Fer-1-related

Overview
NameFer-1-related
Smed IDSMED30030659
Length (bp)6660
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fer-1-related (SMED30030659) t-SNE clustered cells

Violin plots show distribution of expression levels for Fer-1-related (SMED30030659) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fer-1-related (SMED30030659) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fer-1-related (SMED30030659) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030659

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 35

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30030659SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30030659SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30030659SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30030659SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030659SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030659SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30030659SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030659SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030659SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30030659SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30030659SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030659SMESG000070967.1 Contig48307uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030659SMESG000070967.1 Contig48307newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030659SMESG000075933.1 Contig7517uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030659SMESG000075933.1 Contig7517newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030659SMESG000077057.1 SMESG000070967.1 Contig51096uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030659SMESG000077057.1 SMESG000070967.1 Contig51096newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30030659SMESG000075933.1 dd_Smed_v4_6816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030659SMESG000075933.1 dd_Smed_v4_6816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30030659SMESG000075933.1 dd_Smed_v4_6816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30030659SMESG000075933.1 dd_Smed_v4_6816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30030659SMESG000075933.1 dd_Smed_v4_6816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30030659SMESG000075933.1 dd_Smed_v4_6816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030659SMESG000075933.1 Contig36058uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030659SMESG000075933.1 Contig36058newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030659SMESG000075933.1 Contig43830uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030659SMESG000075933.1 Contig43830newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030659SMESG000070967.1 Contig42957uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030659SMESG000070967.1 Contig42957newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030659SMESG000075933.1 Contig45301uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30030659SMESG000075933.1 Contig45301newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
secretory systemSMED30030659SMESG000075933.1 dd_Smed_v6_6816_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30030659SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30030659SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermis progenitor cellSMED30030659SMESG000075933.1 dd_Smed_v4_6816_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fer-1-related vs. Ensembl Human
Match: DYSF (dysferlin [Source:HGNC Symbol;Acc:HGNC:3097])

HSP 1 Score: 1645.17 bits (4259), Expect = 0.000e+0
Identity = 957/2167 (44.16%), Postives = 1338/2167 (61.74%), Query Frame = 3
Query:  102 VINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXX--IDQTDSAGAEEDETDNAEIGN---------SGSGPQIKIKKVGKR---------------TTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN-------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSN-NSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDE-WQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQL-QAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            ++ A+NL + +   +SDP   + F+G KK+TK I  ++NP W+E   +DL G  L     L V V D E +G ++ +G   VPLR+ LA           LLD  K+PT   L L+V Y P   A       +  + + T   +D     G EED  D    G+          G G     +K+  R               T+RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T++    NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  IY EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE+NLLRP GV LR A F L+V+RAEDLP+MD  +++ +K++F  ++ KK LVDP++   FAGK + + +   + +P+WN+ + +   FPSMCE++++++ DWDR+T +DI+ T  + +S I+A G         GFLPTFGPC+IN +GSPREF+  PD +  LN GKGEGVAYRGRL++ L T L E  EQ  E LP   D +L+ +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPWGN KP  V+  +WE++S R+ T N  L I D++ + ++++ +A+KA    E+    V    D+LI  CS+  P  +  E+P  T LD  L  LRT+ L  I + AL ++   + +  AL   E +  +LR L+ EPQNS+PD+VIWM+ G KR  Y R+PA+ VL+S   ++Y G+ CG +QTI LK P  K   +    +P Q+R+KLW G   DE E+++   EG+LS+ AETYEN+   +LVG W T    +T P +SD +G+++L K++ +P  GW W GDW++ PE +L +D DAG   ++E+VF N+ R+PGG W      +TD+ G+      DI  P GW+WEDE W  DLNR  DE+GWEY++    E     +VP EKMY+  RRRR+VR R+    ++           + E WEYA LF  +FH + RKTD  RRRRW R+M+P++   PA                    V  +E      +D ++ED +    +   V +           P +  +F   +++ LR Y+YQAR+L A D+  FSDPYA V+FL+QSQ T  +  TL PTWDQTLIF++IEI G+PA + E PP +++E++D+D  G DEF+GRC   P ++      R P L W+ LT+G++ +GELLA+FEL +Q +KP                        LP+ PP+R  NI+ V   I+P +QRT IEIL+WG+RNM  YQLAN++SPS+  E GG  +Q+ +I+N   NPNF+   LF++V+LP+EELY PP  +KV DNR FGR+P+VG   + S++++   P   E+             GG +     +  E+++ I  D++       +    + L            T +A  P    +E             E IDWWSK++AS+GE  KC  Y + ++DTL+VY T+LE VE +   +DFC  F LYRGK  ++ E+ SV GEFKG F+IYPLPE+    +P +   + L +  P EC+VR+YI++A  LQP DP+G  DPY+++ +GKK ++++D+YIP  L P FG+MFEL C LP++KDL+I + DYD +S D+ IGET +DLENR L+KF A CGLPQTYC+SGPN+WRD  +P+++L  FC+++ +  P Y+T+    V    +++ +   E    PN H GP  ERLALHVL    L  EHVE+RPL+SPLQP IEQGKLQ W+D+FP ++   G PF ITPR+ + + LR I+WNT+DVIL+D +L GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRF+FPF YLPAE +  + KK+ FW LD+TE ++P   V QIWDNDKFS DDFLG+L+L+L +MP PAK +K+C L+QL  AF+P   V   +LFE +   G+WPC  +E     L GK+EM LE++ E E   +PAG GRDEPN NPKLE P RPDTSFLWFTSP+KT KFI+W+ F+W  I  II+ ++ L + +F+Y+ P   A K+V
Sbjct:    6 LVRASNLPSAKKDRRSDPVASLTFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKG-NSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEAPLERKDPSEDKEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMDNVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEVDDYLGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVEDLP--ADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQ--PLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALAEEPQNSLPDIVIWMLQGDKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPMEK---VPGARMPVQIRVKLWFGLSVDEKEFNQF-AEGKLSVFAETYENETKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPERKPKHWVPAEKMYYTHRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPA-------------------AVFALEGALGGVMDDKSEDSMSVSTLSFGVNR-----------PTISCIFDYGNRYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPSGELLASFEL-IQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNPNFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESP---------SPQGGPDDVSLLSPGEDVL-IDIDDKEPLIPIQLADGLSSLAP----------TNTASPPSSPHEE-------------EFIDWWSKFFASIGEREKCGSYLEKDFDTLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSVIGEFKGLFKIYPLPEDPAIPMPPRQFHQ-LAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDR---VMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYLPAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAKKCSLDQLDDAFHPEWFV---SLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRWAIILFIILFILLLFLAIFIYAFPNYAAMKLV 2084          
BLAST of Fer-1-related vs. Ensembl Human
Match: DYSF (dysferlin [Source:HGNC Symbol;Acc:HGNC:3097])

HSP 1 Score: 1639.78 bits (4245), Expect = 0.000e+0
Identity = 959/2181 (43.97%), Postives = 1340/2181 (61.44%), Query Frame = 3
Query:  102 VINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXX--IDQTDSAGAEEDETDNAEIGN---------SGSGPQIKIKKVGKR---------------TTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN---------------------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSN-NSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDE-WQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQL-QAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            ++ A+NL + +   +SDP   + F+G KK+TK I  ++NP W+E   +DL G  L     L V V D E +G ++ +G   VPLR+ LA           LLD  K+PT   L L+V Y P   A       +  + + T   +D     G EED  D    G+          G G     +K+  R               T+RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T++    NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  IY EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE+NLLRP GV LR A F L+V+RAEDLP+MD  +++ +K++F  ++ KK LVDP++   FAGK + + +   + +P+WN+ + +   FPSMCE++++++ DWDR+T +DI+ T  + +S I+A G                       GFLPTFGPC+IN +GSPREF+  PD +  LN GKGEGVAYRGRL++ L T L E  EQ  E LP   D +L+ +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPWGN KP  V+  +WE++S R+ T N  L I D++ + ++++ +A+KA    E+    V    D+LI  CS+  P  +  E+P  T LD  L  LRT+ L  I + AL ++   + +  AL   E +  +LR L+ EPQNS+PD+VIWM+ G KR  Y R+PA+ VL+S   ++Y G+ CG +QTI LK P  K   +    +P Q+R+KLW G   DE E+++   EG+LS+ AETYEN+   +LVG W T    +T P +SD +G+++L K++ +P  GW W GDW++ PE +L +D DAG   ++E+VF N+ R+PGG W      +TD+ G+      DI  P GW+WEDE W  DLNR  DE+GWEY++    E     +VP EKMY+  RRRR+VR R+    ++           + E WEYA LF  +FH + RKTD  RRRRW R+M+P++   PA                    V  +E      +D ++ED +    +   V +           P +  +F   +++ LR Y+YQAR+L A D+  FSDPYA V+FL+QSQ T  +  TL PTWDQTLIF++IEI G+PA + E PP +++E++D+D  G DEF+GRC   P ++      R P L W+ LT+G++ +GELLA+FEL +Q +KP                        LP+ PP+R  NI+ V   I+P +QRT IEIL+WG+RNM  YQLAN++SPS+  E GG  +Q+ +I+N   NPNF+   LF++V+LP+EELY PP  +KV DNR FGR+P+VG   + S++++    L D  S  +  P      GG +     +  E+++ I  D++       +    + L            T +A  P    +E             E IDWWSK++AS+GE  KC  Y + ++DTL+VY T+LE VE +   +DFC  F LYRGK  ++ E+ SV GEFKG F+IYPLPE+    +P +   + L +  P EC+VR+YI++A  LQP DP+G  DPY+++ +GKK ++++D+YIP  L P FG+MFEL C LP++KDL+I + DYD +S D+ IGET +DLENR L+KF A CGLPQTYC+SGPN+WRD  +P+++L  FC+++ +  P Y+T+    V    +++ +   E    PN H GP  ERLALHVL    L  EHVE+RPL+SPLQP IEQGKLQ W+D+FP ++   G PF ITPR+ + + LR I+WNT+DVIL+D +L GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRF+FPF YLPAE +  + KK+ FW LD+TE ++P   V QIWDNDKFS DDFLG+L+L+L +MP PAK +K+C L+QL  AF+P   V   +LFE +   G+WPC  +E     L GK+EM LE++ E E   +PAG GRDEPN NPKLE P RPDTSFLWFTSP+KT KFI+W+ F+W  I  II+ ++ L + +F+Y+ P   A K+V
Sbjct:    6 LVRASNLPSAKKDRRSDPVASLTFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKG-NSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEAPLERKDPSEDKEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMDNVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEEEPAGAVKPSKASDLDDYLGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVEDLP--ADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQ--PLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALAEEPQNSLPDIVIWMLQGDKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPMEK---VPGARMPVQIRVKLWFGLSVDEKEFNQF-AEGKLSVFAETYENETKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPERKPKHWVPAEKMYYTHRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPA-------------------AVFALEGALGGVMDDKSEDSMSVSTLSFGVNR-----------PTISCIFDYGNRYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPSGELLASFEL-IQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNPNFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESF----LCDPYSAESPSP-----QGGPDDVSLLSPGEDVL-IDIDDKEPLIPIQLADGLSSLAP----------TNTASPPSSPHEE-------------EFIDWWSKFFASIGEREKCGSYLEKDFDTLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSVIGEFKGLFKIYPLPEDPAIPMPPRQFHQ-LAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDR---VMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYLPAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAKKCSLDQLDDAFHPEWFV---SLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRWAIILFIILFILLLFLAIFIYAFPNYAAMKLV 2098          
BLAST of Fer-1-related vs. Ensembl Human
Match: DYSF (dysferlin [Source:HGNC Symbol;Acc:HGNC:3097])

HSP 1 Score: 1632.46 bits (4226), Expect = 0.000e+0
Identity = 954/2181 (43.74%), Postives = 1331/2181 (61.03%), Query Frame = 3
Query:  102 VINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXX--IDQTDSAGAEEDETDNAEIGN---------SGSGPQIKIKKVGKR---------------TTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN---------------------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSN-NSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDE-WQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQL-QAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            ++ A+NL + +   +SDP   + F+G KK+TK I  ++NP W+E   +DL G  L     L V V D E +G ++ +G   VPLR+ LA           LLD  K+PT   L L+V Y P   A       +  + + T   +D     G EED  D    G+          G G     +K+  R               T+RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T++    NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  IY EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE+NLLRP GV LR A F L+V+RAEDLP+MD  +++ +K++F  ++ KK LVDP++   FAGK + + +   + +P+WN+ + +   FPSMCE++++++ DWDR+T +DI+ T  + +S I+A G                       GFLPTFGPC+IN +GSPREF+  PD +  LN GKGEGVAYRGRL++ L T L E  EQ  E LP   D +L+ +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPWGN KP  V+  +WE++S R+ T N  L I D++ + ++++ +A+KA    E+    V    D+LI  CS+  P  +  E+P  T LD  L  LRT+ L  I + AL ++   + +  AL   E +  +LR L+ EPQNS+PD+VIWM+ G KR  Y R+PA+ VL+S   ++Y G+ CG +QTI LK P  K   +    +P Q+R+KLW G   DE E+++   EG+LS+ AETYEN+   +LVG W T    +T P +SD +G+++L K++ +P  GW W GDW++ PE +L +D DAG   ++E+VF N+ R+PGG W      +TD+ G+      DI  P GW+WEDE W  DLNR  DE+GWEY++    E     +VP EKMY+  RRRR+VR R+    ++           + E WEYA LF  +FH + RKTD  RRRRW R+M+P++   PA                    V  +E      +D ++ED +    +   V +           P +  +F   +++ LR Y+YQAR+L A D+  FSDPYA V+FL+QSQ T  +  TL PTWDQTLIF++IEI G+PA + E PP +++E++D+D  G DEF+GRC   P ++      R P L W+ LT+G++ +GELLA+FEL +Q +KP                        LP+ PP+R  NI+ V   I+P +QRT IEIL+WG+RNM  YQLAN++SPS+  E GG  +Q+ +I+N   NPNF+   LF++V+LP+EELY PP  +KV DNR FGR+P+VG   + S++++   P   E+             GG +     +  E               D +I  D+                  K P     E+E ++            WWSK++AS+GE  KC  Y + ++DTL+VY T+LE VE +   +DFC  F LYRGK  ++ E+ SV GEFKG F+IYPLPE+    +P +   + L +  P EC+VR+YI++A  LQP DP+G  DPY+++ +GKK ++++D+YIP  L P FG+MFEL C LP++KDL+I + DYD +S D+ IGET +DLENR L+KF A CGLPQTYC+SGPN+WRD  +P+++L  FC+++ +  P Y+T+    V    +++ +   E    PN H GP  ERLALHVL    L  EHVE+RPL+SPLQP IEQGKLQ W+D+FP ++   G PF ITPR+ + + LR I+WNT+DVIL+D +L GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRF+FPF YLPAE +  + KK+ FW LD+TE ++P   V QIWDNDKFS DDFLG+L+L+L +MP PAK +K+C L+QL  AF+P   V   +LFE +   G+WPC  +E     L GK+EM LE++ E E   +PAG GRDEPN NPKLE P RPDTSFLWFTSP+KT KFI+W+ F+W  I  II+ ++ L + +F+Y+ P   A K+V
Sbjct:    6 LVRASNLPSAKKDRRSDPVASLTFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKG-NSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEAPLERKDPSEDKEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMDNVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEEEPAGAVKPSKASDLDDYLGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVEDLP--ADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQ--PLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALAEEPQNSLPDIVIWMLQGDKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPMEK---VPGARMPVQIRVKLWFGLSVDEKEFNQF-AEGKLSVFAETYENETKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPERKPKHWVPAEKMYYTHRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPA-------------------AVFALEGALGGVMDDKSEDSMSVSTLSFGVNR-----------PTISCIFDYGNRYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPSGELLASFEL-IQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNPNFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESP---------SPQGGPDDVSLLSPGE---------------DVLIDIDD------------------KEPLIPIQEEEFID------------WWSKFFASIGEREKCGSYLEKDFDTLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSVIGEFKGLFKIYPLPEDPAIPMPPRQFHQ-LAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDR---VMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYLPAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAKKCSLDQLDDAFHPEWFV---SLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRWAIILFIILFILLLFLAIFIYAFPNYAAMKLV 2077          
BLAST of Fer-1-related vs. Ensembl Human
Match: DYSF (dysferlin [Source:HGNC Symbol;Acc:HGNC:3097])

HSP 1 Score: 1632.46 bits (4226), Expect = 0.000e+0
Identity = 954/2166 (44.04%), Postives = 1327/2166 (61.27%), Query Frame = 3
Query:  147 SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXX--IDQTDSAGAEEDETDNAEIGN---------SGSGPQIKIKKVGKR---------------TTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN---------------------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSN-NSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDE-WQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQL-QAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            SD Y    F G KK+TK I  ++NP W+E   +DL G  L     L V V D E +G ++ +G   VPLR+ LA           LLD  K+PT   L L+V Y P   A       +  + + T   +D     G EED  D    G+          G G     +K+  R               T+RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T++    NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  IY EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE+NLLRP GV LR A F L+V+RAEDLP+MD  +++ +K++F  ++ KK LVDP++   FAGK + + +   + +P+WN+ + +   FPSMCE++++++ DWDR+T +DI+ T  + +S I+A G                       GFLPTFGPC+IN +GSPREF+  PD +  LN GKGEGVAYRGRL++ L T L E  EQ  E LP   D +L+ +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPWGN KP  V+  +WE++S R+ T N  L I D++ + ++++ +A+KA    E+    V    D+LI  CS+  P  +  E+P  T LD  L  LRT+ L  I + AL ++   + +  AL   E +  +LR L+ EPQNS+PD+VIWM+ G KR  Y R+PA+ VL+S   ++Y G+ CG +QTI LK P  K   +    +P Q+R+KLW G   DE E+++   EG+LS+ AETYEN+   +LVG W T    +T P +SD +G+++L K++ +P  GW W GDW++ PE +L +D DAG   ++E+VF N+ R+PGG W      +TD+ G+      DI  P GW+WEDE W  DLNR  DE+GWEY++    E     +VP EKMY+  RRRR+VR R+    ++           + E WEYA LF  +FH + RKTD  RRRRW R+M+P++   PA                    V  +E      +D ++ED +    +   V +           P +  +F   +++ LR Y+YQAR+L A D+  FSDPYA V+FL+QSQ T  +  TL PTWDQTLIF++IEI G+PA + E PP +++E++D+D  G DEF+GRC   P ++      R P L W+ LT+G++ +GELLA+FEL +Q +KP                        LP+ PP+R  NI+ V   I+P +QRT IEIL+WG+RNM  YQLAN++SPS+  E GG  +Q+ +I+N   NPNF+   LF++V+LP+EELY PP  +KV DNR FGR+P+VG   + S++++   P   E+             GG +     +  E+++ I  D++       +    + L            T +A  P    +E             E IDWWSK++AS+GE  KC  Y + ++DTL+VY T+LE VE +   +DFC  F LYRGK  ++ E+ SV GEFKG F+IYPLPE+    +P +   + L +  P EC+VR+YI++A  LQP DP+G  DPY+++ +GKK ++++D+YIP  L P FG+MFEL C LP++KDL+I + DYD +S D+ IGET +DLENR L+KF A CGLPQTYC+SGPN+WRD  +P+++L  FC+++ +  P Y+T+    V    +++ +   E    PN H GP  ERLALHVL    L  EHVE+RPL+SPLQP IEQGKLQ W+D+FP ++   G PF ITPR+ + + LR I+WNT+DVIL+D +L GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRF+FPF YLPAE +  + KK+ FW LD+TE ++P   V QIWDNDKFS DDFLG+L+L+L +MP PAK +K+C L+QL  AF+P   V   +LFE +   G+WPC  +E     L GK+EM LE++ E E   +PAG GRDEPN NPKLE P RPDTSFLWFTSP+KT KFI+W+ F+W  I  II+ ++ L + +F+Y+ P   A K+V
Sbjct:   20 SDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKG-NSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEAPLERKDPSEDKEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMDNVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEEEPAGAVKPSKASDLDDYLGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVEDLP--ADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQ--PLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALAEEPQNSLPDIVIWMLQGDKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPMEK---VPGARMPVQIRVKLWFGLSVDEKEFNQF-AEGKLSVFAETYENETKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPERKPKHWVPAEKMYYTHRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPA-------------------AVFALEGALGGVMDDKSEDSMSVSTLSFGVNR-----------PTISCIFDYGNRYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPSGELLASFEL-IQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNPNFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESP---------SPQGGPDDVSLLSPGEDVL-IDIDDKEPLIPIQLADGLSSLAP----------TNTASPPSSPHEE-------------EFIDWWSKFFASIGEREKCGSYLEKDFDTLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSVIGEFKGLFKIYPLPEDPAIPMPPRQFHQ-LAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDR---VMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYLPAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAKKCSLDQLDDAFHPEWFV---SLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRWAIILFIILFILLLFLAIFIYAFPNYAAMKLV 2097          
BLAST of Fer-1-related vs. Ensembl Human
Match: DYSF (dysferlin [Source:HGNC Symbol;Acc:HGNC:3097])

