WTI MPAAL+YNL HDKYNWYY T  Q+++N+R MYWPRGRVLGGSSSLNAMVYIRG+P DYDRWESEGA GW+YA+CLPYF+KAQTHE   N YRG NGPL VSR+K N  LH +WI+AG +AGY FT+D+NGY+QEG G FD TI  GER S+S+A+L P +K  +NLTV+TN +VT+ILF+GK+AVG++   KN  ++      E+ILSGGA+NSP LLMLSG+GD   L+   ID  +H+PGVG+NLQDHLELYVQ   KKP+TLY A WK+PH +I IGL+W LF+ G  AT+HL+SGGFIR++  + HP++QFHFLPST+ DHGRK+   HAFQ HVGPMRS+S+G I +        P IDPNY + + D  E R AIRL+REIF+Q A   EF G+E+ PG D  SD QLDEF+R   D+AYHPSCTCRMG         S+D               V    C+V G+DNLR+VDAS+MPSIVSGNLNAP +M+AEK AD+I+ +       LP   N+  W P++P KQR+
Sbjct:   53 SEFLVSARKPLYKAVIFDKDGTIVCFNSMWMPWARTIAKNISSDIAQDMNFEILNTLGCCPKNHIINPGVLAEGTEEQIIIALTNLLVSH-GITKSMAQSTVSKHIKALSLSPEHIVPLADIKSMITTLRQHSIKTAICTSDSRKGTIQALAVLDVLHLLDVIVCGDDPGRPPKPHPDNAKFICEKLHVSPEETVMVGDTSTDIAFAKNANLGLCIGVLSGIGQQSGLEATWHKYSEIEGKNNLNGAKSYNSKSKLHIVPSVGHILPLVLPDLNQPIRHVLLSKNRLYQKLSNQKFKLVIIDKDGSFINVHPRWAEWCEKVCMRLAEKASPDLACTFSNILGYSFETRKISNGILSEGSMVFIEECLRHLLILKGYGVKESDEIVNQIWICPSSIPGITISDTIEAVKTLREIGLRVAINSSDSRKACDDFLLSVKLYDYIDTTMSAEDAGCHPKPLPHTVIQIIDKAGCKPGETVIVGDTPADLISGRSAKH---------------------------QYYHKHITKRLFKTSCSVTNHKIPIVKSDDFRNSYEYIIIGAGSAGCVLANRLSLPHPKTKNSSKVLVLEAGPTDVGISRWTIKMPAALMYNLYHDKYNWYYHTVPQRHMNDRTMYWPRGRVLGGSSSLNAMVYIRGNPLDYDRWESEGADGWNYANCLPYFRKAQTHELNGNQYRGSNGPLYVSRAKTNHPLHSAWIEAGKQAGYPFTDDVNGYQQEGVGYFDMTIKNGERCSASRAYLHPAMKSSSNLTVETNALVTQILFEGKRAVGVK-YSKNSQVHVARAESEVILSGGAINSPHLLMLSGIGDVDYLRSIGIDAWHHLPGVGQNLQDHLELYVQQACKKPITLYKAQWKYPHIMIGIGLKWILFRRGWAATTHLESGGFIRTDASIPHPNIQFHFLPSTIHDHGRKMGDQHAFQVHVGPMRSRSRGQILLSPASLGFAPKIDPNYLACETDRAEMRAAIRLSREIFAQPALAKEFAGKELAPGEDKISDSQLDEFVRSFGDSAYHPSCTCRMGKNPDGRKAGSDDEIHSGYLGNGRIGAAVTQSDCKVWGIDNLRIVDASIMPSIVSGNLNAPVIMMAEKAADIIVSSRDGVSVVLPADLNLSYWKPQHPDKQRD 1164          
BLAST of Choline dehydrogenase vs. TrEMBL
Match: A0A1S3K4T2 (Choline dehydrogenase OS=Lingula unguis OX=7574 GN=LOC106178838 PE=3 SV=1)

HSP 1 Score: 969.148 bits (2504), Expect = 0.000e+0
Identity = 490/1153 (42.50%), Postives = 720/1153 (62.45%), Query Frame = 3
Query:  195 RQPKFEAVVFDKDGTLLCFHSMWTTWITNLVKNINQELDKDISSAIYSILGVCSKTYRTSPGLMAEGTKDQIKNALQKVIMAECAISEKKSNEII-EKHFQNNAANENSLKEIHNVRKLFKVIKQHGVKIGICTSDTREGTLAALQSINSLDLVDSICCGDDPNSLPKPDPFFSKTISQDLNVPVSSMAMVGDTRSDMEFGKNSGMSGRIGVLSGIGDSEILQNSGATDIIRSVEDILPLLLPS---------------C-----------PIKLSKDTELISSQEWKLIIMDKDGTLTDVYLKYKKWALLLGERLKTSTSSEITELFFKIIGF-DQAETFSTGSLLGESAVLQMKDIIKYLLILNGYSSEETDKIVKKVWVDTSVFGDEELPEFKHSLLE----LKSKGMKLALNSSDSRSSIDNFIKRNNIDDVFDATVSAEDSSPHFKPLPHSILKICNDLQISTKETLLIGDSQTDMLCGRSAKVGASIGVLSGLGKSQNLMGLCQLLIPNINYLPQLL------------------------------------------HSRSFHTSC--------RVHASTCNTNNQAVDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN--TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHE-FGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKI-LNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLENVPIWIPKYPMKQRESE 3395
            R+ K   V+FDKDGT++CFH+MW  W   + K I +     I+  +Y + G C++     PG++AEGT   +K  LQ ++++E  I ++++++I+ + + + +  ++ SL+ + ++  LF+V+K+H +KI ICTSD+R GTL +L+S+  L  +D + CGDD +++PKP  + +  I  +LNV  S   MVGD+ +D+  G+ + + G IGV +G+   E L+   A  ++  + DI+PL+LP+               C            +K  +   +   ++  L+I DKDG+L      + +W   L +RL+ ++   + +  + ++GF  ++  F  G L  E+   +M   ++ +L   G       +++++ + + S     E  +   +L+     LK  G+K+A+ +S+ R    N  K   I    D  V  +D    FKP P ++ KIC  L ++  ET ++GD+ +D+  G+ A V  ++GVL+G+  +++L      ++P+I  +  LL                                            R F TS         R ++++ ++     DY+I+GAGSAGCVLANRLS + NN V ++EAGP D    W I+MPAAL+YNLC DKYNWYY T  QK++N+R MYWPRGRV GGSS+LNAMVYIRGH +DYDRWE EGA GWSYA CLPYF+KAQTH+  G + YRGG+GPL+VS  K N  L ++++ A ++AGY +T DMNGY+QEGFG  D TI+ G+RWS+S+ +L+P L R+NLTV++  M  ++LF+G +AVG+E   K    L  +   KE+ILSGGA+NSPQLLM SGVGD  +LK+  + VV H+PGVG+NLQDHLE+Y Q +  +P+TLYSA WKFPHN+IRIGLQWFL + G GA++HL++GGFIR+ PG+ HP++QFHFLPSTV DHGRK+   HAFQ H+G M S S+G + + S +P  HP++DPNY S + D+ +FR A+RLTREIF+Q AFD+FRG E+LPG    +DEQ+D +I+   D+AYHPSCTC+MG+      VV+ + +V G++NLRVVDAS+MPS+VSGNLNAPT+M AEK AD+ILGN PLP+     +W PK    QR +E
Sbjct:   64 RKRKASLVIFDKDGTMICFHAMWGPWARIVAKKIEEGSGLKIADKVYEVFGYCNQKNIVEPGVLAEGTSAMVKQRLQNLLVSE-GIDKERADQIVKDSYVEADHTSKESLRPLDDLHTLFRVLKEHDMKIAICTSDSRYGTLQSLESLGLLSQIDRLVCGDDIDNIPKPAQYNANMICSELNVDPSEAIMVGDSLADVGMGRLANLGGSIGVSTGVTPREELEPH-ADVVVDRLMDIVPLILPAEVHTNYSLVAEDGQVCYPPQTGADQRGVVKPRRSVAIRPGKKASLVIFDKDGSLVYFNSYWPEWIKKLKQRLEVNSGLNLGDKVYSMLGFCTESGKFGPG-LWAEATHSEMCHRLEDILCDQGMYRYRAKQVIEQSYNECSDSSHYESAKPVGNLVAMFKTLKEYGVKIAICTSNPRDVTLNIFKELGIMPYVDTMVCGDDRDGLFKPSPDAVRKICECLDVNPSETFVVGDTMSDIGMGKMANVAKTVGVLTGVSSAEDLESHADHVVPSIREVLGLLLPEDHRQILEQHEAELDQSEVKDSRVNSSAVKGSGKVGITNQQKRGFLTSSGNHVSSSQRQYSTSVSSGADTYDYVIVGAGSAGCVLANRLSVDPNNRVLVLEAGPEDKWWNWKIHMPAALMYNLCDDKYNWYYHTVPQKHMNDRVMYWPRGRVWGGSSALNAMVYIRGHAYDYDRWEKEGAAGWSYADCLPYFRKAQTHDDCGADEYRGGDGPLHVSHGKTNNPLFKAFVDAALQAGYPYTPDMNGYQQEGFGPMDMTIHNGKRWSASQGYLRPALDRSNLTVQSLAMTHRVLFEGNRAVGVEYKQKKGAELKHVRAEKEVILSGGAINSPQLLMFSGVGDADDLKKLDLPVVQHLPGVGQNLQDHLEVYFQQECSQPITLYSAQWKFPHNMIRIGLQWFLTQKGWGASAHLETGGFIRTRPGLEHPNIQFHFLPSTVNDHGRKMGDRHAFQCHMGTMISPSRGYLKLKSANPYDHPILDPNYMSTEEDWVDFRAAVRLTREIFAQKAFDQFRGPELLPGSHVTTDEQIDTYIKNYGDSAYHPSCTCKMGAEDDKMAVVNNKAQVFGIENLRVVDASIMPSVVSGNLNAPTIMTAEKCADIILGNPPLPR-STAKVWRPKSLDTQRTTE 1212          