HSP 1 Score: 1624.37 bits (4205), Expect = 0.000e+0
Identity = 951/2166 (43.91%), Postives = 1320/2166 (60.94%), Query Frame = 3
Query:  147 SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXX--IDQTDSAGAEEDETDNAEIGN---------SGSGPQIKIKKVGKR---------------TTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN---------------------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSN-NSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDE-WQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQL-QAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            SD Y    F G KK+TK I  ++NP W+E   +DL G  L     L V V D E +G ++ +G   VPLR+ LA           LLD  K+PT   L L+V Y P   A       +  + + T   +D     G EED  D    G+          G G     +K+  R               T+RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T++    NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  IY EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE+NLLRP GV LR A F L+V+RAEDLP+MD  +++ +K++F  ++ KK LVDP++   FAGK + + +   + +P+WN+ + +   FPSMCE++++++ DWDR+T +DI+ T  + +S I+A G                       GFLPTFGPC+IN +GSPREF+  PD +  LN GKGEGVAYRGRL++ L T L E  EQ  E LP   D +L+ +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPWGN KP  V+  +WE++S R+ T N  L I D++ + ++++ +A+KA    E+    V    D+LI  CS+  P  +  E+P  T LD  L  LRT+ L  I + AL ++   + +  AL   E +  +LR L+ EPQNS+PD+VIWM+ G KR  Y R+PA+ VL+S   ++Y G+ CG +QTI LK P  K   +    +P Q+R+KLW G   DE E+++   EG+LS+ AETYEN+   +LVG W T    +T P +SD +G+++L K++ +P  GW W GDW++ PE +L +D DAG   ++E+VF N+ R+PGG W      +TD+ G+      DI  P GW+WEDE W  DLNR  DE+GWEY++    E     +VP EKMY+  RRRR+VR R+    ++           + E WEYA LF  +FH + RKTD  RRRRW R+M+P++   PA                    V  +E      +D ++ED +    +   V +           P +  +F   +++ LR Y+YQAR+L A D+  FSDPYA V+FL+QSQ T  +  TL PTWDQTLIF++IEI G+PA + E PP +++E++D+D  G DEF+GRC   P ++      R P L W+ LT+G++ +GELLA+FEL +Q +KP                        LP+ PP+R  NI+ V   I+P +QRT IEIL+WG+RNM  YQLAN++SPS+  E GG  +Q+ +I+N   NPNF+   LF++V+LP+EELY PP  +KV DNR FGR+P+VG   + S++++   P   E+             GG +     +  E               D +I  D+                  K P     E+E ++            WWSK++AS+GE  KC  Y + ++DTL+VY T+LE VE +   +DFC  F LYRGK  ++ E+ SV GEFKG F+IYPLPE+    +P +   + L +  P EC+VR+YI++A  LQP DP+G  DPY+++ +GKK ++++D+YIP  L P FG+MFEL C LP++KDL+I + DYD +S D+ IGET +DLENR L+KF A CGLPQTYC+SGPN+WRD  +P+++L  FC+++ +  P Y+T+    V    +++ +   E    PN H GP  ERLALHVL    L  EHVE+RPL+SPLQP IEQGKLQ W+D+FP ++   G PF ITPR+ + + LR I+WNT+DVIL+D +L GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRF+FPF YLPAE +  + KK+ FW LD+TE ++P   V QIWDNDKFS DDFLG+L+L+L +MP PAK +K+C L+QL  AF+P   V   +LFE +   G+WPC  +E     L GK+EM LE++ E E   +PAG GRDEPN NPKLE P RPDTSFLWFTSP+KT KFI+W+ F+W  I  II+ ++ L + +F+Y+ P   A K+V
Sbjct:   20 SDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKG-NSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEAPLERKDPSEDKEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMDNVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEEEPAGAVKPSKASDLDDYLGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVEDLP--ADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQ--PLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALAEEPQNSLPDIVIWMLQGDKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPMEK---VPGARMPVQIRVKLWFGLSVDEKEFNQF-AEGKLSVFAETYENETKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPERKPKHWVPAEKMYYTHRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPA-------------------AVFALEGALGGVMDDKSEDSMSVSTLSFGVNR-----------PTISCIFDYGNRYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPSGELLASFEL-IQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNPNFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESP---------SPQGGPDDVSLLSPGE---------------DVLIDIDD------------------KEPLIPIQEEEFID------------WWSKFFASIGEREKCGSYLEKDFDTLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSVIGEFKGLFKIYPLPEDPAIPMPPRQFHQ-LAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDR---VMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYLPAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAKKCSLDQLDDAFHPEWFV---SLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRWAIILFIILFILLLFLAIFIYAFPNYAAMKLV 2076          
BLAST of Fer-1-related vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 157.532 bits (397), Expect = 7.208e-38
Identity = 98/297 (33.00%), Postives = 144/297 (48.48%), Query Frame = 3
Query: 4491 LSAKSPKRKKDEDEVLNVLDLTLMDE-------------------DIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLL---YRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDE 5315
            +S   PK K D  E    LDL + +E                    +DWWS+YYAS+ ++ +   Y +   + +++++  LE++  YN F+DF   F      +G   D EE+   GE K    I  L +      P   +   +    P  C+VRVYII+A  L  N   G  D YV++  GK+ +  K +Y   C  P FG   ++   +P++KDL+I V     + SD  IG T IDLENR LTK+RAT GL   + + G  +WRD   P EILK +C K  +  P  ++   E
Sbjct: 1235 VSHIVPKVKSDHAERWEQLDLVITEEFDQIIRMVRVPTLTTDPMVPLDWWSRYYASMSQFHRSPGYPESGMEYVRIFRRPLEQMNGYNNFSDFLDTFPFVKSMKGDFDDPEEKEKAGELKCRLLISKLKKG----KPPAAINTVVDFVGPTRCLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPKIESRQTE 1527          

HSP 2 Score: 145.206 bits (365), Expect = 4.095e-34
Identity = 184/841 (21.88%), Postives = 339/841 (40.31%), Query Frame = 3
Query:  612 KKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDAL----IGSFKFDLSMIYEEPKHNYMNKWLLLS-------DPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVK-------YNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPR--EFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVD-----SPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKI---IDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIR----KEALRVREEATSVE-QALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA-SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDI-VLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGG 3029
            K  GKR  + +   KP  + + ++++EA+ +  G+          +   +     +   P+W  +  +       E     ++ ++   R +R  AL    +G F   LS +   P  + + KW+ L        +P+D      G+LK   ++    +  P+      +E           +G  L   T  +RV+  E L          I+++      KK+    Y++ Q    + +T+++        N    ++ +E+ + +Q+P++   I   LFD  +      IG A + +  I   G+ G+LPTFGP F+N F   R   FS    +       + +G  + GRL + +   ++   +   +I+ ++   +++++   +  ++  +  F S S +  ++      PV   +SIG++G+  +E  S +SST       +DG  Y  +PWGN +P   V+  WE +  R+   N  +K+   +D M+  + +I    KA           +   +  I   SK L       S    LD ++   R  ++  +R    KEA  +      V+ + L  L    +    L+ + Q ++P V+I M++  K   + +IP  ++  S++    G +CG  + IN++ P+L D         A L  K+W G+     +W +     ++    E YE Q   L  +W   A +          G+ E   E +    GW   G W +     +F  K  G     +  F  + R   G W     ++TD   D    PKD+     GWE     Q       DE+GW Y+      G
Sbjct:   83 KSFGKRKLQDT--DKPCTWNVLVRIIEAKDVSTGS---ARVRTIFDGNSKMTRTVTHAIPKWRQNILYTIKNQPLE----KLAAKVLTLRLVRPTALGESSVGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDESPPTLIDDDGKEQIW--------SGAHLIDYTLKIRVFSVEQL----------IRQMINERKIKKKQ-RFYVMVQCGAHKTETTMESAFLDEDANIASVKFEQEIYLPIQWPTVISEIIFSLFD-KKGRGKTCIGKATLPMKMIYEPGETGYLPTFGPAFLNVFDCERVTRFSIFSRKMRG---SQQDGSRFVGRLFIAID-CVEYMEKANAQIMHLDHSPIMEAESICKNLEW--YNCFCSMSGLNMINPQFASDPVCIMMSIGSFGSTSNEFRSCNSSTLPA-EPNWDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRI--GNKAIDHVSSVGMEALECLEQQIDSASKYLGRINPVSS--NALDRHILDYRKEKILKLREHFEKEAFSIDYSDGEVDAKLLRMLLKIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQWPTLVDQRNRKREHVAVLHAKMWFGRTDQLTKWKEHVQPADIRRFMEMYEVQTKGLALKWKDEADIY--------DGKWEKTNE-VPLENGWNAVGHWIVMNTRHMFVPK-LGQHTVHDKAFEIQKRTEDGTWKH--FKYTDCYADEL-KPKDLDKHAKGWEVGSWAQDKFRNNGDEKGWVYSTNGVFFG 870          

HSP 3 Score: 140.969 bits (354), Expect = 8.011e-33
Identity = 73/186 (39.25%), Postives = 108/186 (58.06%), Query Frame = 3
Query: 5385 FGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNL 5942
             G   + +AL +L  + L  EHVE+RPLFS      ++G+L+ ++DIFP     I  PF I PRKP +YQLRI V + +  I    +   E +SD+YVK ++ G+ +  +TD H+R LDG G FNWRF+  F Y P E  ++   K  F+     E+ +    V+++WD +KF  D  LG +EL+L
Sbjct: 1634 MGSQLQTIALFILRQMNLVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRS-FAEPVSDLYVKAFINGMTKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFC-KPVEELVDPILVIELWDKNKFRKDRLLGDIELDL 1817          

HSP 4 Score: 103.219 bits (256), Expect = 2.081e-21
Identity = 83/276 (30.07%), Postives = 127/276 (46.01%), Query Frame = 3
Query: 3462 RLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGN-RDAGELLAAFELYLQTDKPL-PFTPPKRGNI---FCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTD-IXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTY 4271
            R++    +  KWQLR YI    +LL   +   S  + R++F   S+ T  +D +  P W++T++F  + I G    I++ PP V +EV       E+  LG  +  P V     D R    QW+ L   N R  G +LA FELY + DK L P  P  + N      +    RP   +  ++ L WGVRN+ K++L  V  P +   IG        +             ++F +V+LP      PP  I + D R F R+PLVG  +++ +  Y
Sbjct:  961 RVYEYQMQTGKWQLRCYIMWGNDLLPVVKNS-SRAFVRISFAQYSKQTLLVDNSQNPIWNETVMFKSVLIAGGTRDIMKYPPVVSVEVVGECSNNEEANLGHFETKPNVICGNTDVRG-TPQWFPLKFSNGRTRGAVLACFELYSEEDKDLIPLEPKCKHNYKERSEIPTEFRPQFDKFHVQFLCWGVRNLKKHKLLAVRRPFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVILPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKY 1234          
BLAST of Fer-1-related vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 157.147 bits (396), Expect = 9.100e-38
Identity = 98/297 (33.00%), Postives = 144/297 (48.48%), Query Frame = 3
Query: 4491 LSAKSPKRKKDEDEVLNVLDLTLMDE-------------------DIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLL---YRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDE 5315
            +S   PK K D  E    LDL + +E                    +DWWS+YYAS+ ++ +   Y +   + +++++  LE++  YN F+DF   F      +G   D EE+   GE K    I  L +      P   +   +    P  C+VRVYII+A  L  N   G  D YV++  GK+ +  K +Y   C  P FG   ++   +P++KDL+I V     + SD  IG T IDLENR LTK+RAT GL   + + G  +WRD   P EILK +C K  +  P  ++   E
Sbjct: 1108 VSHIVPKVKSDHAERWEQLDLVITEEFDQIIRMVRVPTLTTDPMVPLDWWSRYYASMSQFHRSPGYPESGMEYVRIFRRPLEQMNGYNNFSDFLDTFPFVKSMKGDFDDPEEKEKAGELKCRLLISKLKKG----KPPAAINTVVDFVGPTRCLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPKIESRQTE 1400          

HSP 2 Score: 140.969 bits (354), Expect = 7.511e-33
Identity = 173/762 (22.70%), Postives = 311/762 (40.81%), Query Frame = 3
Query:  849 ETISFEIFNSRKLRSDAL----IGSFKFDLSMIYEEPKHNYMNKWLLLS-------DPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVK-------YNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPR--EFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVD-----SPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKI---IDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIR----KEALRVREEATSVE-QALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA-SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDI-VLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGG 3029
            E ++ ++   R +R  AL    +G F   LS +   P  + + KW+ L        +P+D      G+LK   ++    +  P+      +E           +G  L   T  +RV+  E L          I+++      KK+    Y++ Q    + +T+++        N    ++ +E+ + +Q+P++   I   LFD  +      IG A + +  I   G+ G+LPTFGP F+N F   R   FS    +       + +G  + GRL + +   ++   +   +I+ ++   +++++   +  ++  +  F S S +  ++      PV   +SIG++G+  +E  S +SST       +DG  Y  +PWGN +P   V+  WE +  R+   N  +K+   +D M+  + +I    KA           +   +  I   SK L       S    LD ++   R  ++  +R    KEA  +      V+ + L  L    +    L+ + Q ++P V+I M++  K   + +IP  ++  S++    G +CG  + IN++ P+L D         A L  K+W G+     +W +     ++    E YE Q   L  +W   A +          G+ E   E +    GW   G W +     +F  K  G     +  F  + R   G W     ++TD   D    PKD+     GWE     Q       DE+GW Y+      G
Sbjct:   26 EKLAAKVLTLRLVRPTALGESSVGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDESPPTLIDDDGKEQIW--------SGAHLIDYTLKIRVFSVEQL----------IRQMINERKIKKKQ-RFYVMVQCGAHKTETTMESAFLDEDANIASVKFEQEIYLPIQWPTVISEIIFSLFD-KKGRGKTCIGKATLPMKMIYEPGETGYLPTFGPAFLNVFDCERVTRFSIFSRKMRG---SQQDGSRFVGRLFIAID-CVEYMEKANAQIMHLDHSPIMEAESICKNLEW--YNCFCSMSGLNMINPQFASDPVCIMMSIGSFGSTSNEFRSCNSSTLPAEPN-WDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRI--GNKAIDHVSSVGMEALECLEQQIDSASKYLGRINPVSS--NALDRHILDYRKEKILKLREHFEKEAFSIDYSDGEVDAKLLRMLLKIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQWPTLVDQRNRKREHVAVLHAKMWFGRTDQLTKWKEHVQPADIRRFMEMYEVQTKGLALKWKDEADIY--------DGKWEKTNE-VPLENGWNAVGHWIVMNTRHMFVPK-LGQHTVHDKAFEIQKRTEDGTWKH--FKYTDCYADEL-KPKDLDKHAKGWEVGSWAQDKFRNNGDEKGWVYSTNGVFFG 743          

HSP 3 Score: 140.584 bits (353), Expect = 9.835e-33
Identity = 73/186 (39.25%), Postives = 108/186 (58.06%), Query Frame = 3
Query: 5385 FGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNL 5942
             G   + +AL +L  + L  EHVE+RPLFS      ++G+L+ ++DIFP     I  PF I PRKP +YQLRI V + +  I    +   E +SD+YVK ++ G+ +  +TD H+R LDG G FNWRF+  F Y P E  ++   K  F+     E+ +    V+++WD +KF  D  LG +EL+L
Sbjct: 1507 MGSQLQTIALFILRQMNLVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRS-FAEPVSDLYVKAFINGMTKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFC-KPVEELVDPILVIELWDKNKFRKDRLLGDIELDL 1690          

HSP 4 Score: 102.834 bits (255), Expect = 2.415e-21
Identity = 83/276 (30.07%), Postives = 127/276 (46.01%), Query Frame = 3
Query: 3462 RLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGN-RDAGELLAAFELYLQTDKPL-PFTPPKRGNI---FCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTD-IXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTY 4271
            R++    +  KWQLR YI    +LL   +   S  + R++F   S+ T  +D +  P W++T++F  + I G    I++ PP V +EV       E+  LG  +  P V     D R    QW+ L   N R  G +LA FELY + DK L P  P  + N      +    RP   +  ++ L WGVRN+ K++L  V  P +   IG        +             ++F +V+LP      PP  I + D R F R+PLVG  +++ +  Y
Sbjct:  834 RVYEYQMQTGKWQLRCYIMWGNDLLPVVKNS-SRAFVRISFAQYSKQTLLVDNSQNPIWNETVMFKSVLIAGGTRDIMKYPPVVSVEVVGECSNNEEANLGHFETKPNVICGNTDVRG-TPQWFPLKFSNGRTRGAVLACFELYSEEDKDLIPLEPKCKHNYKERSEIPTEFRPQFDKFHVQFLCWGVRNLKKHKLLAVRRPFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVILPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKY 1107          
BLAST of Fer-1-related vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 157.147 bits (396), Expect = 9.100e-38
Identity = 98/297 (33.00%), Postives = 144/297 (48.48%), Query Frame = 3
Query: 4491 LSAKSPKRKKDEDEVLNVLDLTLMDE-------------------DIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLL---YRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDE 5315
            +S   PK K D  E    LDL + +E                    +DWWS+YYAS+ ++ +   Y +   + +++++  LE++  YN F+DF   F      +G   D EE+   GE K    I  L +      P   +   +    P  C+VRVYII+A  L  N   G  D YV++  GK+ +  K +Y   C  P FG   ++   +P++KDL+I V     + SD  IG T IDLENR LTK+RAT GL   + + G  +WRD   P EILK +C K  +  P  ++   E
Sbjct: 1108 VSHIVPKVKSDHAERWEQLDLVITEEFDQIIRMVRVPTLTTDPMVPLDWWSRYYASMSQFHRSPGYPESGMEYVRIFRRPLEQMNGYNNFSDFLDTFPFVKSMKGDFDDPEEKEKAGELKCRLLISKLKKG----KPPAAINTVVDFVGPTRCLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPKIESRQTE 1400          