HSP 2 Score: 98.2117 bits (243), Expect = 7.690e-17
Identity = 63/257 (24.51%), Postives = 122/257 (47.47%), Query Frame = 3
Query:  930 IKLSKDTELISSQEWKLIIMDKDGTLTDVYLKYKKWALLLGERLKTSTSSEITELFFKIIGFDQAETFSTGSLLGESAVLQMKDIIKYLLILNGYSSEETDKIVKKVWVDTSVFGDEELPEFK--HSLLE-LKSKGMKLALNSSDSRSSIDNFIKRNNIDDVFDATVSAEDSSPHFKPLPHSILKICNDLQISTKETLLIGDSQTDMLCGRSAKVGASIGVLSGLGKSQNLMGLCQLLIPNINYLPQLLHSRSFHTS 1691
            ++  K  +    ++  L+I DKDGT+   +  +  WA ++ ++++  +  +I +  +++ G+   +      +L E     +K  ++ LL+  G   E  D+IVK  +V+      E L      H+L   LK   MK+A+ +SDSR      ++   +    D  V  +D     KP  ++   IC++L +   E +++GDS  D+  GR A +G SIGV +G+   + L     +++  +  +  L+     HT+
Sbjct:   54 VQTEKPLKAFRKRKASLVIFDKDGTMICFHAMWGPWARIVAKKIEEGSGLKIADKVYEVFGYCNQKNIVEPGVLAEGTSAMVKQRLQNLLVSEGIDKERADQIVKDSYVEADHTSKESLRPLDDLHTLFRVLKEHDMKIAICTSDSRYGTLQSLESLGLLSQIDRLVCGDDIDNIPKPAQYNANMICSELNVDPSEAIMVGDSLADVGMGRLANLGGSIGVSTGVTPREELEPHADVVVDRLMDIVPLILPAEVHTN 310          
BLAST of Choline dehydrogenase vs. Ensembl Cavefish
Match: chdh (choline dehydrogenase [Source:NCBI gene;Acc:103039657])