HSP 2 Score: 140.969 bits (354), Expect = 7.511e-33
Identity = 173/762 (22.70%), Postives = 311/762 (40.81%), Query Frame = 3
Query:  849 ETISFEIFNSRKLRSDAL----IGSFKFDLSMIYEEPKHNYMNKWLLLS-------DPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVK-------YNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPR--EFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVD-----SPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKI---IDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIR----KEALRVREEATSVE-QALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA-SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDI-VLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGG 3029
            E ++ ++   R +R  AL    +G F   LS +   P  + + KW+ L        +P+D      G+LK   ++    +  P+      +E           +G  L   T  +RV+  E L          I+++      KK+    Y++ Q    + +T+++        N    ++ +E+ + +Q+P++   I   LFD  +      IG A + +  I   G+ G+LPTFGP F+N F   R   FS    +       + +G  + GRL + +   ++   +   +I+ ++   +++++   +  ++  +  F S S +  ++      PV   +SIG++G+  +E  S +SST       +DG  Y  +PWGN +P   V+  WE +  R+   N  +K+   +D M+  + +I    KA           +   +  I   SK L       S    LD ++   R  ++  +R    KEA  +      V+ + L  L    +    L+ + Q ++P V+I M++  K   + +IP  ++  S++    G +CG  + IN++ P+L D         A L  K+W G+     +W +     ++    E YE Q   L  +W   A +          G+ E   E +    GW   G W +     +F  K  G     +  F  + R   G W     ++TD   D    PKD+     GWE     Q       DE+GW Y+      G
Sbjct:   26 EKLAAKVLTLRLVRPTALGESSVGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDESPPTLIDDDGKEQIW--------SGAHLIDYTLKIRVFSVEQL----------IRQMINERKIKKKQ-RFYVMVQCGAHKTETTMESAFLDEDANIASVKFEQEIYLPIQWPTVISEIIFSLFD-KKGRGKTCIGKATLPMKMIYEPGETGYLPTFGPAFLNVFDCERVTRFSIFSRKMRG---SQQDGSRFVGRLFIAID-CVEYMEKANAQIMHLDHSPIMEAESICKNLEW--YNCFCSMSGLNMINPQFASDPVCIMMSIGSFGSTSNEFRSCNSSTLPAEPN-WDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRI--GNKAIDHVSSVGMEALECLEQQIDSASKYLGRINPVSS--NALDRHILDYRKEKILKLREHFEKEAFSIDYSDGEVDAKLLRMLLKIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQWPTLVDQRNRKREHVAVLHAKMWFGRTDQLTKWKEHVQPADIRRFMEMYEVQTKGLALKWKDEADIY--------DGKWEKTNE-VPLENGWNAVGHWIVMNTRHMFVPK-LGQHTVHDKAFEIQKRTEDGTWKH--FKYTDCYADEL-KPKDLDKHAKGWEVGSWAQDKFRNNGDEKGWVYSTNGVFFG 743          

HSP 3 Score: 140.584 bits (353), Expect = 9.835e-33
Identity = 73/186 (39.25%), Postives = 108/186 (58.06%), Query Frame = 3
Query: 5385 FGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNL 5942
             G   + +AL +L  + L  EHVE+RPLFS      ++G+L+ ++DIFP     I  PF I PRKP +YQLRI V + +  I    +   E +SD+YVK ++ G+ +  +TD H+R LDG G FNWRF+  F Y P E  ++   K  F+     E+ +    V+++WD +KF  D  LG +EL+L
Sbjct: 1507 MGSQLQTIALFILRQMNLVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRS-FAEPVSDLYVKAFINGMTKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFC-KPVEELVDPILVIELWDKNKFRKDRLLGDIELDL 1690          

HSP 4 Score: 102.834 bits (255), Expect = 2.415e-21
Identity = 83/276 (30.07%), Postives = 127/276 (46.01%), Query Frame = 3
Query: 3462 RLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGN-RDAGELLAAFELYLQTDKPL-PFTPPKRGNI---FCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTD-IXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTY 4271
            R++    +  KWQLR YI    +LL   +   S  + R++F   S+ T  +D +  P W++T++F  + I G    I++ PP V +EV       E+  LG  +  P V     D R    QW+ L   N R  G +LA FELY + DK L P  P  + N      +    RP   +  ++ L WGVRN+ K++L  V  P +   IG        +             ++F +V+LP      PP  I + D R F R+PLVG  +++ +  Y
Sbjct:  834 RVYEYQMQTGKWQLRCYIMWGNDLLPVVKNS-SRAFVRISFAQYSKQTLLVDNSQNPIWNETVMFKSVLIAGGTRDIMKYPPVVSVEVVGECSNNEEANLGHFETKPNVICGNTDVRG-TPQWFPLKFSNGRTRGAVLACFELYSEEDKDLIPLEPKCKHNYKERSEIPTEFRPQFDKFHVQFLCWGVRNLKKHKLLAVRRPFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVILPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKY 1107          
BLAST of Fer-1-related vs. Ensembl Celegans
Match: ferl-1 (FER-1 Like [Source:UniProtKB/TrEMBL;Acc:O01596])

HSP 1 Score: 110.153 bits (274), Expect = 9.252e-24
Identity = 155/679 (22.83%), Postives = 281/679 (41.38%), Query Frame = 3
Query: 1155 TLRVYRAEDLPRMDSD------ILEGIKKVFTSDAAKKELVDP---------YMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVD-----SPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKI---IDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELD-LNLNTLRTNELGNIRKEALRVRE----EATSVEQALNDLES----FCNQLRNLSGE----PQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSS----GRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDI-VLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASM--GGFVP--VEKMYH 3056
            TL VYR ++ P    D      I  GI+ VF+ +   +++++          Y++ Q    + KT++    +    +E+  I          I   LFD  +      IG A + +  I   G  G+LPTFGP F+N F   R  S        +   + +G  + GRL + +   ++   +   +I+ ++   +++++   +  K+  +  F S S++  +D      PV   +SIG++G+  +E    +SST        +     F  WGN +P   V+  WE +  R+   N  +K+   +D M+S +  I     ++   ++ A   I + + L           E+    L  ++ +N N L  + L   +++ L++RE    EA S++ +  ++++       Q+R+++ E     Q ++P V+I M++  K   + +IP  ++  S++    G +CG  + IN++ P+L D         A L  K+W G+     +W +     ++      YE Q        T+ P +    W D S    G+    KE       W   G W +      F  K  G     +  F  + R   G W     Q+TD   D    PKD+     GW+     Q       DE+G  Y+        G +P   EK++H
Sbjct:  224 TLSVYRIDESPPTLIDDGGKEQIWSGIR-VFSVEQLIRKMINERKIKKKQRFYVMVQCGAHKTKTTM----ESAFLDEDANIA--------SIIFSLFD-KKGRGKTCIGKATLPMKMIYEPGVAGYLPTFGPAFLNVFDCER-VSRFSIFSRKMRGSQLDGSRFVGRLFIAID-CVEYMEKANAQIMHLDYSQIMEAESICKNLKW--YNCFCSMSLVNKIDPQFASDPVCIMMSIGSFGSTSNEDKKCNSSTVPTYPERDEHECCSF-AWGNLRPVAEVNAPWEVIDRRIEMSNVLMKMTNMLDSMISEIRHI-----SSGAVDQIASVGIESLECLEQQI-------ESASKFLRRINHVNSNALDRHILDYRKEKILKLREHFEKEAFSIDYSDGEVDAKLLRMLLQIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQWPTLVDQRNRKREHVAVLHAKMWFGRTDQLTKWKEHVQPADIERFIVLYEVQ--------TKEPTLK---WKDESDIYDGKWVKTKEVPPLENEWNAVGPWIVMNTRQTFVPK-LGQHTAHDKAFEIQKRAETGTWKH--FQYTDCYADEL-KPKDLDKHVKGWQVGSWDQDKFRNNGDEKGCVYSTNGVFIGSGVLPDREEKVHH 856          
BLAST of Fer-1-related vs. Ensembl Celegans
Match: snt-5 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:O16700])

HSP 1 Score: 64.6994 bits (156), Expect = 3.800e-10
Identity = 44/118 (37.29%), Postives = 66/118 (55.93%), Query Frame = 3
Query:   72 TNEMSGMNVTVINATNLINMELVGKSDPYVLIE--FQGQKKKTKEIG---ENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSI----DVPLRDLAGGKTEVQLTLN 398
            +N+   + + V  A NL  M++ G SDPYV IE  F G++ K+K+      NLNP + E L FD+  + +  T++L ++VMD ++IG D L+G      D P  D   GKT+    LN
Sbjct:  243 SNQEEKLYINVSKAYNLRPMDITGASDPYVKIEQTFNGKRFKSKKSSTKRANLNPVFHETLVFDIPSSQIAETNIL-IQVMDWDRIGKDDLLGCCILGKDSPTAD---GKTQWDNCLN 356          
BLAST of Fer-1-related vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273291)

HSP 1 Score: 289.656 bits (740), Expect = 2.004e-83
Identity = 208/617 (33.71%), Postives = 319/617 (51.70%), Query Frame = 3
Query: 4548 DLTLMDE-DIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRG---KNLDDEEEASVGEFKGTFRIYP--------------LPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEV--VYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVL-NM--LP-----LTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYND-----ETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWY 6299
            D  L++E +  WW+K+Y S+  W       +  +  L +Y  ELE+   +    D+     L  G   K     +E      K   ++ P              +  N++  +  ++        + ++ +VRVY+++ + ++P D  G +D YV++ LG K  +++  + PN   P FGR+FE++  LP    L++ V D+D +  D+VIG+T IDLE+R+ T+ RAT GL   Y  SG N W D   P+EIL   C+K  I  P Y  N  EV  +  G         E             ERL+L VL NM  LP     L  EHVETR L     P +EQGKLQ WI++F A++  +  P +ITP  P  +++R++V N   +   D+N+ G+ MSD+YV GW    D+RQ TD+HYRS  G+  FNWR VF  +Y P E++M++++K     L+E E + P    LQ+WD D  + D++L  LELNL+ M AP   ++ C            + K INLF+ +   G++P  ++      +  A   GK+++ +E+ T+ EA  +PAG G+D       LEPP RPD+SF   T P K+F+ I+W   + Y
Sbjct:   28 DHELVEEREFTWWTKFYNSM-YWSAAEMCHEHKH-RLVIYYEELEKQAQFGYLQDWAVPVQLVHGVKFKKHGPPKEDIYATLKLQLKLTPCQCPVLEDPGGGGDMVRNMSNPIHPRHQSTLQSLGETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKIK-DEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYGNVIEVDGMLFGDETLISKDEELQ-----------ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANI-YVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMSDVYVIGWCEDEDKRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL--LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPYP-------KKRKRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQD---PPMALEPPYRPDSSFNPLTHPCKSFQHILWPVIRKY 617          
BLAST of Fer-1-related vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273287)

HSP 1 Score: 290.041 bits (741), Expect = 4.555e-79
Identity = 205/611 (33.55%), Postives = 315/611 (51.55%), Query Frame = 3
Query: 4563 DEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRG---KNLDDEEEASVGEFKGTFRIYP--------------LPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEV--VYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVL-NM--LP-----LTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYND-----ETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWY 6299
            + +  WW+K+Y S+  W       +  +  L +Y  ELE+   +    D+     L  G   K     +E      K   ++ P              +  N++  +  ++        + ++ +VRVY+++ + ++P D  G +D YV++ LG K  +++  + PN   P FGR+FE++  LP    L++ V D+D +  D+VIG+T IDLE+R+ T+ RAT GL   Y  SG N W D   P+EIL   C+K  I  P Y  N  EV  +  G         E             ERL+L VL NM  LP     L  EHVETR L     P +EQGKLQ WI++F A++  +  P +ITP  P  +++R++V N   +   D+N+ G+ MSD+YV GW    D+RQ TD+HYRS  G+  FNWR VF  +Y P E++M++++K     L+E E + P    LQ+WD D  + D++L  LELNL+ M AP   ++ C            + K INLF+ +   G++P  ++      +  A   GK+++ +E+ T+ EA  +PAG G+D       LEPP RPD+SF   T P K+F+ I+W   + Y
Sbjct:  737 EREFTWWTKFYNSM-YWSAAEMCHEHKH-RLVIYYEELEKQAQFGYLQDWAVPVQLVHGVKFKKHGPPKEDIYATLKLQLKLTPCQCPVLEDPGGGGDMVRNMSNPIHPRHQSTLQSLGETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKIK-DEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYGNVIEVDGMLFGDETLISKDEELQ-----------ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANI-YVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMSDVYVIGWCEDEDKRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL--LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPYP-------KKRKRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQD---PPMALEPPYRPDSSFNPLTHPCKSFQHILWPVIRKY 1320          
BLAST of Fer-1-related vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273290)

HSP 1 Score: 289.656 bits (740), Expect = 9.741e-79
Identity = 205/611 (33.55%), Postives = 315/611 (51.55%), Query Frame = 3
Query: 4563 DEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRG---KNLDDEEEASVGEFKGTFRIYP--------------LPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEV--VYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVL-NM--LP-----LTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYND-----ETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWY 6299
            + +  WW+K+Y S+  W       +  +  L +Y  ELE+   +    D+     L  G   K     +E      K   ++ P              +  N++  +  ++        + ++ +VRVY+++ + ++P D  G +D YV++ LG K  +++  + PN   P FGR+FE++  LP    L++ V D+D +  D+VIG+T IDLE+R+ T+ RAT GL   Y  SG N W D   P+EIL   C+K  I  P Y  N  EV  +  G         E             ERL+L VL NM  LP     L  EHVETR L     P +EQGKLQ WI++F A++  +  P +ITP  P  +++R++V N   +   D+N+ G+ MSD+YV GW    D+RQ TD+HYRS  G+  FNWR VF  +Y P E++M++++K     L+E E + P    LQ+WD D  + D++L  LELNL+ M AP   ++ C            + K INLF+ +   G++P  ++      +  A   GK+++ +E+ T+ EA  +PAG G+D       LEPP RPD+SF   T P K+F+ I+W   + Y
Sbjct:  825 EREFTWWTKFYNSM-YWSAAEMCHEHKH-RLVIYYEELEKQAQFGYLQDWAVPVQLVHGVKFKKHGPPKEDIYATLKLQLKLTPCQCPVLEDPGGGGDMVRNMSNPIHPRHQSTLQSLGETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKIK-DEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYGNVIEVDGMLFGDETLISKDEELQ-----------ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANI-YVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMSDVYVIGWCEDEDKRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL--LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPYP-------KKRKRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQD---PPMALEPPYRPDSSFNPLTHPCKSFQHILWPVIRKY 1408          
BLAST of Fer-1-related vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273289)

HSP 1 Score: 290.041 bits (741), Expect = 1.537e-78
Identity = 206/611 (33.72%), Postives = 316/611 (51.72%), Query Frame = 3
Query: 4563 DEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRG---KNLDDEEEASVGEFKGTFRIYP--------------LPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEV--VYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVL-NM--LP-----LTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYND-----ETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWY 6299
            + +  WW+K+Y S+  W       +  +  L +Y  ELE+   +    D+     L  G   K     +E      K   ++ P              +  N++  +  ++        + ++ +VRVY+++ + ++P D  G +D YV++ LG K  +++  + PN   P FGR+FE++  LP    L++ V D+D +  D+VIG+T IDLE+R+ T+ RAT GL   Y  SG N W D   P+EIL   C+K  I  P Y  N  EV  +  G         E             ERL+L VL NM  LP     L  EHVETR L     P +EQGKLQ WI++F A++  +  P +ITP  P  +++R++V N   +   D+N+ G+ MSD+YV GW    D+RQ TD+HYRS  G+  FNWR VF  +Y P E++M++++K     L+E E + P    LQ+WD D  + D++L  LELNL+ M AP   ++ C         P  + K INLF+ +   G++P  ++      +  A   GK+++ +E+ T+ EA  +PAG G+D       LEPP RPD+SF   T P K+F+ I+W   + Y
Sbjct: 1033 EREFTWWTKFYNSM-YWSAAEMCHEHKH-RLVIYYEELEKQAQFGYLQDWAVPVQLVHGVKFKKHGPPKEDIYATLKLQLKLTPCQCPVLEDPGGGGDMVRNMSNPIHPRHQSTLQSLGETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKIK-DEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYGNVIEVDGMLFGDETLISKDEELQ-----------ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANI-YVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMSDVYVIGWCEDEDKRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL--LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKP------YPKKR-KRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQD---PPMALEPPYRPDSSFNPLTHPCKSFQHILWPVIRKY 1616          

HSP 2 Score: 56.225 bits (134), Expect = 4.315e-7
Identity = 76/359 (21.17%), Postives = 132/359 (36.77%), Query Frame = 3
Query:  642 SYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNS------GAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTL--RVYRAEDLPR--MDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTS----------------VKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTAL 1640
             ++  PQ+F I I V +A Q+         ++      K TK   +T +P +N  F F FH +  EL   TI FE+      + + ++G    DL  ++ +  H Y  KW  L  P   N          GYL+   AI+                              Q  P ++ L       ++L +  +D D  +  K + T+          Y +  + G  IK S                V  N+  P WN E+     +PS+ +R  + +F  + + +   +    + L  IA  G     P+ GP +++              ++ +N      + Y GRL++EL + +
Sbjct:    7 CFAGAPQEFLICITVHKAAQVGVTTGELYVRISLDKMTKSTKSFPNTENPFFNEYFVFEFHCTLTELLRLTILFELKKHMTYKKNVVVGELLVDLHSVWNQSNHGYFKKWGRLEAPIGENQTLENAVAPHGYLQLDLAIVS-----------------------------QHSPVSYALGSEEQDTQNLNKWTVDHDFDDIEKNLLTNVNIFAPSNIRYFVAFYRGYFIKQSNYMIQVSFAGFNGKTPVVKNTTTPVWNYEINFAWMYPSVAQRFLILIFAHEHL-QWKCVAEFELCLEEIAFNGT----PSLGPTYLHL-------------YDPVN-----PMIYVGRLLMELRSEM 313          
BLAST of Fer-1-related vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273285)