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 330/558 (59.14%), Postives = 409/558 (73.30%), Query Frame = 3
Query: 1701 HASTCNTN--NQAVDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-------TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLEN 3347
            H ST + +  N +  Y+I+GAGSAGCVLANRLS N + +V L+EAGP D        +W I+MPAAL YNLC DKYNWYY T  Q  ++ R MYWPRGRV GGSSSLNAMVYIRGH  DY+RW  EGA GW Y  CLPYF+KAQTHE G + YRGG+GPL+VSR K +  LH ++I+A  +AGY FT+DMNGY+QEG G  D TIYKG+RWS++ A+L+P L R NL  +   + T +LFDG +AVG+E   +N    K++ +KE+ILSGGA+NSPQLLMLSGVG+   L++  I VV H+PGVG NLQDHLELYVQ +  +P+TLY A  + P ++I+IGL+W L  +G GAT+HL+SGGFIR  P V HPD+QFHFLPS V DHGR  +   A+Q HVGP+RS S G + + S +P  HPL+ PNY S   D WEFR+ ++L+REIF+Q AFD FRG E  PGP  QSD ++D F+RQK D+AYHPSCTC+MG +     VVDPQ RV GL+ LRVVDAS+MPS+VSGNLNAPT+MIAEK AD I G   LP L +
Sbjct:   37 HYSTVSASPKNPSFSYVIVGAGSAGCVLANRLSENSSESVLLLEAGPKDMVLGSRRLSWKIHMPAALTYNLCDDKYNWYYNTLPQDGMDGRVMYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHREGAEGWDYDHCLPYFRKAQTHELGADRYRGGSGPLHVSRGKTDHPLHHAFIEASQQAGYPFTDDMNGYQQEGVGWMDMTIYKGKRWSTASAYLRPALSRPNLKAEVGCLTTHVLFDGTRAVGVE-YQQNGQTKKVLADKEVILSGGAINSPQLLMLSGVGNADYLQKLDIPVVQHLPGVGSNLQDHLELYVQQQCTQPITLYKA--QKPFHMIKIGLEWMLKFTGYGATAHLESGGFIRGRPHVTHPDIQFHFLPSQVIDHGRVNSKIEAYQVHVGPIRSTSVGWLKLKSKNPHDHPLLQPNYLSTDIDVWEFRQCVKLSREIFAQKAFDPFRGPEAQPGPAVQSDAEIDAFVRQKADSAYHPSCTCKMGRSSDPMAVVDPQTRVYGLEGLRVVDASIMPSVVSGNLNAPTIMIAEKAADAIKG---LPSLHD 588          
BLAST of Choline dehydrogenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002402.1 (pep scaffold:Pmarinus_7.0:GL482915:11564:16540:1 gene:ENSPMAG00000002188.1 transcript:ENSPMAT00000002402.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 358.221 bits (918), Expect = 1.814e-114
Identity = 168/337 (49.85%), Postives = 235/337 (69.73%), Query Frame = 3
Query: 1737 DYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-------TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESE-GAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSG 2723
             ++++GAGSAGCV+A RLS +  + V L+EAGP D         W I+MPA L   L + KY  +Y T+ Q++L  R + WPRGRV GG+SS+N M+YIRGH  DYD WE E GA GWSYA+CLPYF++AQ+H  G + YRGG+GPL VSR      LH ++++A  +AG+   EDMNG++QEGFG +D TI++G+RWSS+ A+L P L R NL V+   + T++LF G++AVG+E+L +  +  ++   +E+IL GGA+NSPQLL+LSG+G    LKQ  I V+ + PGVG+NLQDHL + V+ +  +P+T Y+A  + PHN+IR GL W L  +G
Sbjct:    9 SHVVVGAGSAGCVMAGRLSEDAASRVLLLEAGPRDTVLGSKRLAWHIHMPAGLSKVLHNSKYAVHYYTEPQEHLGGRSLLWPRGRVWGGTSSMNGMIYIRGHALDYDGWEQEHGASGWSYANCLPYFRRAQSHALGPDEYRGGDGPLRVSRVPTQSPLHVAFLEAASQAGHALNEDMNGFRQEGFGWYDLTIHQGKRWSSACAYLHPALSRPNLEVRDGAVATRVLFRGERAVGVEVL-RGGVKEQVFAEREVILCGGAINSPQLLLLSGIGPEKHLKQVGIPVLVNSPGVGRNLQDHLNVSVKQRCAQPLTAYTA--QKPHNMIRTGLAWMLTSTG 342          
BLAST of Choline dehydrogenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007537.1 (pep scaffold:Pmarinus_7.0:GL493288:965:4963:-1 gene:ENSPMAG00000006807.1 transcript:ENSPMAT00000007537.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.206 bits (365), Expect = 8.916e-41
Identity = 71/128 (55.47%), Postives = 86/128 (67.19%), Query Frame = 3
Query: 2580 GVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNS 2963
            GVG NLQDHLE+YVQ +  +PVTLY      P   +  GLQW L  +G  AT+H+D+GGF RSEP VAHPD+QFHFLP+ V DHGR   T  AFQAHVG +R  S G + + S +P   P+I PNY S
Sbjct:    1 GVGMNLQDHLEVYVQQRCLQPVTLYGLLR--PDRTLSAGLQWLLRFTGPCATAHMDTGGFARSEPSVAHPDVQFHFLPAQVIDHGRVDPTMEAFQAHVGSLRPTSVGWLKLRSANPTDPPVIQPNYLS 126          
BLAST of Choline dehydrogenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008855.1 (pep scaffold:Pmarinus_7.0:GL477199:71485:75871:1 gene:ENSPMAG00000008015.1 transcript:ENSPMAT00000008855.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.642 bits (322), Expect = 1.601e-33
Identity = 70/225 (31.11%), Postives = 127/225 (56.44%), Query Frame = 3
Query:  216 VVFDKDGTLLCFHSMWTTWITNLVKNINQELDK-DISSAIYSILGVCSKTYRTSPGLMAEGTKDQIKNALQKVIMAECAISEKKSNEIIEKHFQNNAANENSLKEIHNVRKLFKVIKQHGVKIGICTSDTREGTLAALQSINSLDLVDSICCGDDPNSLPKPDPFFSKTISQDLNVPVSSMAMVGDTRSDMEFGKNSGMSGRIGVLSGIG-DSEILQNSGATDII 884
            V+FDKDGTL+CFHSMW  W   + + +     + ++   +Y  LG   +      G +AE T +Q++  L++ +  E  + + +   ++   ++++ +   S++ + ++  +F+ +K+ G KI ICTSD+R GT   + +     L+DS+ CGDD   +PKP P  +  + + L V  S  A+VGDT +D+  G+ + +   +GVL G+G +S++L    A D+I
Sbjct:   11 VIFDKDGTLMCFHSMWGPWCEEIGQRVVAVTGRPELLGCVYRALGYDGERRLVQLGSIAEKTMEQVQLMLREALQREHGLEDAEVERVVRVAWRDDCSG-GSMRPLGDLVAIFRRLKERGFKIAICTSDSRAGTEEFIDAQGLAPLLDSVVCGDDAGIVPKPSPSLALDMCRRLGVDPSRAAIVGDTPTDVGMGRAARLGLTLGVLCGVGVESDLL----AADVI 230          

HSP 2 Score: 102.064 bits (253), Expect = 2.377e-24
Identity = 62/232 (26.72%), Postives = 116/232 (50.00%), Query Frame = 3
Query:  960 SSQEWKLIIMDKDGTLTDVYLKYKKWALLLGERLKTSTSS-EITELFFKIIGFDQAETFSTGSLLGESAVLQMKDIIKYLLIL-NGYSSEETDKIVKKVWVDTSVFGD-EELPEFKHSLLELKSKGMKLALNSSDSRSSIDNFIKRNNIDDVFDATVSAEDSSPHFKPLPHSILKICNDLQISTKETLLIGDSQTDMLCGRSAKVGASIGVLSGLGKSQNLMGLCQLLIPNI 1646
            S  E  L+I DKDGTL   +  +  W   +G+R+   T   E+    ++ +G+D          + E  + Q++ +++  L   +G    E +++V+  W D    G    L +       LK +G K+A+ +SDSR+  + FI    +  + D+ V  +D+    KP P   L +C  L +      ++GD+ TD+  GR+A++G ++GVL G+G   +L+    +++P++
Sbjct:    4 SEHEPALVIFDKDGTLMCFHSMWGPWCEEIGQRVVAVTGRPELLGCVYRALGYDGERRLVQLGSIAEKTMEQVQLMLREALQREHGLEDAEVERVVRVAWRDDCSGGSMRPLGDLVAIFRRLKERGFKIAICTSDSRAGTEEFIDAQGLAPLLDSVVCGDDAGIVPKPSPSLALDMCRRLGVDPSRAAIVGDTPTDVGMGRAARLGLTLGVLCGVGVESDLLA-ADVIVPDV 234          
BLAST of Choline dehydrogenase vs. Ensembl Nematostella
Match: EDO38956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBJ6])

HSP 1 Score: 420.624 bits (1080), Expect = 1.138e-137
Identity = 196/346 (56.65%), Postives = 263/346 (76.01%), Query Frame = 3
Query: 2301 RWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPK 3338
            RW+++ A+L+P ++R NL   T  ++T++LF+G KAVG+E    N+I  ++   KE+I+SGGA+NSPQLLMLSGVG+  EL +  I VV ++PGVG+NLQDHLE+Y+Q + KKP+TLYSA      N+I IG++WFLF++G+GA++HL++GGFIRS  GV HPD+QFHFLPS V DHGR     HA+Q HVG MRSQSKG + + S +   HP+ID NY S + D+ E R  +RL+REIF+Q AF+ FRG+E+ PG   ++D+++D F+R+  D+AYHPSCTC+MGS      VVD   RV  +DNLRVVDAS+MPS+VSGNLNAPT+MIAEK+AD ILG DPLP+
Sbjct:    3 RWNTANAYLRPAIQRTNLQADTRALITRVLFEGNKAVGVEYHADNQI-RRVRAKKEVIISGGAINSPQLLMLSGVGNAEELTRLGIPVVVNLPGVGENLQDHLEMYIQQECKKPLTLYSAQKLM--NMIPIGIRWFLFQTGLGASAHLEAGGFIRSREGVPHPDIQFHFLPSGVIDHGRTPIDRHAYQLHVGSMRSQSKGYVKLKSPNAYDHPIIDFNYMSTEDDWQEMRACVRLSREIFAQKAFEPFRGDEMRPGSHIRTDDEIDAFVREFADSAYHPSCTCKMGSASDPLAVVDNAARVFHVDNLRVVDASIMPSVVSGNLNAPTVMIAEKIADAILGKDPLPR 345          
BLAST of Choline dehydrogenase vs. Ensembl Nematostella
Match: EDO38958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK1])

HSP 1 Score: 337.421 bits (864), Expect = 8.626e-104
Identity = 149/235 (63.40%), Postives = 185/235 (78.72%), Query Frame = 3
Query: 1737 DYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDNTWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKI 2441
            DY+I GAGSAGCVLANRLSA+ ++ V L+EAGP D TW I+MPAALIYNLC DKYNWYY T  QK++NNR MY PRGRV GGSSSLNAMVYIRGH +DYDRWE EGA GWSYA CLPYF+K+QTHE G + YRGG+GPL+VSR K N  L  ++++   +AGY FTEDMNGY+QEG G    TI+KG RW+++ A+L+P ++R NL   T  ++T++LF+G KAVG+E    N++
Sbjct:   14 DYVICGAGSAGCVLANRLSADPDSKVLLLEAGPKDRTWKIHMPAALIYNLCDDKYNWYYHTAPQKHMNNRVMYCPRGRVWGGSSSLNAMVYIRGHAYDYDRWEREGAQGWSYADCLPYFRKSQTHELGADDYRGGDGPLHVSRGKTNNPLFHAFLEGAQQAGYPFTEDMNGYQQEGVGWMAMTIHKGIRWNTANAYLRPAIQRTNLHADTRALITRVLFEGNKAVGVEYHADNQV 248          

HSP 2 Score: 105.145 bits (261), Expect = 2.697e-23
Identity = 48/69 (69.57%), Postives = 56/69 (81.16%), Query Frame = 3
Query: 3132 HPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPK 3338
            +PSCTC+MGS      VVD   RV  +DNLRVVDAS+MPS+VSGNLNAPT+MIAEK+AD ILG DPLP+
Sbjct:  455 YPSCTCKMGSASDPLAVVDNAARVFHVDNLRVVDASIMPSVVSGNLNAPTVMIAEKIADAILGKDPLPR 523          
BLAST of Choline dehydrogenase vs. Ensembl Nematostella
Match: EDO47734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLQ6])

HSP 1 Score: 120.939 bits (302), Expect = 6.286e-31
Identity = 65/235 (27.66%), Postives = 121/235 (51.49%), Query Frame = 3
Query:  216 VVFDKDGTLLCFHSMWTTWITNLVKNINQELDKDISSAIYSILGVCSKTYRTSPGLMAEGTKDQIKNALQKVIMAECAISEKKSNEIIEKHFQN-NAANENSLKEIHNVRKLFKVIKQHGVKIGICTSDTREGTLAALQSINSLDLVDSICCGDDPNSLPKPDPFFSKTISQDLNVPVSSMAMVGDTRSDMEFGKNSGMSGRIGVLSGIGDSEILQNSGATDIIRSVEDILPLLL 917
            V+FDKDGTL+  +S+W  W    V  I +    D++  +Y  +G C                          ++ +C +   +++ ++E    + +  NE  L+ + ++  +F  +K + VKI +CT+D+R GT++AL  +    ++D + CGDD  S PKP P  +  I ++LNV  +   ++GDT +D   G+++G+   +GVLSG G  + L+      ++ SV ++L ++ 
Sbjct:    2 VIFDKDGTLINCNSVWIPWFKAHVDEIERSTGMDLADKLYEAVGYCP-------------------------VLVKCGLDSMEAHVLVENCCNDFDTGNEEMLEPLGDLNNIFSTLKSNNVKIAVCTADSRSGTMSALDRLGLTSMIDMVVCGDDEISKPKPAPDNALNICRNLNVCPTKTVVIGDTTADTGMGRSAGLGLTVGVLSGAGSRKSLEKDSDV-VVDSVNELLGIIF 210          

HSP 2 Score: 81.6481 bits (200), Expect = 2.120e-17
Identity = 60/230 (26.09%), Postives = 108/230 (46.96%), Query Frame = 3
Query:  978 LIIMDKDGTLTDVYLKYKKWALLLGERLKTSTSSEITELFFKIIGFDQAETFSTGSLLGESAVLQMKDIIKYLLILNGYSSEETDKIVKKVWVDTSVFGDEELPE----FKHSLLELKSKGMKLALNSSDSRSSIDNFIKRNNIDDVFDATVSAEDSSPHFKPLPHSILKICNDLQISTKETLLIGDSQTDMLCGRSAKVGASIGVLSGLGKSQNLMGLCQLLIPNINYL 1655
            ++I DKDGTL +    +  W     + ++ ST  ++ +  ++ +G+                          +L+  G  S E   +V+    D    G+EE+ E      +    LKS  +K+A+ ++DSRS   + + R  +  + D  V  +D     KP P + L IC +L +   +T++IGD+  D   GRSA +G ++GVLSG G  ++L     +++ ++N L
Sbjct:    1 MVIFDKDGTLINCNSVWIPWFKAHVDEIERSTGMDLADKLYEAVGYCP------------------------VLVKCGLDSMEAHVLVENCCNDFDT-GNEEMLEPLGDLNNIFSTLKSNNVKIAVCTADSRSGTMSALDRLGLTSMIDMVVCGDDEISKPKPAPDNALNICRNLNVCPTKTVVIGDTTADTGMGRSAGLGLTVGVLSGAGSRKSLEKDSDVVVDSVNEL 205          
BLAST of Choline dehydrogenase vs. Ensembl Medaka
Match: chdh (choline dehydrogenase [Source:NCBI gene;Acc:101161152])