HSP 1 Score: 281.567 bits (719), Expect = 1.553e-77
Identity = 189/572 (33.04%), Postives = 294/572 (51.40%), Query Frame = 3
Query: 4563 DEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRG---KNLDDEEEASVGEFKGTFRIYP--------------LPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEV--VYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVL-NM--LP-----LTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYND-----ETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRD 6182
            + +  WW+K+Y S+  W       +  +  L +Y  ELE+   +    D+     L  G   K     +E      K   ++ P              +  N++  +  ++        + ++ +VRVY+++ + ++P D  G +D YV++ LG K  +++  + PN   P FGR+FE++  LP    L++ V D+D +  D+VIG+T IDLE+R+ T+ RAT GL   Y  SG N W D   P+EIL   C+K  I  P Y  N  EV  +  G         E             ERL+L VL NM  LP     L  EHVETR L     P +EQGKLQ WI++F A++  +  P +ITP  P  +++R++V N   +   D+N+ G+ MSD+YV GW    D+RQ TD+HYRS  G+  FNWR VF  +Y P E++M++++K     L+E E + P    LQ+WD D  + D++L  LELNL+ M AP   ++ C            + K INLF+ +   G++P  ++      +  A   GK+++ +E+ T+ EA  +PAG G+D
Sbjct:  490 EREFTWWTKFYNSM-YWSAAEMCHEHKH-RLVIYYEELEKQAQFGYLQDWAVPVQLVHGVKFKKHGPPKEDIYATLKLQLKLTPCQCPVLEDPGGGGDMVRNMSNPIHPRHQSTLQSLGETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKIK-DEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYGNVIEVDGMLFGDETLISKDEELQ-----------ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANI-YVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMSDVYVIGWCEDEDKRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL--LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPYP-------KKRKRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQD 1037          
BLAST of Fer-1-related vs. Ensembl Zebrafish
Match: myof (myoferlin [Source:ZFIN;Acc:ZDB-GENE-040426-1138])

HSP 1 Score: 1597.79 bits (4136), Expect = 0.000e+0
Identity = 930/2138 (43.50%), Postives = 1315/2138 (61.51%), Query Frame = 3
Query:   90 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEV--QLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTD-SAGAEEDETDNAEIGNSGS-----GPQIKIKKVGKRT-TRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG----------DNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSK-ELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSD-YIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSK-ADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPM-KPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMA-VPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQT---DKPLPFTPPKRGN-IFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASL-LTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKN-LDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQL---QAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            + V V +A +L   +L G  DP   + F+ +KKKT+ I   +NP W+E L FDL G  L  +  + V V D E +G DKL+GS  V L+DLA  + +      L L+D+N +   G +++ V Y+PP  A                +DQ D + G +  E +  ++ ++GS      P    +K+  R+  R + + KPQDFQIR++V+E RQL G NI PV KV    +  +T+++   N+P ++  FFFN ++  +ELFDE ISF ++N+   R+D L+G FK D+  IY+E  H  M KW+LL+DP+D +SGAKGYLK    ++G GDE P     +  + D++E+NLL PAGV LR  T  L+V+RAED+P+MD  I + +K+ F  +  KK LVDP++   FAGK++ T +   + +PEWN++L + ++FPSMCERIKL ++DWDR+T +D +GT  +DL+ IA+ G          + GFLPTFGPC+IN +GS REFS LPD ++ LN GKGEG AYRGR++VELST LD   ++  E   I+ D +L  QK+ RRRKY L A F SA+MI     P++FEVSIGNYGNK+D T  P +STTQ + A+FDG  Y++LPWG++KP   V   WE++S RL ++N  L I + + +N+  +K A+++   +    +  +   + L+   S  ++P  E G+  LT LD+ +  LR   L  I + A R+ EEAT V + L  +E +  +LR L+ EPQNSMPD+ IWM+ G+KR  Y RIPA+ VL+S+  +   G++CG  QT+ ++ P   DS+     IP ++R+ +WLG   +E  +++   EG  ++ AE YENQA ++G+W T   ++ R  +SD +G+++L  E   PP GW W+GDW + PE +L  + DAG ++++++V+ NE R PGG W  +   +TD+ G+    PK+I  PSGW WED W  D+NR  DE GWEY +    +     +V  EKMYH+       R      +K+    ++  K   + E WEY+ L   +FH ++R +D  RRRRW RKM P  + G  AIF L                      E  + VD E+E+         K  K + ++K   A  P +   F +++ + LR Y+YQARNL A DQ  FSDPY  V+FL+ SQ TE I   L PTWDQTLIF  +EI+GDP ++V+  P V++E+FD DQ+G+DE LGR    P+VK        P L W  +T  N  AGE+L A EL L+T   D  LP  PPKRG+ ++ V  G+RP++Q T IE+L+WG+RNM  YQLA VTSP +  E GG  +QT +IKN    PNF   +LFL VLLPKEE+Y PP  +KV D+R FGRKP+VG   + S++ +R  P +  + + ++   +L  +S G      D+  ++L                                    L A+  K K                E +DWWSK+YASLG+  KC  Y D  YDTL+VY+ ELE V+ +   TDFC  F L RGKN +DDE+   VGEFKG+F +YPLP++     P +   + LP S   EC+VR+Y+++ IDLQP D +G  DPY+++ LGKK + ++D+Y+P  L P FGRMFE+ C LP  KDL+I V D+D +S D+ +GET IDLENRFL+ F + CGL QTYCISGPN+WRD  KP++IL+       + PP  + N + + + GQ  + LS FE N + + H GP +ER+ALHVL    L  EHVETR L+S  QP + QGKLQ W+DIFP S+   G PF+I+PRK K Y LR+IVWNT DV+L+++++ GE MSDIYVKGW+ G++E +Q+TDVHYRSLDG+GNFNWRFVF F YLP E +  + KKEHFWSLD++E R+P    +QIWDNDKFS DD+LG +EL+L  + +P+K S++C L+ L    A   + Q K  +LF+ +   G+WPCY ++ G  EL GK+E+ LE++ E+EA  +PAG GRDEPN NPKL+PP RP+TSF WFT+P KT KFI+W+ FKW FIG +++ LV L + +  YS+P   + K+V
Sbjct:    2 LRVAVESAADLPKKKL-GSPDPIASLVFRDEKKKTRSINNEVNPVWNETLQFDLKGVPLDSSSYIDVIVKDYETLGKDKLIGSAKVSLKDLASSQVKSLPVKNLTLVDENGKSIGGTISMTVGYEPPAGAGANP------------LDQQDGNVGGDTAEGEAGDVPDAGSRGAFTSPGEPGQKLQLRSRNRNNLANKPQDFQIRVRVIEGRQLPGNNIKPVVKVHVCGETHRTRIRKG-NNPYFDEIFFFNINMLPSELFDEVISFRVYNASSFRADCLMGEFKLDIGYIYDEQAHCIMKKWILLNDPDDSSSGAKGYLKVSMFVVGTGDEPPVEKKEQDSDKDDVESNLLLPAGVALRWVTLKLKVFRAEDIPQMDDSITQSLKEAFGGEGNKKNLVDPFVEAWFAGKKLCTQIIEKNANPEWNQQLNLQVKFPSMCERIKLTVYDWDRLTRNDTVGTTYLDLTKIASSGGESEGDTGESEMGFLPTFGPCYINLYGSLREFSGLPDPYDDLNLGKGEGAAYRGRILVELSTKLDGKADKSVE--EISSDDILVVQKYQRRRKYCLCAVFHSATMIQEPGEPIQFEVSIGNYGNKMDLTCKPLASTTQYSCAVFDGNNYYYLPWGDTKPVVAVTSFWEDISHRLDSLNILLYISNHLQTNISALKFAVQSKATDARLVEIWLKLINQLMEDISSLKIPDLE-GKPNLTSLDIQIKKLRDKALEGIMEGAKRLFEEATDVNKCLTIIEGWLEKLRQLAEEPQNSMPDINIWMLRGEKRIAYTRIPAHQVLFSSYCEQACGQYCGKTQTVFMQYP--MDSK-NGLKIPVKIRVNMWLGLATEEKNFNQY-AEGMFNVFAELYENQAQVLGKWGTTG-LLNRSKFSDVTGKIKLKHEYFMPPVGWEWEGDWSVDPEKALLTEADAGHTEFVDEVYENETRFPGGEWKLATETYTDVNGEKVLGPKEIECPSGWTWEDNWTFDVNRAVDERGWEYGITIPPDEKPKSWVACEKMYHV----HRRRRMIRPRKKIPGAKTADKKDTGNAEGWEYSSLIGWKFHRQQRSSDTFRRRRWRRKMAPAGRVGASAIFKL----------------------EGALGVDMESEE---------KGTKADSSVKQFGANTPMISCTFDRSNAYHLRVYVYQARNLTALDQDSFSDPYVHVSFLHHSQTTETIQSNLNPTWDQTLIFKNVEIYGDPQSLVQNSPVVVMEIFDRDQVGKDEMLGRSTCVPLVKLASGMDGSPKLLWEPVTHKNASAGEILVAAELILKTKGNDTELPLVPPKRGDSLYMVPQGVRPVVQLTAIEVLAWGLRNMKMYQLAPVTSPCLVVECGGERVQTAVIKNMKKCPNFQGNVLFLKVLLPKEEMYTPPIVLKVIDHRPFGRKPVVGQCTITSLEEFRCDPYVTVSEVAMSSKVSLMAASPGHLSVNIDDSRQQL------------------------------------LEAQREKEK----------------ETVDWWSKFYASLGQSEKCRPYLDKGYDTLEVYEHELENVKEFMGLTDFCKTFKLQRGKNEIDDEDPNVVGEFKGSFMVYPLPDDPTVLAPPRQFRE-LPDSVSQECVVRIYVVQGIDLQPKDNNGKCDPYIKISLGKKSVDDRDNYMPLTLNPVFGRMFEITCFLPQDKDLKIAVYDFDLLSRDEKVGETVIDLENRFLSHFGSNCGLAQTYCISGPNQWRDQLKPSQILEHHARWKGLSPPRSEDNGNTLSFNGQL-YSLSDFEANKEIHEHLGPPSERIALHVLRTQGLVPEHVETRTLYSSFQPTLPQGKLQMWVDIFPKSLGAPGPPFDISPRKAKKYFLRVIVWNTTDVVLDEKSITGENMSDIYVKGWMQGMEEDKQKTDVHYRSLDGDGNFNWRFVFGFDYLPTEQLCHISKKEHFWSLDKSEFRIPPKLTVQIWDNDKFSLDDYLGAVELDLHHLISPSKSSEKCSLSMLPDGPAHPKSDQYK--SLFDQKSVRGWWPCYMEKDGKKELGGKVELTLEIVNEKEADERPAGKGRDEPNMNPKLDPPKRPETSFFWFTNPCKTCKFIVWRRFKWLFIGLVVLILVLLFLGILFYSLPNYISMKIV 2026          
BLAST of Fer-1-related vs. Ensembl Zebrafish
Match: dysf (dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) [Source:ZFIN;Acc:ZDB-GENE-070501-1])

HSP 1 Score: 1584.7 bits (4102), Expect = 0.000e+0
Identity = 959/2194 (43.71%), Postives = 1323/2194 (60.30%), Query Frame = 3
Query:  111 ATNLINMELVGK-SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXID-------QTDSAGAEEDET----DNAEIGNSGSGPQIK-------------------IKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN-------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVRE-EATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWED-EWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPM-KPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP----------------------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEAS-VGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMVGV*ISGIDK 6416
            ATNL N+E   + SDP   I F+G KKKTK I  N+NP W+E   +DL G  L     L V V D EK+G ++ +G   V LRD L         T++L+D  +  T   + L+V Y PP       Q   Q +   T ++         D+ G ++ E+    + AE      GPQ +                   +KK  +++ +   S K QD Q+R++++E RQL G NI PV KV    Q K+T++K   N+P ++ +FF NF    ++LFDE I   +F+S+ LR D++IG FK D+ M+Y E +H  + KWLLL+DP+D ++GA+GYLK    +L  GDE P       EE ++IE NLLRPAG+ LR ATFTLRVYRAEDLP+MD  +++ +K     D  +K LVDP +   FAGK I + +     +P+WN+ L + ++FPSMCE++++++ DWDR + +D+IGTA + +S I+A G +       GFLPTFGPCF+N +GSPREF+   D  EALN GKGEGVAYRGR+++EL T L +  +Q  E   IN D LL  +KF+R+RK+ L AAF SA+++  VD  V+FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPWGN KP  VV   WE++  R+  +N  L I+D++ SN++++++ +KA   ++E  Q V+   DD+I  CS+ELP  E  + P +T LD  L  LR   +  I + AL ++    T +   L   E +  +LR LS EPQNS+PD++IWM+ G +R  Y+RIPA+ VL+S    Y G+ CG +QT+ +K P  +D   +   IPAQLR+K+W G   D   +++   EG+LS+ AETYENQ   +LVG W T    +T P +SD +GRV+L KE+ KP  GW W G+W+ISPE ++ YD DAG   +LE+VF N+ R+PGG W      +TD+ G+      +I  P GW WED EW  DL R  D++GWEY +    +     +VP EKMYH  RRRR++R R+   +K+           + E WEYA LF  +FH K++KTD+ RRRRW R+M+P+ K G  AIF L                    E       D++ +D            K+     G+ + P +   F     + LR Y+YQAR+LLA D+  FSD YA V+FL+QSQ T  +  TL PTWDQTLIF+++EI GD      +PP +++E++D D  G DEF+GRC   P + + P       L WY + K    AG+LLAAFEL ++ DKP                                        LP+ PP+R  N++ V  GI+P++QRT IEIL+WG+RN+  +QLA+VTSPS++ E GG V+Q+ +I+N   NPNF+  +LF+DV LPKEELYMPP  IKV DNR FGRKP+VG   ++S++ + F P                     E  + D+ EEE   I    +     D ++  D+                  K P     +DE +            DWWSK+YAS+GE  KC  Y +  +D LQVY  ELE+ E + +F DFC  F LYRG+  +D E+ S VGEFKG+F+IYPLP++ +  +P +   K LP +   EC+VR+YII+A  LQP D +G  DPYV++ LGKK + + D+YIP  L P FG+MFEL C LP++KDL+I + DYD ++ D+ IGET IDLENRFL++  A CGLPQ+YC+SG N+WRD  KP+++L + CE+     P YK +    +Y    ++ ++  +     N H GP  ERLAL VL    L  EHVETRPL+SPLQP IEQG+LQ W+D+FP S+   G PF ITPRK K + LR I+WNT+DVIL+D ++ GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRF+FPF YLPAE +  + KKEHFWSLD+ E +LP    +QIWDNDKFS DDFLG+LE++L  M +PAK  ++C L  L      SQ K ++LFE +   G+WPC  D+     L GK+EM LE++ E+E   +PAGLGRDEPN NP LE P RP+TSFLWF+SP+KTF+FI+W+ FKW  +G  I+  + L + +F+Y+ P   A KMVG   SG+ K
Sbjct:    9 ATNLRNVEKGERHSDPLASITFRGTKKKTKVIKNNVNPVWNEGFEWDLKGVPLDSGAELHVVVKDHEKMGRNRFLGECRVALRDVLNSPNLAATFTVSLVDTKRNSTGATITLQVSYIPPPGMTPIFQPPPQPEAQHTPVELDTVTVFSLDTMGEDDTESMLMMEVAEEPEPVPGPQGQDIGAPTAPPKKAPPNFNQGLKKKKRQSNKSPLSDKAQDLQVRLRIIEGRQLPGVNIKPVVKVTVGGQTKRTRIKKG-NNPFFDETFFLNFFEKPSDLFDEPIFITVFDSKSLRKDSVIGEFKLDVGMVYNEHRHAILRKWLLLADPDDLSAGARGYLKVSMFVLAAGDEPPMDKKEGVEEKEDIEANLLRPAGLTLRGATFTLRVYRAEDLPQMDDALIDDVKHFLGFDTNRKNLVDPLVEVNFAGKTISSKILEKCANPQWNQCLTLPIRFPSMCEKMRIRILDWDRASHNDVIGTAHLCMSKISAPGGDIEVDDSIGFLPTFGPCFVNMYGSPREFTAFSDPHEALNLGKGEGVAYRGRVLLELITKLSDQVDQRSE--DINSDDLLVVEKFMRKRKFSLFAAFYSATLLQDVDDAVQFEVSIGNYGNKFDNTCLPLASTTQFSRAVFDGCHYYYLPWGNVKPVVVVSSEWEDIGPRIEALNMLLSIVDRLESNLEQVQLELKARSDDQEVEQRVVQLLDDVIADCSEELP--ELDKWPCVTPLDKALRNLRKINMQQIVQAALALKHGPETELSAVLEQAEDWTMRLRYLSEEPQNSLPDIIIWMLQGDRRVAYHRIPAHQVLFSYG--YCGKHCGQLQTVFMKCPQ-EDGGCSK--IPAQLRIKVWFGLTADVKSFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGRVKLPKESFKPSSGWSWAGEWFISPEKTMLYDADAGHISFLEEVFENQLRLPGGQWIGMPEGYTDVNGEKAVPKDEIECPPGWVWEDIEWSEDLKRAVDDQGWEYGITLPPDRRPKSWVPSEKMYHTNRRRRWIRLRRRDMQKMEALRKQRPDESEREGWEYASLFGWKFHLKQKKTDLFRRRRWRRRMEPLEKTGPAAIFAL--------------------ECSLSSFTDEKNDD------------KSVTTTFGV-SRPTISCFFDSGTLYHLRCYLYQARDLLAMDKDSFSDAYAVVSFLHQSQKTVTVRNTLNPTWDQTLIFYEVEIFGDHLVTERSPPNIVVELYDQDTYGADEFMGRCVCQPSMASSPR------LAWYPIQKAGNSAGDLLAAFEL-IRRDKPAVHHIPGQEGDIIPPSHIMDELVLPGFLSENQQQWPEDSDLPYPPPQREPNVYMVPQGIKPVLQRTAIEILAWGLRNLKSFQLASVTSPSLQVECGGSVVQSCVIRNIKKNPNFDVNILFIDVRLPKEELYMPPLVIKVIDNRQFGRKPVVGQCSVHSLNEFYFQP---------------------ESLERDSTEEEFEVIAHTPRD----DVLVDIDD------------------KEPLIPGQQDEFM------------DWWSKFYASMGERTKCGSYLEKGFDMLQVYDRELEKTEGFEQFADFCQTFKLYRGRTQNDSEDPSVVGEFKGSFKIYPLPDDPSMPVPTRQFRK-LPPNGIEECLVRIYIIQAFGLQPKDANGKCDPYVKITLGKKSVDDHDNYIPCTLEPVFGKMFELTCCLPLEKDLKITLYDYDMVTKDEKIGETIIDLENRFLSRHGARCGLPQSYCLSGINQWRDQLKPSQLLHRLCERRNYKLPVYKQDR---IYFRGHEYTVADLDEGKPLNPHLGPVMERLALLVLRRHGLVPEHVETRPLYSPLQPDIEQGRLQMWVDLFPKSLGPPGPPFNITPRKAKKFFLRCIIWNTRDVILDDVSVTGEKMSDIYVKGWMHGHEENKQKTDVHYRSLGGEGNFNWRFLFPFHYLPAEQLCTIDKKEHFWSLDKVETKLPPKLTIQIWDNDKFSFDDFLGSLEMDLNHMLSPAKSPEKCGLEMLT----QSQDKLVSLFEQKTVKGWWPCVCDKEDKKILAGKVEMSLEIVCEQEQDERPAGLGRDEPNMNPHLEEPQRPETSFLWFSSPYKTFRFIVWRRFKWLILGLFILFFIILFLGVFLYAFPNYAAMKMVGP-FSGLGK 2085          
BLAST of Fer-1-related vs. Ensembl Zebrafish
Match: dysf (dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) [Source:ZFIN;Acc:ZDB-GENE-070501-1])

HSP 1 Score: 1574.3 bits (4075), Expect = 0.000e+0
Identity = 954/2211 (43.15%), Postives = 1324/2211 (59.88%), Query Frame = 3
Query:   90 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXID-------QTDSAGAEEDET----DNAEIGNSGSGPQIK-------------------IKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN------------------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVRE-EATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWED-EWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPM-KPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP----------------------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEAS-VGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMVGV*ISGIDK 6416
            + V ++ A N++  +    SD Y  + ++G KKKTK I  N+NP W+E   +DL G  L     L V V D EK+G ++ +G   V LRD L         T++L+D  +  T   + L+V Y PP       Q   Q +   T ++         D+ G ++ E+    + AE      GPQ +                   +KK  +++ +   S K QD Q+R++++E RQL G NI PV KV    Q K+T++K   N+P ++ +FF NF    ++LFDE I   +F+S+ LR D++IG FK D+ M+Y E +H  + KWLLL+DP+D ++GA+GYLK    +L  GDE P       EE ++IE NLLRPAG+ LR ATFTLRVYRAEDLP+MD  +++ +K     D  +K LVDP +   FAGK I + +     +P+WN+ L + ++FPSMCE++++++ DWDR + +D+IGTA + +S I+A G +                  GFLPTFGPCF+N +GSPREF+   D  EALN GKGEGVAYRGR+++EL T L +  +Q  E   IN D LL  +KF+R+RK+ L AAF SA+++  VD  V+FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPWGN KP  VV   WE++  R+  +N  L I+D++ SN++++++ +KA   ++E  Q V+   DD+I  CS+ELP  E  + P +T LD  L  LR   +  I + AL ++    T +   L   E +  +LR LS EPQNS+PD++IWM+ G +R  Y+RIPA+ VL+S    Y G+ CG +QT+ +K P  +D   +   IPAQLR+K+W G   D   +++   EG+LS+ AETYENQ   +LVG W T    +T P +SD +GRV+L KE+ KP  GW W G+W+ISPE ++ YD DAG   +LE+VF N+ R+PGG W      +TD+ G+      +I  P GW WED EW  DL R  D++GWEY +    +     +VP EKMYH  RRRR++R R+   +K+           + E WEYA LF  +FH K++KTD+ RRRRW R+M+P+ K G  AIF L                    E       D++ +D            K+     G+ + P +   F     + LR Y+YQAR+LLA D+  FSD YA V+FL+QSQ T  +  TL PTWDQTLIF+++EI GD      +PP +++E++D D  G DEF+GRC   P + + P       L WY + K    AG+LLAAFEL ++ DKP                                        LP+ PP+R  N++ V  GI+P++QRT IEIL+WG+RN+  +QLA+VTSPS++ E GG V+Q+ +I+N   NPNF+  +LF+DV LPKEELYMPP  IKV DNR FGRKP+VG   ++S++ + F P                     E  + D+ EEE   I    +     D ++  D+                  K P     +DE +            DWWSK+YAS+GE  KC  Y +  +D LQVY  ELE+ E + +F DFC  F LYRG+  +D E+ S VGEFKG+F+IYPLP++ +  +P +   K LP +   EC+VR+YII+A  LQP D +G  DPYV++ LGKK + + D+YIP  L P FG+MFEL C LP++KDL+I + DYD ++ D+ IGET IDLENRFL++  A CGLPQ+YC+SG N+WRD  KP+++L + CE+     P YK +    +Y    ++ ++  +     N H GP  ERLAL VL    L  EHVETRPL+SPLQP IEQG+LQ W+D+FP S+   G PF ITPRK K + LR I+WNT+DVIL+D ++ GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRF+FPF YLPAE +  + KKEHFWSLD+ E +LP    +QIWDNDKFS DDFLG+LE++L  M +PAK  ++C L  L      SQ K ++LFE +   G+WPC  D+     L GK+EM LE++ E+E   +PAGLGRDEPN NP LE P RP+TSFLWF+SP+KTF+FI+W+ FKW  +G  I+  + L + +F+Y+ P   A KMVG   SG+ K
Sbjct:    2 LRVFILCAQNVLTHD-EDISDAYCTVTYEGTKKKTKVIKNNVNPVWNEGFEWDLKGVPLDSGAELHVVVKDHEKMGRNRFLGECRVALRDVLNSPNLAATFTVSLVDTKRNSTGATITLQVSYIPPPGMTPIFQPPPQPEAQHTPVELDTVTVFSLDTMGEDDTESMLMMEVAEEPEPVPGPQGQDIGAPTAPPKKAPPNFNQGLKKKKRQSNKSPLSDKAQDLQVRLRIIEGRQLPGVNIKPVVKVTVGGQTKRTRIKKG-NNPFFDETFFLNFFEKPSDLFDEPIFITVFDSKSLRKDSVIGEFKLDVGMVYNEHRHAILRKWLLLADPDDLSAGARGYLKVSMFVLAAGDEPPMDKKEGVEEKEDIEANLLRPAGLTLRGATFTLRVYRAEDLPQMDDALIDDVKHFLGFDTNRKNLVDPLVEVNFAGKTISSKILEKCANPQWNQCLTLPIRFPSMCEKMRIRILDWDRASHNDVIGTAHLCMSKISAPGGDIEDEFPARTLHDTMDDSIGFLPTFGPCFVNMYGSPREFTAFSDPHEALNLGKGEGVAYRGRVLLELITKLSDQVDQRSE--DINSDDLLVVEKFMRKRKFSLFAAFYSATLLQDVDDAVQFEVSIGNYGNKFDNTCLPLASTTQFSRAVFDGCHYYYLPWGNVKPVVVVSSEWEDIGPRIEALNMLLSIVDRLESNLEQVQLELKARSDDQEVEQRVVQLLDDVIADCSEELP--ELDKWPCVTPLDKALRNLRKINMQQIVQAALALKHGPETELSAVLEQAEDWTMRLRYLSEEPQNSLPDIIIWMLQGDRRVAYHRIPAHQVLFSYG--YCGKHCGQLQTVFMKCPQ-EDGGCSK--IPAQLRIKVWFGLTADVKSFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGRVKLPKESFKPSSGWSWAGEWFISPEKTMLYDADAGHISFLEEVFENQLRLPGGQWIGMPEGYTDVNGEKAVPKDEIECPPGWVWEDIEWSEDLKRAVDDQGWEYGITLPPDRRPKSWVPSEKMYHTNRRRRWIRLRRRDMQKMEALRKQRPDESEREGWEYASLFGWKFHLKQKKTDLFRRRRWRRRMEPLEKTGPAAIFAL--------------------ECSLSSFTDEKNDD------------KSVTTTFGV-SRPTISCFFDSGTLYHLRCYLYQARDLLAMDKDSFSDAYAVVSFLHQSQKTVTVRNTLNPTWDQTLIFYEVEIFGDHLVTERSPPNIVVELYDQDTYGADEFMGRCVCQPSMASSPR------LAWYPIQKAGNSAGDLLAAFEL-IRRDKPAVHHIPGQEGDIIPPSHIMDELVLPGFLSENQQQWPEDSDLPYPPPQREPNVYMVPQGIKPVLQRTAIEILAWGLRNLKSFQLASVTSPSLQVECGGSVVQSCVIRNIKKNPNFDVNILFIDVRLPKEELYMPPLVIKVIDNRQFGRKPVVGQCSVHSLNEFYFQP---------------------ESLERDSTEEEFEVIAHTPRD----DVLVDIDD------------------KEPLIPGQQDEFM------------DWWSKFYASMGERTKCGSYLEKGFDMLQVYDRELEKTEGFEQFADFCQTFKLYRGRTQNDSEDPSVVGEFKGSFKIYPLPDDPSMPVPTRQFRK-LPPNGIEECLVRIYIIQAFGLQPKDANGKCDPYVKITLGKKSVDDHDNYIPCTLEPVFGKMFELTCCLPLEKDLKITLYDYDMVTKDEKIGETIIDLENRFLSRHGARCGLPQSYCLSGINQWRDQLKPSQLLHRLCERRNYKLPVYKQDR---IYFRGHEYTVADLDEGKPLNPHLGPVMERLALLVLRRHGLVPEHVETRPLYSPLQPDIEQGRLQMWVDLFPKSLGPPGPPFNITPRKAKKFFLRCIIWNTRDVILDDVSVTGEKMSDIYVKGWMHGHEENKQKTDVHYRSLGGEGNFNWRFLFPFHYLPAEQLCTIDKKEHFWSLDKVETKLPPKLTIQIWDNDKFSFDDFLGSLEMDLNHMLSPAKSPEKCGLEMLT----QSQDKLVSLFEQKTVKGWWPCVCDKEDKKILAGKVEMSLEIVCEQEQDERPAGLGRDEPNMNPHLEEPQRPETSFLWFSSPYKTFRFIVWRRFKWLILGLFILFFIILFLGVFLYAFPNYAAMKMVGP-FSGLGK 2094          
BLAST of Fer-1-related vs. Ensembl Zebrafish
Match: myofl (myoferlin like [Source:ZFIN;Acc:ZDB-GENE-111116-2])

HSP 1 Score: 1434.08 bits (3711), Expect = 0.000e+0
Identity = 900/2151 (41.84%), Postives = 1257/2151 (58.44%), Query Frame = 3
Query:   90 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLN--LLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQ----IKIKKVGKRTTRK---SYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNE----ELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG-----------------------DNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQ----FVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSD-YIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPM-KPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQ---TDKPLPFTPPKRG-NIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEAS-VGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            M   V+ +   I  + +G  DP   I F+G+KKKTK I + LNP W+E + FDL G+ L  +  + V V D E IG DK +GS+ + L++LA G+T    + N  L+++ K+     +NL + Y+PP          +  +       +  +A ++ED  D A+ G  G  P      K  K   RTTRK   + + KPQDFQIRI+V+E RQL G NI PV KV    Q  +T+++   N+P ++  F +N ++  +ELFDE+  F I  +  L+                    H  M KWLLL DP+D  SGA+GYLK    I+G GDE P       EE D+IE+NLL PAGV LR AT +L++YRAED+P+MD    + +K +F     KK LVDP++   FAGK++ T +   + +PEWN+    ++K+G    +M   + +          +D+IGT  ++L+ IA+ G                       + GFLP FGPC+IN +GSPREF+ LPD +E LN+GKGEGVAYRGR+++ELST L++  ++  E L  + D++L +QK+ RRRKY L A F SA M+     P++FEVSIGNYGNKLD T  P +STTQ + A+FDG  Y++LPW +SKP  ++   WE++S RL +VN  L I D++ SN+  +K AI A + +   A+     V    DDL    S +LP  E G+  LT LD+ +  LR   + ++++ A+R+REEA  V   + D+E + ++L+ +S EPQNSMPDV+IWM+ G+KR  Y RIPA  VLY+ +S+  IG++CG  QTI ++ P  K+       IP QLR+ +WLG    E +++    EG  S+ AE YENQA + G+W +   +++R  +SD +G+V+L +E   PP+    + +  IS    L  + DAG S++ ++V+ NE R PGG W  +   +TD+ G+   +P++I  P+GW WED W  D NR  DE+GWEY V    +     +V  EKMYH+ RR+R VR R+  +E       +  K D  + WEY+ L   +FH KER +D  RRRRW RKM P  + G  AIFNL                      E  + +D + +            KK +  L G    P +F  F K+  + LR Y+YQARNLL  D+  FSDPY  V+FL+ S+ TE I   L PTWDQTLIF+ IEI+GDP  I   PP V++E++D DQ+G+DE +GRC   P+VK +P +P  P L W+ ++   R AGE+L A EL L+    D  LP  PP+R  N++ V  GIRP++Q T IEIL+WG+RNM  YQLA V+SPS+  E GG +IQT  IKN   NPNF   +LFL VLLPK+E+Y PP  +KV D+R FGRKP+VG   +NS++ +R  P ID                           E  MS      +    D +I   +++ +P                  K++ED V             DWWSK+YAS+ E  KC  Y    YDTL VY TELE V  +   TDFC  F L RGK  D+EE+ S VGEFKG+FR+YPL ++ N   P +   + LP S P EC+VR++II+ +DLQP D +G+ DPY+++ LG+K + ++D Y PN L P+FGR+FEL C +P  KDL+I V DYD +SSD+ +GET IDLENR L++F + CG+P++YC+SG N+WRD  KP++IL+       I  P   ++    +  G R+++L   E N   + H GP  ER+ LHVL    L  EHVETR L+S  QP + QGK+Q W++IFP ++   G   +ITPR+PK Y LR +VWNT +VIL++ ++ GE MSDIYVKG L        T ++   L G G F        Q L    M + K+ EHFWSLD+TE R+P    +QIWDNDKFS DD+LGT+EL+L  +  PAK  ++C L+ L     N  +   +LF  +   G+WPC  +E G   L GK+EM LE++ E+EA  +PAG GRDEPN NPKLE PNRPDTSFLWFT+P KT KFI+W+ +KW FIG II+  V L + + +YS P   + K+V
Sbjct:    1 MLRVVVESAKGIPKKTIGVPDPIAGIIFRGEKKKTKAIDKELNPVWNEIIEFDLKGSPLDSSSFIEVVVKDYETIGKDKFIGSVKISLKELAAGQTRSLASKNTPLINEKKQEIGATINLTIAYEPPASTVPNLNDQNTGEANTKDTGEEKAADSDEDAGDVADSGAPGVSPTGQPGKKDSKKVVRTTRKRQKALANKPQDFQIRIRVIEGRQLPGNNIKPVAKVSVCGQTHRTRIRRG-NNPFFDEIFSYNVNMLPSELFDESFWFMIMFAVSLKG-------------------HAIMRKWLLLGDPDDAVSGARGYLKVSMFIVGTGDEPPVEKREANEEQDDIESNLLLPAGVALRWATLSLKIYRAEDMPQMDDAFAQTVKHIFGGTDDKKNLVDPFVEVNFAGKKVCTKIIEKNANPEWNQLIHLQVKVGRLMITMLHFLDVSF-------SNDVIGTTYLNLTKIASSGGEIEETPSENGLPSSFNVDTTEAEVGFLPAFGPCYINLYGSPREFTGLPDPYEDLNYGKGEGVAYRGRVLIELSTQLNDKTDKKVEDL--SNDNILVAQKYQRRRKYSLCAVFHSACMLQEPGEPIQFEVSIGNYGNKLDSTCKPLASTTQYSCAVFDGNHYYYLPWADSKPVVILTSFWEDISHRLDSVNIILYISDRLQSNIISLKTAILAKVSDARLAEIWLKLVTQVIDDL---SSYQLPDME-GKPNLTALDIQIKNLRDKTMTSVKEAAIRMREEAVDVRATMPDIEDWLDRLQQISEEPQNSMPDVIIWMLRGEKRVAYARIPANQVLYTTHSEQAIGKYCGRTQTIFMQYPMDKNK---GLKIPVQLRVNMWLGLSAHEKKFNTF-AEGTFSVYAEMYENQAQVFGKWGSTG-LVSRHKFSDVTGKVKLKQERFMPPR---INDNCKIS---ILLTEADAGHSEFTDEVYQNETRFPGGEWKSAAEPYTDVNGEKAQSPEEIECPTGWIWEDGWNFDSNRAVDEKGWEYGVTIPPDDKPRSWVAAEKMYHIHRRKRLVRSRRKTSEA-----PTIEKKDIGDGWEYSSLIGWKFHRKERSSDTFRRRRWRRKMAPSERVGASAIFNL----------------------EGALGIDDDEKGS----------KKDSAKLFG-ANTPTVFCRFDKSFSYHLRVYVYQARNLLPMDKDSFSDPYVHVSFLHASKTTEIIKSCLNPTWDQTLIFNDIEIYGDPQTIAYNPPNVVLEIYDSDQMGKDEAMGRCTCPPVVKLNPANPLIPKLFWFPISLKGRSAGEMLVAAELLLKEKANDANLPLVPPRRSENLYMVPQGIRPVVQLTAIEILAWGLRNMKAYQLAAVSSPSLVVECGGQIIQTATIKNIKKNPNFPGSVLFLKVLLPKDEMYTPPIVVKVIDHRPFGRKPVVGQCTINSLEEFRCDPYIDTT-------------------------EVAMSAKVAMMAAAPRDVVIDMGDRIPSPS-----------------KQEEDTV-------------DWWSKFYASINELEKCGPYLQKGYDTLTVYNTELEAVPEFRGLTDFCNTFKLQRGKLEDEEEDPSVVGEFKGSFRVYPLSDDPNISDPPRQFRE-LPESCPQECLVRIHIIRCLDLQPKDNNGMCDPYIKISLGRKTIDDRDHYKPNTLNPDFGRVFELNCYIPQDKDLKISVYDYDLLSSDEKVGETVIDLENRLLSRFGSHCGIPKSYCVSGVNQWRDQLKPSQILQNLARMRGILAPQI-SDDGSFLAFGGREYRLDELEANKSIHPHLGPPKERICLHVLRRQGLVPEHVETRTLYSSYQPTLSQGKIQMWVEIFPKNLGIPGPLCDITPRRPKQYFLRAVVWNTTEVILDETSITGENMSDIYVKGNL------YSTAIYSFFLSGFGAFLTTLFTVAQQL----MHLSKQFEHFWSLDKTEFRIPPKLTIQIWDNDKFSLDDYLGTVELDLLHLIPPAKTPEKCSLSMLTQTGKN--LTPSSLFSQKSVRGWWPCAMEENGKKVLAGKVEMTLEVVEEKEADERPAGKGRDEPNMNPKLESPNRPDTSFLWFTNPCKTMKFIVWRKYKWLFIGLIILIPVILFIGILLYSFPNYLSMKLV 2000          
BLAST of Fer-1-related vs. Ensembl Zebrafish
Match: otofb (otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5])