HSP 1 Score: 707.597 bits (1825), Expect = 0.000e+0
Identity = 339/580 (58.45%), Postives = 418/580 (72.07%), Query Frame = 3
Query: 1668 HSRSFHTSCRVHASTCNTNNQAVDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDN-------TWTINMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLENVPIWIPKYPMKQR 3386
            H R F  S    A   N    +  Y+++GAGSAGCVLANRL+ + + +V L+EAGP D        +W I+MPAAL YNLC DKYNWYY T  Q ++NNR +YWPRGRV GGSSSLNAMVYIRGH  DY+RW  EGA GW Y  CLPYF+KAQ HE G+N YRGG GPL+VSR K N  LH+++I+AG +AGY FT+DMNGY+QEG G  D TIYKG+RWS++ A+L+PVL R NL  +   + T+ILFDG +AVG+E   +N    K+   KE+ILSGGA+NSPQLLMLSGVG+  +LK+  I VV H+PGVG NLQDHLELYVQ +  +P+TLY A  + P ++++IGL+W    +G GAT+HL+SGGFIRS P V HPD+QFHFLPS V DHGR  +   A+Q HVGPMRS S G I + S +P  HP++ PNY S   D WEFR+ ++L+REIF+Q AFD FRG E+ PGP  QSD ++D F+RQK D+AYHPSCTC+MGS      VV    RV+GLD LRVVDAS+MPSIVSGNLNAPT+MIAEK AD+I G  PL     VP++ P     QR
Sbjct:   56 HYRCFSAS----APDRNQRTPSFSYVVVGAGSAGCVLANRLTEDAHESVLLLEAGPKDLWLGSLRLSWKIHMPAALTYNLCDDKYNWYYHTLPQAHMNNRALYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHREGAAGWDYQHCLPYFRKAQCHELGENRYRGGRGPLHVSRGKTNHPLHKAFIEAGRQAGYPFTDDMNGYQQEGLGWMDMTIYKGKRWSTASAYLRPVLSRPNLKTEVRCVATRILFDGGRAVGVE-YTQNGQKKKVFAEKEVILSGGAINSPQLLMLSGVGNADDLKELGIPVVQHLPGVGSNLQDHLELYVQQQCTQPITLYKA--QKPFHMVKIGLEWLSVFTGYGATAHLESGGFIRSRPNVTHPDIQFHFLPSQVIDHGRIASKIEAYQVHVGPMRSTSIGWIKLKSPNPLDHPVLQPNYLSTDIDVWEFRQCVKLSREIFAQKAFDPFRGPEVQPGPQVQSDAEIDAFVRQKADSAYHPSCTCKMGSPSDPMAVVGADTRVLGLDRLRVVDASIMPSIVSGNLNAPTIMIAEKAADIIRGRPPLVD-PGVPVYQPPTLETQR 627          
BLAST of Choline dehydrogenase vs. Planmine SMEST
Match: SMESG000055659.1 (SMESG000055659.1)

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 339/341 (99.41%), Postives = 339/341 (99.41%), Query Frame = 3
Query: 2373 MVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLENVPIWIPKYPMKQRESE 3395
            MVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTV DHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPG DAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLENVPIWIPKYPMKQRESE
Sbjct:    1 MVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVIDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGSDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLENVPIWIPKYPMKQRESE 341          
BLAST of Choline dehydrogenase vs. Planmine SMEST
Match: SMESG000055689.1 (SMESG000055689.1)

HSP 1 Score: 498.434 bits (1282), Expect = 9.252e-167
Identity = 222/370 (60.00%), Postives = 295/370 (79.73%), Query Frame = 3
Query: 2001 MVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIR 3110
            M+Y+RGHP+DYDRWE +GA GWSY+SCLPYFKKA+ HE G+N Y GGNGPL+V+RSK+N +LH +W+KAG +AGYG  ED NG++QEGFG FD TI+KGERWSS+KA+L+PV+K  +LTV T+++VTK++F+GK+A+G+++L+K   L  +  NKE+IL GGA+NSP LL+LSGVGDG ELK+HS+++V H+PGVGKN QDH  +YV+++ KKPVTL+S   + P    ++   W   K+G GAT HL SGGFIRSE  V HPD+QFHF P  + DHGR+  T H+FQ  V P+RS+SKGSI++ S DP++HP IDPNY S +RD  EF+ AI+LTREI +QSAFDE+R EE+ PGP  Q+D+Q++EFI+
Sbjct:    1 MIYMRGHPYDYDRWEKQGASGWSYSSCLPYFKKAEKHEAGENLYHGGNGPLHVTRSKINQVLHETWVKAGTQAGYGHAEDFNGFRQEGFGHFDMTIHKGERWSSAKAYLEPVMKNKHLTVTTDSLVTKVIFEGKRAIGVKVLNKEGKLENVFANKEVILCGGAINSPHLLLLSGVGDGNELKKHSVNIVEHIPGVGKNFQDHPTIYVRYQCKKPVTLFSL--QSPEFKKKVDQDWDEHKTGYGATVHLTSGGFIRSEANVTHPDIQFHFFPGLLLDHGRQTMTSHSFQMFVSPLRSESKGSISLHSIDPKEHPSIDPNYCSSERDICEFKSAIKLTREIIAQSAFDEYRSEEMSPGPLVQTDKQMEEFIK 368          
BLAST of Choline dehydrogenase vs. Planmine SMEST
Match: SMESG000055689.1 (SMESG000055689.1)

HSP 1 Score: 499.59 bits (1285), Expect = 1.279e-166
Identity = 224/383 (58.49%), Postives = 297/383 (77.55%), Query Frame = 3
Query: 2001 MVYIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTC 3149
            M+Y+RGHP+DYDRWE +GA GWSY+SCLPYFKKA+ HE G+N Y GGNGPL+V+RSK+N +LH +W+KAG +AGYG  ED NG++QEGFG FD TI+KGERWSS+KA+L+PV+K  +LTV T+++VTK++F+GK+A+G+++L+K   L  +  NKE+IL GGA+NSP LL+LSGVGDG ELK+HS+++V H+PGVGKN QDH  +YV+++ KKPVTL+S   + P    ++   W   K+G GAT HL SGGFIRSE  V HPD+QFHF P  + DHGR+  T H+FQ  V P+RS+SKGSI++ S DP++HP IDPNY S +RD  EF+ AI+LTREI +QSAFDE+R EE+ PGP  Q+D+Q++EFI+        P  T 
Sbjct:    1 MIYMRGHPYDYDRWEKQGASGWSYSSCLPYFKKAEKHEAGENLYHGGNGPLHVTRSKINQVLHETWVKAGTQAGYGHAEDFNGFRQEGFGHFDMTIHKGERWSSAKAYLEPVMKNKHLTVTTDSLVTKVIFEGKRAIGVKVLNKEGKLENVFANKEVILCGGAINSPHLLLLSGVGDGNELKKHSVNIVEHIPGVGKNFQDHPTIYVRYQCKKPVTLFSL--QSPEFKKKVDQDWDEHKTGYGATVHLTSGGFIRSEANVTHPDIQFHFFPGLLLDHGRQTMTSHSFQMFVSPLRSESKGSISLHSIDPKEHPSIDPNYCSSERDICEFKSAIKLTREIIAQSAFDEYRSEEMSPGPLVQTDKQMEEFIKNYKTRKLMPDQTV 381          
BLAST of Choline dehydrogenase vs. Planmine SMEST
Match: SMESG000055689.1 (SMESG000055689.1)