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 403/1061 (37.98%), Postives = 605/1061 (57.02%), Query Frame = 3
Query: 3444 GLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRC---QITPMVKTHPDDPR-KPVLQWYNLTKGNRDAGELLAAFELYL-----QTDKPLPFTPPK---RGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSD-EQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASL-------------------------------------GEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDD--------EEEASVGEFKGTFRIYPL-PENINEKL---PAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTY----KTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNM---LP-----LTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLL-GEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWP-CYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMVGV 6395
            G+ + P + L++     +QLR ++YQAR+L A D TG SDP+AR+ F   SQ TE +++TLCPTWDQ L+F  +E++G+   + + PP ++IE++D D +G+ +F+GR     IT M   H   PR  P L++Y + +GN  AGE+LAAFEL       + D P P   P    RG I  V  GIRP++ +  IE+L WG+R++ +  LA V  P ++ E  G  +Q+ +I+N   NPNF+  + + +V LP+ EL  PP NI+V D R FGR  LVG H + ++  + + P  D++  + ++ A+ E                 + IH++ E + +  ++++  D+      K              KRKK E+     LD +++D    WWSKY+AS+                                     GE     K Q +  +  +VY  ELE    YN+F D+   F L+RGK  DD        +E+  +G+FKG+  IY +  ++++  +       + + +P + PI  +VR+Y+++A DL P D +G ADPY+ ++LGK  + +K++YI   L P FG+ F+++  LP+   L + + D+D + +DD+IGET IDLENRF +K RATCG+  TY I G N WRD  KP+ IL + C+   I  P Y    +      VY G  + +          N     ++E LAL VLN    +P     L  EH+ETRPL +P +PGIEQG+++ W+D+FP  +   G   +I+PRKPK ++LR+IVWNT +V+LED+++  GEK SDI+V+GWL G  E +Q+TDVHY SL GEGNFNWRF++PF YL AE  +++ KKE  +S DETE ++P    LQ+WD D FSADDFLG +EL+L + P  AK +KQC +  +   N   ++  +N+F+ +R  G+WP    DE    E+TGK+E EL+LLT EEA   P G GR+   E   LE PNRPDT+FLWF  P K  + ++   +KW  I  ++  L+  ++ LF+YS+PG   +K++G 
Sbjct:  756 GVQSSPPISLMYTMKQIFQLRVHMYQARSLFAADSTGLSDPFARIFFSTHSQVTEVLNETLCPTWDQLLVFDHVELYGEAGELRDDPPIIVIEIYDQDTVGKADFMGRTFAKPITKMSDEHYGPPRFPPQLEYYQIYRGNCTAGEMLAAFELLQIGPGGKADLP-PIDGPTDIDRGPILPVPIGIRPVLSKYRIEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTTLRKFIYRP-ADKS--VNNWSAMEE-----------------VVIHTEPEPAVKKIETVVKLDSASDAVVKVDMPDDEKGGKGKKKRKKGEEVEEEELDESMLD----WWSKYFASIETLKEAMKAQEAEAEEKEDFESGDGKKKRGKKSKTIPGEAVPEKKKQKI--EEFKVYNRELEY--EYNQFEDWLHTFNLHRGKCSDDADVDQNAADEDRLIGKFKGSLCIYKVSSDDMSRDMGFDSNMGMFQNIPHNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKSEIKDKENYISKQLNPVFGKSFDVEATLPMDSTLTVSIYDWDLVGTDDLIGETKIDLENRFYSKHRATCGISSTYAIHGYNVWRDPLKPSHILAKLCKDGKIDAPQYGPGGRVKVTNRVYTGPTEVE--------DENGLKKQTDEHLALAVLNHWEDIPRIGCKLVPEHMETRPLLNPDKPGIEQGRIEMWVDMFPKDMSAPGPALDISPRKPKKFELRVIVWNTDEVVLEDDDIFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLQAEEKIVISKKESMFSWDETEYKIPARLNLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSIEMVTNEN---EMPMVNIFKQKRIKGWWPFVARDENDELEITGKVEAELQLLTGEEAEKSPVGEGRN---EPEPLEKPNRPDTAFLWFMMPLKAIRHLVCNQYKWLVIKIVVALLLLAMLGLFLYSMPGYMVKKLLGA 1773          

HSP 2 Score: 379.022 bits (972), Expect = 5.879e-106
Identity = 251/713 (35.20%), Postives = 387/713 (54.28%), Query Frame = 3
Query:  576 IGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKL-RSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGV--QLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDET--PE-------QGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMI--TAVDSPVEFEVSIGNYGNKLDEX---------------------------------XXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSK--ELPGWEAGESPLTELDLNLNTLRTNELGNIRKEA--LRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLG---QEKD 2552
            + N  S P IKI+    R         P DFQ+ + V+EARQL G N+ PV  V+  +  K T +K STN P +N  F F+FH+    +FD+ +   + +S+ L RS  L+GSFK D+  IY +P H + +KW  L DPED  +G KGY+K   A++  GD   +   + + + D+IE+NLL P  V  + + A F L++YRAE LP+M++ I+  +KK F  +   K+LVDPY+   FAG++ KTS++ +S  P WNE++    QFP +C R+KLQ+ D D++  D  IGT  IDL  IA  GD GFLPT GP ++N +GS R ++ L D ++ LN G GEGV++R RL++ L+  + +T  PE       Q + I  I+ ++  K ++F       L  +FL A+MI     D P+ FEV+IGNYG++LD                                   ++  S+T      I D  ++H LP+   KPC  +   W++   RLY  N   K+ DK+   ++ ++  IK      E+   +    ++L   CS    L   +  ++  T+LD     L   E+ ++ ++A  +R + + ++V+  +   ++F ++LR LS EPQ+S+PD+ IWMI+  KR  Y R+P+ D+LYS+  +  G+ CG VQTI  K P  K      +++ A+  L LWLG   Q KD
Sbjct:   47 VSNKRSKPDIKIEPSAGR---------PMDFQVSVTVIEARQLVGLNMDPVVCVEIGDDKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKILKVSVIHSKNLLRSGTLVGSFKLDVGTIYTQPDHQFFHKWATLCDPEDITAGLKGYVKCDIAVVAKGDTIKTPHKANENDEDDIESNLLLPEDVPAERQWARFYLKIYRAEGLPKMNTSIMANVKKAFIGE--NKDLVDPYVQVLFAGQKGKTSIQKSSYEPIWNEQIVFTEQFPPLCRRMKLQIRDSDKVN-DVAIGTHFIDLRKIANDGDKGFLPTLGPAWVNMYGSTRSYT-LMDEYQDLNEGLGEGVSFRARLLISLAVEILDTSSPEVMSSTEVQVEGIPNISDNATGKVEEFF------LFGSFLEATMIDRKIGDKPINFEVTIGNYGSELDTPTKPKSKKKKGDGDDEESELIHGSSDEEVDDGGDVTSVSTTPPMKPVITDRNYFH-LPYFERKPCIYIYSWWQDQRRRLYNANVLDKMADKLEEGLNDVQEIIKTEKAYPERR--LRGVLEELSNSCSTFVSLANNDQNQAGRTKLDKERVKLCMQEVESMGQQAKTMRSQVKKSNVKDRIKLAQNFLHKLRFLSDEPQHSVPDIYIWMISNNKRIAYARVPSKDILYSSVEEECGKDCGKVQTIFFKLPGKKSFGPAGWTVQAKTELYLWLGLNRQRKD 737          
BLAST of Fer-1-related vs. Ensembl Xenopus
Match: ctnnal1 (catenin alpha-like 1 [Source:Xenbase;Acc:XB-GENE-5815188])

HSP 1 Score: 1642.86 bits (4253), Expect = 0.000e+0
Identity = 969/2131 (45.47%), Postives = 1340/2131 (62.88%), Query Frame = 3
Query:   90 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQ--LTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGP--------QIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG---------DNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNS-DYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDE-WQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPM-KPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTD--KPLPFTPPKRG-NIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAK-YLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            + V V +A N+   +L GK DP V I F+G+KKKTK +   LNP W+E L FDL G  L  +  L V V D E IG DK +G+I V L++ + G+        L L  +  +P    ++L + Y+PP  A                I Q D    EE++ D  + G + S P        QI  + V  + TR+  S KPQDFQIRI+V+E RQL G NI PV KV    Q  +T++K   N+P ++  FF+N +++  EL DE++ F +FNS  +R+D+LIG FK D+  IY+EP H  M KW+LL+DP+D +SGAKGYLK    ++G GDE P     ++ E D++E+NLL PAGV LR  TF L++YRAED+P+MD    + +K++F +D+ KK LVDP++   FAGK++ T+    + +PEWN+ + + ++FPSMCE IKL ++DWDR+T++D +GT  + LS IAA G         + GFLPTFGPC++N +GSPRE++  PD ++ LN+GKGEGVAYRGR++VEL+T LD +    ++I  I+ D +L  +K+ RRRKY L A F SA+MI  +   ++FEVSIGNYGNK D T  P +STTQ +  IFDG +Y++LPW  +KP   +  +WE++S RL  VN  + + D++ SN+  +K AI+A LP+   A+  +   D LI    + +P  E G++ +T LD   + LR   L  I++ A+++R EAT V+  L ++E + ++L+ LS EPQNSMPDV+IWMI  +KR  Y R+PA+ VL+S  S +  G++CG  QT+ L+ P  K        IP +LR+ +WLG  + E +++   +EG  S+ AE YENQA L+G+W T   ++ R  +SD +G ++L +E+  PP+GW W+ DW + PE SL  + DAG +++ +++F NE R PGG W  +   FTD  G+   +P D+  P GW W+D+ W  D+NR  DE GWEY +    ++    +V  EKMYH   RRR +  ++  + K++    ++    + E WEYA L   +FH   R +D  RRRRW RKM P  + G  AIF L                      E  +  D  TEDE +    +   K+T  N+ G    P +   F K + + LR YIYQAR L   D+  FSDPYA V+FL++S+ TE I  TL PTWDQTLIF+ I+I+GDP A+ + PP V+IE+FDYDQ+G+DEFLGR    PMVK +P+    P L WY +   N+  G+LL A EL ++      LP  P +R   I+ V  GIRP++Q T IEIL+WG+RNM  YQLA+VTSPS+  E GG +++T +IKN    PNF + +LF+ VLLPK+E+Y+PP  IK+ D+R FGRKP+VG   +  ++ +R  P + +     D P L  +       +   IE E            +T  +++  NQL +            S  +   ++ E+EV            +DWWSKYYAS GE  KC +Y    Y TL+VYK ELE V  +   TDFC  F LYRGK  D ++ + VGEFKG+FRIYPLP++ N   P + +LE  LP ++  ECIVR+YI++ IDLQP D +GL DPY+++ L KK++ ++D YIPN L P FGRM+EL C LP +KDL+I V DYD ++ D+ +GET IDLENRFL++F + CGLPQTYCISG N+WRD   PT+IL+ F      PPP +  N   + +   + + L  FE N K + H GP NERLAL+VL    L  EHVETR L+S  QP I QGKL+ W+D+FP S+   G PF ITPRK K Y LR+IVWNTKDVIL+++++ GE+MSDIYVKGW+ G +E +Q+TDVHYRSLDGEGNFNWRFVFPF+YLPAE + IV KKEHFWSLD+TE +LP   +LQIWDNDKFS DD+LG +EL+L +   PAK  ++C  N L   + +   K  +LFE +   G+WPC+ ++ G   L GKIEM LE+L E++A  +PAG GRDEPN NPKL+PPNRPDTSFLWFT+P KT KFIIW+ FKW FIG II+ LV L + +F YS+PG  + K+V
Sbjct:    2 LKVIVESAANIPKTKL-GKPDPIVTIIFKGEKKKTKPVDNELNPIWNELLEFDLKGIPLDYSASLEVIVKDFETIGKDKFIGTIVVSLKEFSAGQVRSLPFKGLALQSEKGQPIGSTIDLMISYEPPPSAISNPTDPGGTT-----IIQGDGENDEEEDRDIVDAGFNPSVPGAPGQTDTQIARRLVKGKKTRRILSNKPQDFQIRIRVIEGRQLPGNNIKPVVKVSVGGQTHRTRIKRG-NNPYFDEIFFYNVNMTPLELLDESVIFRLFNSGSIRADSLIGEFKLDVGYIYDEPGHAVMRKWVLLNDPDDSSSGAKGYLKVSMFVVGTGDEPPVEKRDREMEDDDVESNLLLPAGVALRWVTFFLKIYRAEDIPQMDDAFAQTVKEIFGADSDKKNLVDPFVEVSFAGKKVCTNRIEKNANPEWNQAVNLQIKFPSMCENIKLTVYDWDRLTKNDAVGTTCLSLSKIAASGGEIEATTEKEVGFLPTFGPCYLNLYGSPREYTGFPDPYDDLNFGKGEGVAYRGRVLVELTTKLDNS--SIKKIEDISSDDILVVEKYQRRRKYCLCAVFHSATMIQDIGEAIQFEVSIGNYGNKFDSTCKPLASTTQYSRPIFDGNYYYYLPWSFTKPVVTLTSYWEDISHRLDIVNILIAMTDRLQSNISTLKSAIQAKLPDVRLAEIWMRLIDQLIEDTMRPMPSLE-GKANVTVLDKQRDKLRQTSLKYIQEAAIKMRGEATDVKATLTEIEDWLDRLQQLSEEPQNSMPDVIIWMIRAEKRLAYARVPAHQVLFSKTSEEACGKYCGKTQTVFLQYPLDK---TKGLKIPTELRVNIWLGLSEVEKKFNSY-SEGTFSVYAEMYENQALLLGKWGTTG-LLKRHKFSDVTGSIKLKRESFLPPKGWEWEDDWKVDPERSLLTEADAGHTEFTDEIFENEARYPGGEWKKADETFTDANGEKSASPSDLSCPFGWIWDDDGWMRDINRAVDENGWEYGLTIPPDSKPKSWVAAEKMYH-TNRRRRLVRKRKKDPKVSTTSKAALTPQEQEGWEYAALIGWKFHITPRSSDTFRRRRWRRKMAPSDQHGAAAIFKL----------------------EGALGTDM-TEDEEK----KGSEKQTATNVFG-ANTPIVSCTFDKFYTYHLRCYIYQARGLTPLDKDSFSDPYAHVSFLHRSKTTETIRSTLNPTWDQTLIFNTIDIYGDPHAVAQNPPNVVIEIFDYDQVGKDEFLGRSVCMPMVKLNPEVDIAPKLLWYPVMNSNKHCGDLLLAAELIIREKDGSNLPILPSQRAPQIYMVPQGIRPVVQLTAIEILTWGLRNMKSYQLASVTSPSLIVECGGEIVETAVIKNLKKTPNFYSSVLFMKVLLPKDEMYVPPIIIKIVDHRPFGRKPVVGQCTIECLEEFRCDPYLTKHE---DAPELRVARLTSSPLRDVVIEVE------------DTKPLLA--NQLLS--SMSTAIGKMASPTTVHLQEKEEEV------------VDWWSKYYASTGETEKCGQYIQKGYTTLKVYKCELENVSEFRGLTDFCDTFKLYRGKAEDSDDPSVVGEFKGSFRIYPLPDDPNIPYPPRQFLE--LPGTESQECIVRIYIVRGIDLQPKDNNGLCDPYIKITLNKKVIEDRDHYIPNTLNPLFGRMYELSCFLPQEKDLKISVYDYDTLTRDEKVGETTIDLENRFLSRFGSHCGLPQTYCISGINQWRDQLTPTQILQNFARLKSSPPPVFSDNGTRLTF-SSKDYTLEEFENNRKIHQHLGPPNERLALYVLRTQGLVPEHVETRTLYSTFQPNISQGKLEMWVDVFPKSLGPPGPPFNITPRKAKKYVLRVIVWNTKDVILDEKSITGEEMSDIYVKGWIPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFEYLPAEQLCIVSKKEHFWSLDKTEFKLPPKLILQIWDNDKFSLDDYLGFVELDLHRTTIPAKVPEKCSFNLL---DQDKHSKVASLFEQKSMKGWWPCHAEKDGKRILAGKIEMTLEVLNEKDAEERPAGKGRDEPNMNPKLDPPNRPDTSFLWFTNPCKTMKFIIWRRFKWVFIGLIILLLVLLFLGVFFYSLPGYVSMKIV 2051          
BLAST of Fer-1-related vs. Ensembl Xenopus
Match: ctnnal1 (catenin alpha-like 1 [Source:Xenbase;Acc:XB-GENE-5815188])

HSP 1 Score: 1574.68 bits (4076), Expect = 0.000e+0
Identity = 917/2079 (44.11%), Postives = 1278/2079 (61.47%), Query Frame = 3
Query:   90 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQ--LTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGP--------QIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIY----EEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG----------------------DNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNS-DYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDE-WQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPM-KPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTD--KPLPFTPPKRG-NIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAK-YLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRD 6182
            + V V +A N+   +L GK DP V I F+G+KKKTK +   LNP W+E L FDL G  L  +  L V V D E IG DK +G+I V L++ + G+        L L  +  +P    ++L + Y+PP  A                I Q D    EE++ D  + G + S P        QI  + V  + TR+  S KPQDFQIRI+V+E RQL G NI PV KV    Q  +T++K   N+P ++  FF+N +++  EL DE++ F +FNS  +R+D+LIG FK   +  +        H  M KW+LL+DP+D +SGAKGYLK    ++G GDE P     ++ E D++E+NLL PAGV LR  TF L++YRAED+P+MD    + +K++F +D+ KK LVDP++   FAGK++ T+    + +PEWN+ + + ++FPSMCE IKL ++DWDR+T++D +GT  + LS IAA G                      + GFLPTFGPC++N +GSPRE++  PD ++ LN+GKGEGVAYRGR++VEL+T LD +    ++I  I+ D +L  +K+ RRRKY L A F SA+MI  +   ++FEVSIGNYGNK D T  P +STTQ +  IFDG +Y++LPW  +KP   +  +WE++S RL  VN  + + D++ SN+  +K AI+A LP+   A+  +   D LI    + +P  E G++ +T LD   + LR   L  I++ A+++R EAT V+  L ++E + ++L+ LS EPQNSMPDV+IWMI  +KR  Y R+PA+ VL+S  S +  G++CG  QT+ L+ P  K        IP +LR+ +WLG  + E +++   +EG  S+ AE YENQA L+G+W T   ++ R  +SD +G ++L +E+  PP+GW W+ DW + PE SL  + DAG +++ +++F NE R PGG W  +   FTD  G+   +P D+  P GW W+D+ W  D+NR  DE GWEY +    ++    +V  EKMYH   RRR +  ++  + K++    ++    + E WEYA L   +FH   R +D  RRRRW RKM P  + G  AIF L                      E  +  D  TEDE +    +   K+T  N+ G    P +   F K + + LR YIYQAR L   D+  FSDPYA V+FL++S+ TE I  TL PTWDQTLIF+ I+I+GDP A+ + PP V+IE+FDYDQ+G+DEFLGR    PMVK +P+    P L WY +   N+  G+LL A EL ++      LP  P +R   I+ V  GIRP++Q T IEIL+WG+RNM  YQLA+VTSPS+  E GG +++T +IKN    PNF + +LF+ VLLPK+E+Y+PP  IK+ D+R FGRKP+VG   +  ++ +R  P + +     D P L  +       +   IE E            +T  +++  NQL +           +   +      E+EV            +DWWSKYYAS GE  KC +Y    Y TL+VYK ELE V  +   TDFC  F LYRGK  D ++ + VGEFKG+FRIYPLP++ N   P + +LE  LP ++  ECIVR+YI++ IDLQP D +GL DPY+++ L KK++ ++D YIPN L P FGRM+EL C LP +KDL+I V DYD ++ D+ +GET IDLENRFL++F + CGLPQTYCISG N+WRD   PT+IL+ F      PPP +  N   + +   + + L  FE N K + H GP NERLAL+VL    L  EHVETR L+S  QP I QGKL+ W+D+FP S+   G PF ITPRK K Y LR+IVWNTKDVIL+++++ GE+MSDIYVKGW+ G +E +Q+TDVHYRSLDGEGNFNWRFVFPF+YLPAE + IV KKEHFWSLD+TE +LP   +LQIWDNDKFS DD+LG +EL+L +   PAK  ++C  N L   + +   K  +LFE +   G+WPC+ ++ G   L GKIEM LE+L E++A  +PAG GRD
Sbjct:    2 LKVIVESAANIPKTKL-GKPDPIVTIIFKGEKKKTKPVDNELNPIWNELLEFDLKGIPLDYSASLEVIVKDFETIGKDKFIGTIVVSLKEFSAGQVRSLPFKGLALQSEKGQPIGSTIDLMISYEPPPSAISNPTDPGGTT-----IIQGDGENDEEEDRDIVDAGFNPSVPGAPGQTDTQIARRLVKGKKTRRILSNKPQDFQIRIRVIEGRQLPGNNIKPVVKVSVGGQTHRTRIKRG-NNPYFDEIFFYNVNMTPLELLDESVIFRLFNSGSIRADSLIGEFKILQANTFCSNSHVAGHAVMRKWVLLNDPDDSSSGAKGYLKVSMFVVGTGDEPPVEKRDREMEDDDVESNLLLPAGVALRWVTFFLKIYRAEDIPQMDDAFAQTVKEIFGADSDKKNLVDPFVEVSFAGKKVCTNRIEKNANPEWNQAVNLQIKFPSMCENIKLTVYDWDRLTKNDAVGTTCLSLSKIAASGGEIEEYDSTGTGSSSLEATTEKEVGFLPTFGPCYLNLYGSPREYTGFPDPYDDLNFGKGEGVAYRGRVLVELTTKLDNS--SIKKIEDISSDDILVVEKYQRRRKYCLCAVFHSATMIQDIGEAIQFEVSIGNYGNKFDSTCKPLASTTQYSRPIFDGNYYYYLPWSFTKPVVTLTSYWEDISHRLDIVNILIAMTDRLQSNISTLKSAIQAKLPDVRLAEIWMRLIDQLIEDTMRPMPSLE-GKANVTVLDKQRDKLRQTSLKYIQEAAIKMRGEATDVKATLTEIEDWLDRLQQLSEEPQNSMPDVIIWMIRAEKRLAYARVPAHQVLFSKTSEEACGKYCGKTQTVFLQYPLDK---TKGLKIPTELRVNIWLGLSEVEKKFNSY-SEGTFSVYAEMYENQALLLGKWGTTG-LLKRHKFSDVTGSIKLKRESFLPPKGWEWEDDWKVDPERSLLTEADAGHTEFTDEIFENEARYPGGEWKKADETFTDANGEKSASPSDLSCPFGWIWDDDGWMRDINRAVDENGWEYGLTIPPDSKPKSWVAAEKMYH-TNRRRRLVRKRKKDPKVSTTSKAALTPQEQEGWEYAALIGWKFHITPRSSDTFRRRRWRRKMAPSDQHGAAAIFKL----------------------EGALGTDM-TEDEEK----KGSEKQTATNVFG-ANTPIVSCTFDKFYTYHLRCYIYQARGLTPLDKDSFSDPYAHVSFLHRSKTTETIRSTLNPTWDQTLIFNTIDIYGDPHAVAQNPPNVVIEIFDYDQVGKDEFLGRSVCMPMVKLNPEVDIAPKLLWYPVMNSNKHCGDLLLAAELIIREKDGSNLPILPSQRAPQIYMVPQGIRPVVQLTAIEILTWGLRNMKSYQLASVTSPSLIVECGGEIVETAVIKNLKKTPNFYSSVLFMKVLLPKDEMYVPPIIIKIVDHRPFGRKPVVGQCTIECLEEFRCDPYLTKHE---DAPELRVARLTSSPLRDVVIEVE------------DTKPLLA--NQLLS------SMSTAIGKMASPTTVHEEEV------------VDWWSKYYASTGETEKCGQYIQKGYTTLKVYKCELENVSEFRGLTDFCDTFKLYRGKAEDSDDPSVVGEFKGSFRIYPLPDDPNIPYPPRQFLE--LPGTESQECIVRIYIVRGIDLQPKDNNGLCDPYIKITLNKKVIEDRDHYIPNTLNPLFGRMYELSCFLPQEKDLKISVYDYDTLTRDEKVGETTIDLENRFLSRFGSHCGLPQTYCISGINQWRDQLTPTQILQNFARLKSSPPPVFSDNGTRLTF-SSKDYTLEEFENNRKIHQHLGPPNERLALYVLRTQGLVPEHVETRTLYSTFQPNISQGKLEMWVDVFPKSLGPPGPPFNITPRKAKKYVLRVIVWNTKDVILDEKSITGEEMSDIYVKGWIPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFEYLPAEQLCIVSKKEHFWSLDKTEFKLPPKLILQIWDNDKFSLDDYLGFVELDLHRTTIPAKVPEKCSFNLL---DQDKHSKVASLFEQKSMKGWWPCHAEKDGKRILAGKIEMTLEVLNEKDAEERPAGKGRD 1995          
BLAST of Fer-1-related vs. Ensembl Xenopus
Match: DYSF (dysferlin [Source:NCBI gene;Acc:100488564])

HSP 1 Score: 1470.29 bits (3805), Expect = 0.000e+0
Identity = 915/2124 (43.08%), Postives = 1244/2124 (58.57%), Query Frame = 3
Query:   90 MNVTVINATNLINMEL-VGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVG----------KRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN-------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVR-EEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYS-NNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWED-EWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPM-KPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFEL------------------YLQTDKPLPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLD------LTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKW 6296
            +   V  A+NL N+E  V  SDP   + F+G KKKTK I  NLNP W+E   +DL G  L  +  L   V D E +G ++ +G   V LRDL    T   LT           A +L+ K Q           +      T     + T+      DE D   +   G+      KK            K  ++K  S KPQDFQ+R++V+E RQ+ G NI PV KV    Q K+T+++   N                   FDE     + +SR LR+D++IG            P+H ++ KWLLLSDP+D ++GAKGYLK    +LGPGDE+P       E+ ++IE NLLRPAGV LR A  TL++YRAEDLP+MD  +L+ +K++F  D+ KK LVDP++   FAGK           +P      +    FPSMCE+++++L DWDR+T +DIIGT  + +S I+A G         GFLPTFGPC++N +GSPREF+  PD +E LN GKGEGVAYRGR+++EL T L E  EQ  E +P   D + + +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  +    W  S P  +++ H +    RL          DK VSN+D + +A+KA     +    V   FDD+I  CS  LP  ++ +   T LD  L   R   L  I + AL+++ ++    E  +   E +  +L+ ++ EPQNS+PD+VIWM+ G+KR  YYR+PA DVL+S N S   G+ CG +QTI LK P           +PAQ+R++LW G   D+ E++    +G+LS+ AE YENQ   +LVG W T    +T P +SD +G+++L KE+ K   GW W GDW+ISPE +L YD DAG   ++E+VF N+ R+PGG W      ++D+ G+      +I  P GW+WED EW  D NR  DE+GWEY +    +     +VP EKMYH  RRRR+VR R+   +++           + E WEYA LF  +FH K RKTD  RRRRW R+M+P+ + G  A+F L                    E       D +++D            K    +   +  P +  +F   +++ LR YIYQARNL+  DQ  FSDPYA V+FL+QSQ T  +  TL PTWDQTLIFH+IE+ GDP  I E+PP +++E++D+D  G DE++GRC   P  +      R P L W+ +  G ++ GELLAAFEL                  Y      LP+ PP+R  N++ V  GI+P++QRT IEIL+WG+RN+  YQLA+VTSPS+  E G  +IQ+ +IKN   NPNF+  LL ++V LP+E+LY PP  +KV DNR FGRK                 P++ + ++                       + L   H D     N++ +  ED  L TP                      DEVL  +D       T  +E IDWWSK+YAS+GE  KC  Y +  +DTLQV  TELE +E Y E +DFC  F LYRGK  D+ E+ SV GEFKG+F+IYPLP++ +   PA    + LP+    EC+VRVYI++A  LQP DP+G  DPYV++ +GKK L +++ YIP  L P FG+MFEL C LP++KDL++ + DYD +S D+ IGET IDLENRFL+K+ A CGLPQ+YCISGPN+WRD  KP+E+L+ F ++    PP +K N    +     ++ +S  +    PN H GP  ERLALHVL    L  EHVETR L+SPLQP IEQGKLQ W+D+FP S+ + G PF ITPRK K Y LR I+WNTKDVIL+D ++ GEKMSDIYVK WL G +E +Q+TDVHYRS+ GEGNFNWR VFPF YLPAE +  V +KEHFWSLD+TE ++P + ++QIWDNDKFS DD+LG+++L+L +MP PAK +++C L+ L          + +LFE +   G+WPC   E     L GK+E+ LE++ E+E   +PAG+GRDEPN NP+LE P RP+TSFLWFTSP+KT K+I+W+ +KW
Sbjct:    2 LRCVVQRASNLPNVEKGVRYSDPVTSLTFRGVKKKTKIIKNNLNPIWNEGFEWDLKGLPLDNSSELVAVVKDHETMGRNRFLGETRVSLRDLL---TSPNLTATY-------NAPLLDSKKQGTGVSGKQPFLETCITCVTDTAGEEDTEDQAGTGDEADIVSLAPGGAEQPTLPKKTAPVPVQGLKRKKSNSKKHLSNKPQDFQVRVRVIEGRQIPGINIKPVVKVTVAGQTKRTRIRKGNNP-----------------YFDEVRCLLVLDSRSLRTDSVIGCGSV--------PEHAFLRKWLLLSDPDDFSAGAKGYLKVSLYVLGPGDESPVEKKEVSEDKEDIEGNLLRPAGVSLRGAHLTLKIYRAEDLPQMDDAVLDNVKQIFGFDSNKKNLVDPFVEVSFAGKM----------NPSGTGPFEF---FPSMCEKMRIRLLDWDRLTHNDIIGTTYLSMSKISAPGGEIEVDDTLGFLPTFGPCYVNLYGSPREFTGFPDPYEDLNLGKGEGVAYRGRVLLELETKLVEQAEQKVEDIP--SDDISRVEKYLRRRKYCLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDNTCLPLASTTQYSRAVFDGKRHPL--WDGSFPSVLIENHAKGKHCRL----------DK-VSNLDWVHLAVKAKSSPYDLDALVARLFDDIITDCSHALPDVKSMQG-TTHLDQYLYRFRKTNLAQIVQAALKLKHDDCVEQENVMEQAEDWLMRLKAMAEEPQNSLPDIVIWMLQGEKRVAYYRMPARDVLFSRNGSKCCGKNCGKLQTIFLKFPQ---EGTQGAKMPAQVRVQLWFGLAVDQKEFNHY-AQGKLSVFAEAYENQTKLALVGNWGTTG--LTYPKYSDVTGKIKLPKESFKASTGWSWAGDWFISPEKTLLYDTDAGHMSFVEEVFENQARLPGGQWIHMTEAYSDVNGEKVLPKDEIECPPGWKWEDDEWSTDTNRAVDEQGWEYGITIPPDRKPKSWVPAEKMYHTNRRRRWVRLRRRDPKQIEILKKHKPDESESEGWEYASLFGWKFHLKYRKTDSFRRRRWRRRMEPLERTGAAAVFAL--------------------EGSLGGITDDKSDD-----------GKNTSTMSFGVNRPTISCIFDYGNRYHLRCYIYQARNLVPMDQDSFSDPYAIVSFLHQSQKTLVMKSTLNPTWDQTLIFHEIEVFGDPETIKESPPNIVVEIYDHDTYGADEYMGRCICKPSFE------RSPRLSWHPVIMGTKNVGELLAAFELIPREKVKQMPLQCIILHLYCSWYADLPYPPPQREANVYMVPQGIKPVLQRTAIEILAWGLRNLKSYQLASVTSPSLIVECGDELIQSGVIKNVKKNPNFDVCLLLMEVRLPREDLYCPPIIVKVIDNRQFGRK-----------------PVVGQCTI-----------------------KSLEEFHCDP----NSEDLEVEDG-LVTP---------------------RDEVLIDIDDKEPLIPTQEEEFIDWWSKFYASIGEKEKCGTYLEKGFDTLQVLDTELENIEDYEELSDFCRTFKLYRGKTQDETEDPSVVGEFKGSFKIYPLPDDPSVPRPAPQFRQ-LPAKGLQECLVRVYIVRAFGLQPKDPNGKCDPYVKISIGKKSLNDQEHYIPCTLEPVFGKMFELTCTLPLEKDLKVTLYDYDMISKDEKIGETVIDLENRFLSKYGARCGLPQSYCISGPNQWRDQRKPSELLRIFAQQRNFKPPNFKNNS---IMFRNHEYHVSELDSKF-PNPHQGPPEERLALHVLRRQGLVCEHVETRALYSPLQPDIEQGKLQMWVDLFPKSLGSPGPPFNITPRKAKRYYLRCIIWNTKDVILDDVSITGEKMSDIYVKSWLIGHEENKQKTDVHYRSMGGEGNFNWRLVFPFDYLPAEQVCSVSRKEHFWSLDKTENKIPPNLIIQIWDNDKFSFDDYLGSVQLDLNRMPRPAKTAEKCRLDLLDEV---ESANHCSLFEQKTVKGWWPCVGQEGDEKILAGKVEITLEIVNEQEHDERPAGIGRDEPNMNPRLEDPKRPETSFLWFTSPYKTLKYILWRRYKW 1944          
BLAST of Fer-1-related vs. Ensembl Xenopus
Match: DYSF (dysferlin [Source:NCBI gene;Acc:100488564])

HSP 1 Score: 1465.29 bits (3792), Expect = 0.000e+0
Identity = 924/2164 (42.70%), Postives = 1260/2164 (58.23%), Query Frame = 3
Query:   90 MNVTVINATNLINMEL-VGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLN--LLDKNKRPTAGVLNLKVQY--XXXXXXXXXXXXXXXXXXXXXXIDQ-------------TDSAGAEE--------DETDNAEIGNSGSGPQIKIKKVG----------KRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN-----------------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVR-EEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYS-NNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWE-DEWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPM-KPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELY--------------LQTDKPLPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEAS-VGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCI---------------SGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKW 6296
            +   V  A+NL N+E  V  SDP   + F+G KKKTK I  NLNP W+E   +DL G  L  +  L   V D E +G ++ +G   V LRDL      +  T N  LLD  K+ T  +L L++ Y   P            +   +   +D              TD+AG E+        DE D   +   G+      KK            K  ++K  S KPQDFQ+R++V+E RQ+ G NI PV KV    Q K+T+++   N+P ++ +FFFNF  S +ELFDE +   +            GS           P+H ++ KWLLLSDP+D ++GAKGYLK    +LGPGDE+P       E+ ++IE NLLRPAGV LR A  TL++YRAEDLP+MD  +L+ +K++F  D+ KK LVDP++   FAGK           +P      +    FPSMCE+++++L DWDR+T +DIIGT  + +S I+A G                   GFLPTFGPC++N +GSPREF+  PD +E LN GKGEGVAYRGR+++EL T L E  EQ  E +P   D + + +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  +    W  S P +V    W ++  R               +N+D + +A+KA     +    V   FDD+I  CS  LP  ++ +   T LD  L   R   L  I + AL+++ ++    E  +   E +  +L+ ++ EPQNS+PD+VIWM+ G+KR  YYR+PA DVL+S N S   G+ CG +QTI LK P           +PAQ+R++LW G   D+ E++    +G+LS+ AE YENQ   +LVG W T    +T P +SD +G+++L KE+ K   GW W GDW+ISPE +L YD DAG   ++E+VF N+ R+PGG W      ++D+ G+      +I  P GW+WE DEW  D NR  DE+GWEY +    +     +VP EKMYH  RRRR+VR R+   +++           + E WEYA LF  +FH K RKTD  RRRRW R+M+P+ + G  A+F L                    E       D +++D      +   V +           P +  +F   +++ LR YIYQARNL+  DQ  FSDPYA V+FL+QSQ T  +  TL PTWDQTLIFH+IE+ GDP  I E+PP +++E++D+D  G DE++GRC   P  +      R P L W+ +  G ++ GELLAAFEL               ++ D  LP+ PP+R  N++ V  GI+P++QRT IEIL+WG+RN+  YQLA+VTSPS+  E G  +IQ+ +IKN   NPNF+  LL ++V LP+E+LY PP  +KV DNR FGRKP+VG   + S++ +   P              N     VE    DN+                  S+   D  L             +  K P     E+E             IDWWSK+YAS+GE  KC  Y +  +DTLQV  TELE +E Y E +DFC  F LYRGK  D+ E+ S VGEFKG+F+IYPLP++ +   PA    + LP+    EC+VRVYI++A  LQP DP+G  DPYV++ +GKK L +++ YIP  L P FG+MFEL C LP++KDL++ + DYD +S D+ IGET IDLENRFL+K+ A CGLPQ+YCI               SGPN+WRD  KP+E+L+ F ++    PP +K N    +     ++ +S  E +  PN H GP  ERLALHVL    L  EHVETR L+SPLQP IEQGKLQ W+D+FP S+ + G PF ITPRK K Y LR I+WNTKDVIL+D ++ GEKMSDIYVK WL G +E +Q+TDVHYRS+ GEGNFNWR VFPF YLPAE +  V +KEHFWSLD+TE ++P + ++QIWDNDKFS DD+LG+++L+L +MP PAK +++C L+ L          + +LFE +   G+WPC   E     L GK+E+ LE++ E+E   +PAG+GRDEPN NP+LE P RP+TSFLWFTSP+KT K+I+W+ +KW
Sbjct:    2 LRCVVQRASNLPNVEKGVRYSDPVTSLTFRGVKKKTKIIKNNLNPIWNEGFEWDLKGLPLDNSSELVAVVKDHETMGRNRFLGETRVSLRDLLTSPN-LTATYNAPLLDSKKQGTGAILTLQISYFPPPGAAPVVPPPAPKEPTPSLNELDTGKQPFLETCITCVTDTAGEEDTEDQAGTGDEADIVSLAPGGAEQPTLPKKTAPVPVQGLKRKKSNSKKHLSNKPQDFQVRVRVIEGRQIPGINIKPVVKVTVAGQTKRTRIRKG-NNPYFDETFFFNFFESPSELFDEPVFLTV----------RCGSV----------PEHAFLRKWLLLSDPDDFSAGAKGYLKVSLYVLGPGDESPVEKKEVSEDKEDIEGNLLRPAGVSLRGAHLTLKIYRAEDLPQMDDAVLDNVKQIFGFDSNKKNLVDPFVEVSFAGKM----------NPSGTGPFEF---FPSMCEKMRIRLLDWDRLTHNDIIGTTYLSMSKISAPGGEIEGTVRSSHFHPFDDTLGFLPTFGPCYVNLYGSPREFTGFPDPYEDLNLGKGEGVAYRGRVLLELETKLVEQAEQKVEDIP--SDDISRVEKYLRRRKYCLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDNTCLPLASTTQYSRAVFDGKRHPL--WDGSFP-SVESLTWIDLCYR----GRITAPESLSTANLDWVHLAVKAKSSPYDLDALVARLFDDIITDCSHALPDVKSMQG-TTHLDQYLYRFRKTNLAQIVQAALKLKHDDCVEQENVMEQAEDWLMRLKAMAEEPQNSLPDIVIWMLQGEKRVAYYRMPARDVLFSRNGSKCCGKNCGKLQTIFLKFPQ---EGTQGAKMPAQVRVQLWFGLAVDQKEFNHY-AQGKLSVFAEAYENQTKLALVGNWGTTG--LTYPKYSDVTGKIKLPKESFKASTGWSWAGDWFISPEKTLLYDTDAGHMSFVEEVFENQARLPGGQWIHMTEAYSDVNGEKVLPKDEIECPPGWKWEDDEWSTDTNRAVDEQGWEYGITIPPDRKPKSWVPAEKMYHTNRRRRWVRLRRRDPKQIEILKKHKPDESESEGWEYASLFGWKFHLKYRKTDSFRRRRWRRRMEPLERTGAAAVFAL--------------------EGSLGGITDDKSDDGKNTSTMSFGVNR-----------PTISCIFDYGNRYHLRCYIYQARNLVPMDQDSFSDPYAIVSFLHQSQKTLVMKSTLNPTWDQTLIFHEIEVFGDPETIKESPPNIVVEIYDHDTYGADEYMGRCICKPSFE------RSPRLSWHPVIMGTKNVGELLAAFELIPREKPAVHLIPGLEVRIDADLPYPPPQREANVYMVPQGIKPVLQRTAIEILAWGLRNLKSYQLASVTSPSLIVECGDELIQSGVIKNVKKNPNFDVCLLLMEVRLPREDLYCPPIIVKVIDNRQFGRKPVVGQCTIKSLEEFHCDP--------------NSEDLEVEDGLSDNV------------------SVTPRDEVL-----------IDIDDKEPLIPTQEEEF------------IDWWSKFYASIGEKEKCGTYLEKGFDTLQVLDTELENIEDYEELSDFCRTFKLYRGKTQDETEDPSVVGEFKGSFKIYPLPDDPSVPRPAPQFRQ-LPAKGLQECLVRVYIVRAFGLQPKDPNGKCDPYVKISIGKKSLNDQEHYIPCTLEPVFGKMFELTCTLPLEKDLKVTLYDYDMISKDEKIGETVIDLENRFLSKYGARCGLPQSYCITPGSYRDCLNPTACKSGPNQWRDQRKPSELLRIFAQQRNFKPPNFKNNS---IMFRNHEYHVSELEDSKFPNPHQGPPEERLALHVLRRQGLVCEHVETRALYSPLQPDIEQGKLQMWVDLFPKSLGSPGPPFNITPRKAKRYYLRCIIWNTKDVILDDVSITGEKMSDIYVKSWLIGHEENKQKTDVHYRSMGGEGNFNWRLVFPFDYLPAEQVCSVSRKEHFWSLDKTENKIPPNLIIQIWDNDKFSFDDYLGSVQLDLNRMPRPAKTAEKCRLDLLDEV---ESANHCSLFEQKTVKGWWPCVGQEGDEKILAGKVEITLEIVNEQEHDERPAGIGRDEPNMNPRLEDPKRPETSFLWFTSPYKTLKYILWRRYKW 2015          
BLAST of Fer-1-related vs. Ensembl Xenopus
Match: DYSF (dysferlin [Source:NCBI gene;Acc:100488564])