HSP 1 Score: 492.271 bits (1266), Expect = 1.911e-164
Identity = 220/367 (59.95%), Postives = 292/367 (79.56%), Query Frame = 3
Query: 2010 IRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIR 3110
            +RGHP+DYDRWE +GA GWSY+SCLPYFKKA+ HE G+N Y GGNGPL+V+RSK+N +LH +W+KAG +AGYG  ED NG++QEGFG FD TI+KGERWSS+KA+L+PV+K  +LTV T+++VTK++F+GK+A+G+++L+K   L  +  NKE+IL GGA+NSP LL+LSGVGDG ELK+HS+++V H+PGVGKN QDH  +YV+++ KKPVTL+S   + P    ++   W   K+G GAT HL SGGFIRSE  V HPD+QFHF P  + DHGR+  T H+FQ  V P+RS+SKGSI++ S DP++HP IDPNY S +RD  EF+ AI+LTREI +QSAFDE+R EE+ PGP  Q+D+Q++EFI+
Sbjct:    1 MRGHPYDYDRWEKQGASGWSYSSCLPYFKKAEKHEAGENLYHGGNGPLHVTRSKINQVLHETWVKAGTQAGYGHAEDFNGFRQEGFGHFDMTIHKGERWSSAKAYLEPVMKNKHLTVTTDSLVTKVIFEGKRAIGVKVLNKEGKLENVFANKEVILCGGAINSPHLLLLSGVGDGNELKKHSVNIVEHIPGVGKNFQDHPTIYVRYQCKKPVTLFSL--QSPEFKKKVDQDWDEHKTGYGATVHLTSGGFIRSEANVTHPDIQFHFFPGLLLDHGRQTMTSHSFQMFVSPLRSESKGSISLHSIDPKEHPSIDPNYCSSERDICEFKSAIKLTREIIAQSAFDEYRSEEMSPGPLVQTDKQMEEFIK 365          
BLAST of Choline dehydrogenase vs. Planmine SMEST
Match: SMESG000055689.1 (SMESG000055689.1)

HSP 1 Score: 493.426 bits (1269), Expect = 3.267e-164
Identity = 222/380 (58.42%), Postives = 294/380 (77.37%), Query Frame = 3
Query: 2010 IRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLNVSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERWSSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIMVNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGGFIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSITILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEEILPGPDAQSDEQLDEFIRQKTDTAYHPSCTC 3149
            +RGHP+DYDRWE +GA GWSY+SCLPYFKKA+ HE G+N Y GGNGPL+V+RSK+N +LH +W+KAG +AGYG  ED NG++QEGFG FD TI+KGERWSS+KA+L+PV+K  +LTV T+++VTK++F+GK+A+G+++L+K   L  +  NKE+IL GGA+NSP LL+LSGVGDG ELK+HS+++V H+PGVGKN QDH  +YV+++ KKPVTL+S   + P    ++   W   K+G GAT HL SGGFIRSE  V HPD+QFHF P  + DHGR+  T H+FQ  V P+RS+SKGSI++ S DP++HP IDPNY S +RD  EF+ AI+LTREI +QSAFDE+R EE+ PGP  Q+D+Q++EFI+        P  T 
Sbjct:    1 MRGHPYDYDRWEKQGASGWSYSSCLPYFKKAEKHEAGENLYHGGNGPLHVTRSKINQVLHETWVKAGTQAGYGHAEDFNGFRQEGFGHFDMTIHKGERWSSAKAYLEPVMKNKHLTVTTDSLVTKVIFEGKRAIGVKVLNKEGKLENVFANKEVILCGGAINSPHLLLLSGVGDGNELKKHSVNIVEHIPGVGKNFQDHPTIYVRYQCKKPVTLFSL--QSPEFKKKVDQDWDEHKTGYGATVHLTSGGFIRSEANVTHPDIQFHFFPGLLLDHGRQTMTSHSFQMFVSPLRSESKGSISLHSIDPKEHPSIDPNYCSSERDICEFKSAIKLTREIIAQSAFDEYRSEEMSPGPLVQTDKQMEEFIKNYKTRKLMPDQTV 378          
The following BLAST results are available for this feature:
BLAST of Choline dehydrogenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CHDH0.000e+054.64choline dehydrogenase [Source:HGNC Symbol;Acc:HGNC... [more]
CHDH5.640e-4253.91choline dehydrogenase [Source:HGNC Symbol;Acc:HGNC... [more]
CHDH1.110e-2548.48choline dehydrogenase [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Choline dehydrogenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C34C6.40.000e+055.83pep chromosome:WBcel235:II:8696591:8698928:-1 gene... [more]
F45E1.43.553e-4641.51pep chromosome:WBcel235:X:7985979:7988981:1 gene:W... [more]
F09C3.21.673e-3130.37pep chromosome:WBcel235:I:14271893:14274213:-1 gen... [more]
back to top
BLAST of Choline dehydrogenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG450654.086e-9735.61gene:FBgn0266435 transcript:FBtr0344424[more]
CG95186.644e-9335.87gene:FBgn0030590 transcript:FBtr0073983[more]
CG95186.644e-9335.87gene:FBgn0030590 transcript:FBtr0343598[more]
CG95186.644e-9335.87gene:FBgn0030590 transcript:FBtr0344175[more]
CG95034.325e-9237.81gene:FBgn0030598 transcript:FBtr0073974[more]
back to top
BLAST of Choline dehydrogenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
chdh0.000e+058.48choline dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-12... [more]
chdh0.000e+058.54choline dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-12... [more]
back to top
BLAST of Choline dehydrogenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Choline dehydrogenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Chdh0.000e+056.99choline dehydrogenase [Source:MGI Symbol;Acc:MGI:1... [more]
Chdh0.000e+056.99choline dehydrogenase [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Choline dehydrogenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6UPE0|CHDH_RAT0.000e+056.89Choline dehydrogenase, mitochondrial OS=Rattus nor... [more]
sp|Q8BJ64|CHDH_MOUSE0.000e+056.99Choline dehydrogenase, mitochondrial OS=Mus muscul... [more]
sp|Q8NE62|CHDH_HUMAN0.000e+054.64Choline dehydrogenase, mitochondrial OS=Homo sapie... [more]
sp|Q8G1Z8|BETA_BRUSU0.000e+047.64Oxygen-dependent choline dehydrogenase OS=Brucella... [more]
sp|B0CKN4|BETA_BRUSI0.000e+047.46Oxygen-dependent choline dehydrogenase OS=Brucella... [more]
back to top
BLAST of Choline dehydrogenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H5C70.000e+047.36Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FYP10.000e+047.28Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A4Z2DY400.000e+045.31Choline dehydrogenase OS=Schistosoma japonicum OX=... [more]
G4VTR20.000e+045.57Putative choline dehydrogenase OS=Schistosoma mans... [more]
A0A1S3K4T27.690e-1742.50Choline dehydrogenase OS=Lingula unguis OX=7574 GN... [more]
back to top
BLAST of Choline dehydrogenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
chdh0.000e+059.14choline dehydrogenase [Source:NCBI gene;Acc:103039... [more]
back to top
BLAST of Choline dehydrogenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002402.11.814e-11449.85pep scaffold:Pmarinus_7.0:GL482915:11564:16540:1 g... [more]
ENSPMAT00000007537.18.916e-4155.47pep scaffold:Pmarinus_7.0:GL493288:965:4963:-1 gen... [more]
ENSPMAT00000008855.11.601e-3331.11pep scaffold:Pmarinus_7.0:GL477199:71485:75871:1 g... [more]
back to top
BLAST of Choline dehydrogenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Choline dehydrogenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO389561.138e-13756.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389588.626e-10463.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477346.286e-3127.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Choline dehydrogenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
chdh0.000e+058.45choline dehydrogenase [Source:NCBI gene;Acc:101161... [more]
back to top
BLAST of Choline dehydrogenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055659.10.000e+099.41SMESG000055659.1[more]
SMESG000055689.19.252e-16760.00SMESG000055689.1[more]
SMESG000055689.11.279e-16658.49SMESG000055689.1[more]
SMESG000055689.11.911e-16459.95SMESG000055689.1[more]
SMESG000055689.13.267e-16458.42SMESG000055689.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030666 ID=SMED30030666|Name=Choline dehydrogenase|organism=Schmidtea mediterranea sexual|type=transcript|length=3461bp
TATCAATACAGTATATTATTTAAAATCAGTTTCAAGTAATTGTTCATTTA
TTTGAAATGATAATCAAACCAATTTTGCGAAGGAAGATACAACAAATACT
ATATCACAGACGTTATAGTATTGACTTAGTTCAAAAGCAAATTCTTTCAG
TTAATAAAAATACAGATATATTATCCGAAAAATTATTTGATGATAGACAA
CCAAAATTCGAAGCGGTTGTTTTTGACAAAGATGGAACATTGCTTTGCTT
TCATTCTATGTGGACTACATGGATAACTAATTTGGTAAAAAATATAAATC
AAGAATTGGATAAAGATATTAGTTCTGCAATATATAGCATTTTAGGAGTT
TGTTCTAAAACTTACAGAACTTCTCCAGGATTAATGGCAGAGGGTACAAA
AGACCAAATTAAAAACGCTCTTCAAAAAGTGATAATGGCCGAATGCGCAA
TTTCAGAAAAGAAATCTAATGAAATTATAGAAAAACATTTTCAAAACAAC
GCAGCCAATGAGAACTCACTGAAAGAAATTCATAATGTACGAAAATTATT
TAAAGTTATTAAACAACACGGAGTAAAAATTGGAATTTGTACATCTGACA
CTCGAGAAGGCACATTAGCAGCTTTACAATCAATAAATTCTCTGGATTTA
GTTGATTCCATTTGTTGTGGAGATGATCCCAACAGCTTGCCAAAACCAGA
CCCATTTTTTTCAAAAACTATTTCCCAAGATCTCAATGTTCCTGTTTCAT
CAATGGCAATGGTTGGCGATACGAGAAGTGACATGGAATTTGGCAAGAAT
TCTGGAATGAGTGGAAGAATAGGAGTATTAAGTGGAATAGGTGATAGCGA
AATCCTTCAGAATTCCGGCGCCACAGACATTATTCGATCAGTAGAGGATA
TATTGCCTCTTTTATTGCCTAGTTGTCCAATAAAATTATCAAAAGACACT
GAATTAATAAGTTCTCAAGAATGGAAATTGATAATAATGGATAAGGACGG
CACTTTAACAGATGTTTACTTAAAATATAAGAAATGGGCTTTGCTTCTTG
GAGAAAGACTAAAAACTTCAACATCCAGTGAAATTACTGAATTGTTTTTT
AAAATAATTGGATTTGATCAAGCTGAAACATTTTCTACTGGATCTTTGCT
AGGCGAATCTGCAGTTTTACAAATGAAAGATATCATCAAATATCTTTTGA
TTTTAAATGGATATAGTTCAGAGGAAACTGATAAAATAGTTAAAAAGGTA
TGGGTGGATACTTCTGTATTTGGAGATGAAGAACTCCCAGAATTTAAACA
CTCACTTTTAGAACTAAAATCAAAAGGCATGAAGCTGGCATTAAATAGCA
GTGATTCTAGAAGTAGCATCGACAACTTTATTAAACGAAACAACATTGAT
GACGTATTTGATGCGACTGTTTCTGCCGAAGATTCAAGTCCTCACTTCAA
ACCATTACCTCACTCAATCCTTAAAATTTGCAATGACTTACAGATTTCCA
CGAAAGAAACTTTGCTAATAGGAGATAGCCAAACTGACATGCTTTGCGGG
AGGTCAGCCAAAGTAGGGGCCTCAATCGGTGTCTTATCCGGTCTCGGTAA
ATCCCAAAACTTAATGGGATTATGTCAATTGCTAATTCCAAATATAAATT
ATTTACCACAATTACTTCATTCCCGCAGTTTCCACACTTCCTGCAGAGTC
CACGCCTCAACATGTAATACAAATAATCAAGCAGTTGATTATATTATAAT
CGGAGCAGGCTCAGCTGGCTGTGTTCTAGCAAATCGTTTGTCAGCGAATG
TTAACAATACAGTCAATTTAATAGAAGCTGGCCCAAGTGATAATACATGG
ACCATAAATATGCCGGCAGCGTTAATATATAATTTATGTCATGACAAATA
TAATTGGTATTACACAACGAAAGCTCAAAAGTACTTGAATAATCGTGAAA
TGTACTGGCCAAGAGGTAGAGTCCTTGGGGGTAGTTCTTCATTGAATGCT
ATGGTGTACATCAGAGGGCATCCATTTGATTATGATAGGTGGGAATCAGA
GGGAGCACATGGATGGTCATATGCCTCTTGCTTGCCCTATTTCAAAAAGG
CTCAAACACATGAATTTGGAGATAATACTTATCGTGGAGGAAACGGACCT
CTTAATGTTAGTCGAAGTAAAGTGAATGGTATTCTTCATCGCTCTTGGAT
AAAAGCAGGAATGGAGGCTGGATACGGTTTTACAGAGGATATGAATGGTT
ATAAACAGGAAGGGTTTGGTGAATTTGATCAGACCATTTACAAAGGAGAG
AGATGGTCATCATCAAAAGCATTTTTGAAGCCAGTATTGAAAAGAAATAA
TTTAACTGTAAAAACAAATACTATGGTCACAAAAATACTGTTTGATGGTA
AAAAAGCAGTTGGAATTGAAATATTGGATAAAAATAAAATATTAAACAAG
ATTATGGTTAATAAAGAAATAATATTAAGTGGTGGTGCCGTAAATAGTCC
TCAGTTATTAATGCTTAGTGGAGTGGGAGATGGGGCGGAACTGAAACAGC
ACTCTATAGACGTTGTGAACCATGTTCCTGGGGTGGGCAAAAATTTACAG
GATCATTTGGAATTGTATGTGCAACATAAGTCTAAGAAACCTGTCACTTT
ATACTCGGCCACTTGGAAGTTTCCTCATAACGTGATCCGAATTGGTTTGC
AATGGTTTTTGTTCAAATCCGGAATGGGAGCAACTAGCCACTTAGACAGT
GGGGGATTTATTCGCTCAGAACCCGGTGTGGCTCACCCTGATCTTCAATT
TCATTTTTTACCTTCTACCGTTAAAGATCATGGACGTAAATTAGCTACGT
TTCATGCATTTCAGGCTCATGTTGGACCAATGAGATCACAATCAAAAGGT
AGCATTACAATCTTATCAAATGATCCTAGACAACATCCTTTAATTGATCC
AAATTATAATTCATTAAAAAGAGACTTTTGGGAGTTCAGGAAGGCAATTA
GATTAACTCGTGAAATATTTTCCCAGTCGGCTTTTGACGAATTTCGTGGC
GAAGAAATTCTACCTGGACCTGATGCTCAATCTGATGAACAATTGGATGA
ATTTATTAGACAAAAAACTGATACAGCATATCACCCATCATGTACTTGTC
GAATGGGATCGACTAAGAGCAATGATACAGTTGTGGATCCTCAATGTAGA
GTTGTTGGATTAGATAACTTACGTGTTGTAGATGCATCTGTCATGCCAAG
TATTGTCAGTGGTAATCTAAATGCTCCGACAATGATGATTGCTGAAAAGG
TAGCTGATATGATCCTAGGTAATGATCCTTTGCCTAAGTTAGAAAATGTG
CCAATCTGGATCCCTAAGTATCCAATGAAGCAAAGAGAATCTGAATAAAT
AATTTTCAAATTGGAAAATTGTGATTTTATATTTTACTTTCATAGTTTGA
TATTCAATAAA
back to top

protein sequence of SMED30030666-orf-1

>SMED30030666-orf-1 ID=SMED30030666-orf-1|Name=SMED30030666-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1114bp
MIIKPILRRKIQQILYHRRYSIDLVQKQILSVNKNTDILSEKLFDDRQPK
FEAVVFDKDGTLLCFHSMWTTWITNLVKNINQELDKDISSAIYSILGVCS
KTYRTSPGLMAEGTKDQIKNALQKVIMAECAISEKKSNEIIEKHFQNNAA
NENSLKEIHNVRKLFKVIKQHGVKIGICTSDTREGTLAALQSINSLDLVD
SICCGDDPNSLPKPDPFFSKTISQDLNVPVSSMAMVGDTRSDMEFGKNSG
MSGRIGVLSGIGDSEILQNSGATDIIRSVEDILPLLLPSCPIKLSKDTEL
ISSQEWKLIIMDKDGTLTDVYLKYKKWALLLGERLKTSTSSEITELFFKI
IGFDQAETFSTGSLLGESAVLQMKDIIKYLLILNGYSSEETDKIVKKVWV
DTSVFGDEELPEFKHSLLELKSKGMKLALNSSDSRSSIDNFIKRNNIDDV
FDATVSAEDSSPHFKPLPHSILKICNDLQISTKETLLIGDSQTDMLCGRS
AKVGASIGVLSGLGKSQNLMGLCQLLIPNINYLPQLLHSRSFHTSCRVHA
STCNTNNQAVDYIIIGAGSAGCVLANRLSANVNNTVNLIEAGPSDNTWTI
NMPAALIYNLCHDKYNWYYTTKAQKYLNNREMYWPRGRVLGGSSSLNAMV
YIRGHPFDYDRWESEGAHGWSYASCLPYFKKAQTHEFGDNTYRGGNGPLN
VSRSKVNGILHRSWIKAGMEAGYGFTEDMNGYKQEGFGEFDQTIYKGERW
SSSKAFLKPVLKRNNLTVKTNTMVTKILFDGKKAVGIEILDKNKILNKIM
VNKEIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDH
LELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGATSHLDSGG
FIRSEPGVAHPDLQFHFLPSTVKDHGRKLATFHAFQAHVGPMRSQSKGSI
TILSNDPRQHPLIDPNYNSLKRDFWEFRKAIRLTREIFSQSAFDEFRGEE
ILPGPDAQSDEQLDEFIRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVV
GLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMILGNDPLPKLENVPI
WIPKYPMKQRESE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036188FAD/NAD-bd_sf
IPR041492HAD_2
IPR006439HAD-SF_hydro_IA
IPR023198PGP-like_dom2
IPR027424Glucose_Oxidase_domain_2
IPR036412HAD-like_sf
IPR023214HAD_sf
IPR023753FAD/NAD-binding_dom
IPR007867GMC_OxRtase_C
IPR000172GMC_OxRdtase_N
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0016491oxidoreductase activity
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0008812choline dehydrogenase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0019285glycine betaine biosynthetic process from choline
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 560..1086
e-value: 1.7E-177
score: 593.3
IPR036188FAD/NAD(P)-binding domain superfamilySUPERFAMILYSSF51905FAD/NAD(P)-binding domaincoord: 543..1090
IPR000172Glucose-methanol-choline oxidoreductase, N-terminalPFAMPF00732GMC_oxred_Ncoord: 560..851
e-value: 2.4E-92
score: 309.5
IPR000172Glucose-methanol-choline oxidoreductase, N-terminalPROSITEPS00623GMC_OXRED_1coord: 637..660
IPR000172Glucose-methanol-choline oxidoreductase, N-terminalPROSITEPS00624GMC_OXRED_2coord: 810..824
IPR041492Haloacid dehalogenase-like hydrolasePFAMPF13419HAD_2coord: 407..503
e-value: 2.1E-18
score: 67.0
coord: 54..251
e-value: 2.0E-17
score: 63.8
IPR006439HAD hydrolase, subfamily IATIGRFAMTIGR01549TIGR01549coord: 422..501
e-value: 1.3E-5
score: 23.6
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 139..288
e-value: 2.5E-26
score: 94.3
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 309..515
e-value: 3.4E-21
score: 78.2
IPR023198Phosphoglycolate phosphatase-like, domain 2GENE3DG3DSA:1.10.150.240coord: 321..406
e-value: 3.4E-21
score: 78.2
NoneNo IPR availableGENE3DG3DSA:1.10.1220.110coord: 652..705
e-value: 1.7E-177
score: 593.3
NoneNo IPR availableGENE3DG3DSA:3.30.410.40coord: 706..1027
e-value: 1.7E-177
score: 593.3
NoneNo IPR availableSFLDSFLDG01129C1.5:_HAD,_Beta-PGM,_Phosphatcoord: 51..285
e-value: 5.4E-24
score: 79.8
coord: 307..513
e-value: 4.0E-20
score: 67.1
NoneNo IPR availableSFLDSFLDS00003Haloacid_Dehalogenasecoord: 307..513
e-value: 4.0E-20
score: 67.1
coord: 51..285
e-value: 5.4E-24
score: 79.8
NoneNo IPR availablePANTHERPTHR11552:SF147CHOLINE DEHYDROGENASE, MITOCHONDRIALcoord: 544..1101
NoneNo IPR availablePANTHERPTHR11552GLUCOSE-METHANOL-CHOLINE GMC OXIDOREDUCTASEcoord: 544..1101
NoneNo IPR availableCDDcd01427HAD_likecoord: 161..257
e-value: 1.6047E-13
score: 65.8802
NoneNo IPR availableSUPERFAMILYSSF54373FAD-linked reductases, C-terminal domaincoord: 846..1030
IPR027424Glucose Oxidase, domain 2GENE3DG3DSA:4.10.450.10coord: 593..751
e-value: 1.7E-177
score: 593.3
IPR007867Glucose-methanol-choline oxidoreductase, C-terminalPFAMPF05199GMC_oxred_Ccoord: 945..1081
e-value: 5.9E-41
score: 140.4
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 305..537
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 43..286