HSP 1 Score: 1464.51 bits (3790), Expect = 0.000e+0
Identity = 907/2123 (42.72%), Postives = 1241/2123 (58.46%), Query Frame = 3
Query:  147 SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLN--LLDKNKRPTAGVLNLKVQY--XXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNS--------GSGPQ-----------IKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN---------------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVR-EEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYS-NNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWE-DEWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPM-KPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELY--------------LQTDKPLPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEAS-VGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCF--------KPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKW 6296
            SD Y  + FQG+      I  + N QW     +DL G  L  +  L   V D E +G ++ +G   V LRDL      +  T N  LLD  K+ T  +L L++ Y   P            +   +   +D       EED  D A  G+         G   Q           ++  K  K  ++K  S KPQDFQ+R++V+E RQ+ G NI PV KV    Q K+T+++   N+P ++ +FFFNF  S +ELFDE +   +            GS           P+H ++ KWLLLSDP+D ++GAKGYLK    +LGPGDE+P       E+ ++IE NLLRPAGV LR A  TL++YRAEDLP+MD  +L+ +K++F  D+ KK LVDP++   FAGK           +P      +    FPSMCE+++++L DWDR+T +DIIGT  + +S I+A G                 GFLPTFGPC++N +GSPREF+  PD +E LN GKGEGVAYRGR+++EL T L E  EQ  E +P   D + + +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  +    W  S P  +++ H +    RL          DK  +N+D + +A+KA     +    V   FDD+I  CS  LP  ++ +   T LD  L   R   L  I + AL+++ ++    E  +   E +  +L+ ++ EPQNS+PD+VIWM+ G+KR  YYR+PA DVL+S N S   G+ CG +QTI LK P           +PAQ+R++LW G   D+ E++    +G+LS+ AE YENQ   +LVG W T    +T P +SD +G+++L KE+ K   GW W GDW+ISPE +L YD DAG   ++E+VF N+ R+PGG W      ++D+ G+      +I  P GW+WE DEW  D NR  DE+GWEY +    +     +VP EKMYH  RRRR+VR R+   +++           + E WEYA LF  +FH K RKTD  RRRRW R+M+P+ + G  A+F L                    E       D +++D      +   V +           P +  +F   +++ LR YIYQARNL+  DQ  FSDPYA V+FL+QSQ T  +  TL PTWDQTLIFH+IE+ GDP  I E+PP +++E++D+D  G DE++GRC   P  +      R P L W+ +  G ++ GELLAAFEL               ++ D  LP+ PP+R  N++ V  GI+P++QRT IEIL+WG+RN+  YQLA+VTSPS+  E G  +IQ+ +IKN   NPNF+  LL ++V LP+E+LY PP  +KV DNR FGRKP+VG   + S++ +   P              N     VE    DN+                  S+   D  L             +  K P     E+E             IDWWSK+YAS+GE  KC  Y +  +DTLQV  TELE +E Y E +DFC  F LYRGK  D+ E+ S VGEFKG+F+IYPLP++ +   PA    + LP+    EC+VRVYI++A  LQP DP+G  DPYV++ +GKK L +++ YIP  L P FG+MFEL C LP++KDL++ + DYD +S D+ IGET IDLENRFL+K+ A CGLPQ+YCI+ P  +RDC         KP+E+L+ F ++    PP +K N    +     ++ +S  E +  PN H GP  ERLALHVL    L  EHVETR L+SPLQP IEQGKLQ W+D+FP S+ + G PF ITPRK K Y LR I+WNTKDVIL+D ++ GEKMSDIYVK WL G +E +Q+TDVHYRS+ GEGNFNWR VFPF YLPAE +  V +KEHFWSLD+TE ++P + ++QIWDNDKFS DD+LG+++L+L +MP PAK +++C L+ L          + +LFE +   G+WPC   E     L GK+E+ LE++ E+E   +PAG+GRDEPN NP+LE P RP+TSFLWFTSP+KT K+I+W+ +KW
Sbjct:   20 SDSYCSVVFQGKYCALGAIEHSANAQWGWGFEWDLKGLPLDNSSELVAVVKDHETMGRNRFLGETRVSLRDLLTSPN-LTATYNAPLLDSKKQGTGAILTLQISYFPPPGAAPVVPPPAPKEPTPSLNELDTVTDTAGEEDTEDQAGTGDEADIVSLAPGGAEQPTLPKKTAPVPVQGLKRKKSNSKKHLSNKPQDFQVRVRVIEGRQIPGINIKPVVKVTVAGQTKRTRIRKG-NNPYFDETFFFNFFESPSELFDEPVFLTV----------RCGSV----------PEHAFLRKWLLLSDPDDFSAGAKGYLKVSLYVLGPGDESPVEKKEVSEDKEDIEGNLLRPAGVSLRGAHLTLKIYRAEDLPQMDDAVLDNVKQIFGFDSNKKNLVDPFVEVSFAGKM----------NPSGTGPFEF---FPSMCEKMRIRLLDWDRLTHNDIIGTTYLSMSKISAPGGEIEGTPENALSFDDTLGFLPTFGPCYVNLYGSPREFTGFPDPYEDLNLGKGEGVAYRGRVLLELETKLVEQAEQKVEDIP--SDDISRVEKYLRRRKYCLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDNTCLPLASTTQYSRAVFDGKRHPL--WDGSFPSVLIENHAKGKHCRL----------DK-AANLDWVHLAVKAKSSPYDLDALVARLFDDIITDCSHALPDVKSMQG-TTHLDQYLYRFRKTNLAQIVQAALKLKHDDCVEQENVMEQAEDWLMRLKAMAEEPQNSLPDIVIWMLQGEKRVAYYRMPARDVLFSRNGSKCCGKNCGKLQTIFLKFPQ---EGTQGAKMPAQVRVQLWFGLAVDQKEFNHY-AQGKLSVFAEAYENQTKLALVGNWGTTG--LTYPKYSDVTGKIKLPKESFKASTGWSWAGDWFISPEKTLLYDTDAGHMSFVEEVFENQARLPGGQWIHMTEAYSDVNGEKVLPKDEIECPPGWKWEDDEWSTDTNRAVDEQGWEYGITIPPDRKPKSWVPAEKMYHTNRRRRWVRLRRRDPKQIEILKKHKPDESESEGWEYASLFGWKFHLKYRKTDSFRRRRWRRRMEPLERTGAAAVFAL--------------------EGSLGGITDDKSDDGKNTSTMSFGVNR-----------PTISCIFDYGNRYHLRCYIYQARNLVPMDQDSFSDPYAIVSFLHQSQKTLVMKSTLNPTWDQTLIFHEIEVFGDPETIKESPPNIVVEIYDHDTYGADEYMGRCICKPSFE------RSPRLSWHPVIMGTKNVGELLAAFELIPREKPAVHLIPGLEVRIDADLPYPPPQREANVYMVPQGIKPVLQRTAIEILAWGLRNLKSYQLASVTSPSLIVECGDELIQSGVIKNVKKNPNFDVCLLLMEVRLPREDLYCPPIIVKVIDNRQFGRKPVVGQCTIKSLEEFHCDP--------------NSEDLEVEDGLSDNV------------------SVTPRDEVL-----------IDIDDKEPLIPTQEEEF------------IDWWSKFYASIGEKEKCGTYLEKGFDTLQVLDTELENIEDYEELSDFCRTFKLYRGKTQDETEDPSVVGEFKGSFKIYPLPDDPSVPRPAPQFRQ-LPAKGLQECLVRVYIVRAFGLQPKDPNGKCDPYVKISIGKKSLNDQEHYIPCTLEPVFGKMFELTCTLPLEKDLKVTLYDYDMISKDEKIGETVIDLENRFLSKYGARCGLPQSYCIT-PGSYRDCLNPTWRDQRKPSELLRIFAQQRNFKPPNFKNNS---IMFRNHEYHVSELEDSKFPNPHQGPPEERLALHVLRRQGLVCEHVETRALYSPLQPDIEQGKLQMWVDLFPKSLGSPGPPFNITPRKAKRYYLRCIIWNTKDVILDDVSITGEKMSDIYVKSWLIGHEENKQKTDVHYRSMGGEGNFNWRLVFPFDYLPAEQVCSVSRKEHFWSLDKTENKIPPNLIIQIWDNDKFSFDDYLGSVQLDLNRMPRPAKTAEKCRLDLLDEV---ESANHCSLFEQKTVKGWWPCVGQEGDEKILAGKVEITLEIVNEQEHDERPAGIGRDEPNMNPRLEDPKRPETSFLWFTSPYKTLKYILWRRYKW 1985          
BLAST of Fer-1-related vs. Ensembl Mouse
Match: Dysf (dysferlin [Source:MGI Symbol;Acc:MGI:1349385])

HSP 1 Score: 1628.22 bits (4215), Expect = 0.000e+0
Identity = 954/2172 (43.92%), Postives = 1325/2172 (61.00%), Query Frame = 3
Query:  102 VINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXX--XXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSG------------SGPQIKI--------------KKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG------DN-GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNS-DYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWED-EWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSR---RNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQL-QAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            +  A+NL N++   +SDP   + F+G KK+TK I  ++NP W+E   +DL G  L  +  L V V D E +G ++ +G   +PL++ LA           LLD  ++PT   L L+V Y P                      +D     G EED  D    G+               GP                  +K      RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T+++   NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  +Y EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE NLLRP GV LR A F L+++RAEDLP+MD  +++ +K++F  D+ KK LVDP++   FAGK + + +   + +P+WN+ + +   FPSMCE++++++ DWDR+T +D + T  + +S I+A G      DN GFLPTFGPC++N +GSPREF+  PD +  LN GKGEGVAYRGR+++ L T L E  EQ  E LP   D +L+ +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPWGN KP  V+  +WE++S R+   N  L++ D++ +N++++ +A+KA    E+    V    D+L+  CS+  P  +  E P  T LD  L  LRT  L  I++ AL ++   + +  AL   E +   LR L+ EPQNS+PD++IWM+ G KR  Y R+PA++VL+S     Y GR CG +QTI LK P      +    +P Q+R+KLW G   DE E+++   EG+LS+ AETYENQ   +LVG W T    +T P +SD +G+++L K++ +P  GW W GDW++ PE +L +D DAG   ++E+VF N+ R+PGG W      +TD+ G+      DI  P GW+WED EW  DLNR  DE+GWEY++    +     +VPVEKMY+  RRRR+VR R+    ++           + E WEYA LF  +FH + RKTD  RRRRW R+M+P++   PA                    V  +E      VD ++ED +    +   V +           P +  +F   +++ LR Y+YQAR+L A D+  FSDPYA V+FL+QSQ T     TL PTWDQTLIF++IEI G+PA+I E PP +++E++D+D  G DEF+GRC   P ++      R P L W+ LT+G++ AGELLAAFEL +Q +KP                        LP+ PP+R  NI+ V   I+P +QRT IEIL+WG+RNM  YQ+A+++SPS+  E GG  +Q+ +I+N   NPNF+   LF++V+LP+E+LY PP  +KV DNR FGR+P+VG   + S++ +   P   E+             GG +     +  E+++    D++     + TD + S      TP           S  SP                  +E IDWWSK++AS+GE  KC  Y + ++DTL+VY T+LE VE +   +DFC  F LYRG+  ++ ++ SV GEFKG F+IYPLPE+    +P +   + L +  P EC+VR+YI++A  LQP DP+G  DPY+++ +GKK ++++D+YIP  L P FG+MFEL C LP++KDL+I + DYD +S D+ IGET IDLENR L+KF A CGLPQTYC+SGPN+WRD  +P+++L  FC+++ I  P Y+T+    V    + + +   E    PN H GP  ERLALHVL    L  EHVE+RPL+SPLQP IEQGKLQ WIDIFP  +   G PF ITPRK + + LR I+WNTKDVIL+D +L GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRFVFPF YLPAE +  V KK+ FW LD+TE ++P   V QIWDNDKFS DDFLG+L+L+L +MP PAK +++C L+QL   F+P   V   +LFE +   G+WPC  +E     L GK+EM LE++ E E   +PAG GRDEPN NPKLE P RPDTSFLWFTSP+KT KFI+W+ F+   I  II+ ++ L + +FVY+ P   A K+V
Sbjct:    6 LARASNLPNVKKDRRSDPVASLIFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQSSELLVVVKDHETMGRNRFLGEAKIPLQEVLATPSLSASFNAPLLDAKQQPTGASLVLQVSYTPPPGAVPLFPPPASLAPSPTLPDMDLVPDTGGEEDTEDQGLTGDEAEPFLDQSAAVGPGGPTTPRKPPSHPPPHYPGAKRKRSSAPPRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIQKG-NSPLFNETLFFNVFDSPLELFDEPIFITVVDSRSLRTDALLGEFRMDVGTVYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLDKKDPSEDKEDIEGNLLRPTGVALRGAHFCLKLFRAEDLPQMDDAVMDNVKQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRVMDWDRLTHNDTVATTYLGMSKISATGGEIEVDDNLGFLPTFGPCYVNLYGSPREFTGFPDPYAELNTGKGEGVAYRGRVLLSLETKLVEHSEQKVEDLP--ADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDTTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIEIQNQLLRVADRLEANLEQVHLALKAQCSSEDVDALVAQLTDELLADCSQ--PLCDIHEIPSATHLDQYLLRLRTRHLSQIKEAALALKLGHSELSTALEQAEDWLLHLRALAEEPQNSLPDIIIWMLQGDKRVAYQRVPAHEVLFSRRGPSYCGRNCGKLQTIFLKYPM---EGMPGARMPVQIRIKLWFGLSVDEKEFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWAWAGDWFVCPEKTLLHDADAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPKHWVPVEKMYYTHRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPA-------------------AVFALEGALGGMVDDKSEDSMSVSTLSFGVNR-----------PTISCIFDYGNRYHLRCYLYQARDLPAMDKDSFSDPYAIVSFLHQSQKTVVEKNTLNPTWDQTLIFYEIEIFGEPASIAEHPPCIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPAGELLAAFEL-IQREKPAIHHIPGFEMHETSRILDETEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQMASISSPSLVVECGGQTVQSCVIRNLRKNPNFDVCTLFMEVMLPREDLYCPPIVVKVIDNRQFGRRPVVGQCTIRSLENFLCDPYSAESP---------SPQGGPDDVSLLSPGEDVLIDIDDKEPLIPVQLTDGLSSLGPTNLTP-----------SPSSPHE----------------EEFIDWWSKFFASVGEREKCGSYLEKDFDTLKVYDTQLENVEAFGGLSDFCNTFKLYRGRTQEETDDPSVIGEFKGLFKIYPLPEDPAIPMPPRQFHQ-LAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRIKAPVYRTDR---VTFQDKDYTIEEIEAGRLPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWIDIFPKVLGRPGPPFNITPRKARRFFLRCIIWNTKDVILDDLSLTGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLPAEQVCAVAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAEKCSLDQLDDTFHPEWFV---SLFEQKTVKGWWPCVTEEGEKKMLAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRCAIILFIILFILLLFLGVFVYAFPNYAAMKLV 2086          
BLAST of Fer-1-related vs. Ensembl Mouse
Match: Dysf (dysferlin [Source:MGI Symbol;Acc:MGI:1349385])

HSP 1 Score: 1622.06 bits (4199), Expect = 0.000e+0
Identity = 954/2186 (43.64%), Postives = 1325/2186 (60.61%), Query Frame = 3
Query:  102 VINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXX--XXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSG------------SGPQIKI--------------KKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG--------------------DN-GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNS-DYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWED-EWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSR---RNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQL-QAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            +  A+NL N++   +SDP   + F+G KK+TK I  ++NP W+E   +DL G  L  +  L V V D E +G ++ +G   +PL++ LA           LLD  ++PT   L L+V Y P                      +D     G EED  D    G+               GP                  +K      RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T+++   NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  +Y EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE NLLRP GV LR A F L+++RAEDLP+MD  +++ +K++F  D+ KK LVDP++   FAGK + + +   + +P+WN+ + +   FPSMCE++++++ DWDR+T +D + T  + +S I+A G                    DN GFLPTFGPC++N +GSPREF+  PD +  LN GKGEGVAYRGR+++ L T L E  EQ  E LP   D +L+ +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPWGN KP  V+  +WE++S R+   N  L++ D++ +N++++ +A+KA    E+    V    D+L+  CS+  P  +  E P  T LD  L  LRT  L  I++ AL ++   + +  AL   E +   LR L+ EPQNS+PD++IWM+ G KR  Y R+PA++VL+S     Y GR CG +QTI LK P      +    +P Q+R+KLW G   DE E+++   EG+LS+ AETYENQ   +LVG W T    +T P +SD +G+++L K++ +P  GW W GDW++ PE +L +D DAG   ++E+VF N+ R+PGG W      +TD+ G+      DI  P GW+WED EW  DLNR  DE+GWEY++    +     +VPVEKMY+  RRRR+VR R+    ++           + E WEYA LF  +FH + RKTD  RRRRW R+M+P++   PA                    V  +E      VD ++ED +    +   V +           P +  +F   +++ LR Y+YQAR+L A D+  FSDPYA V+FL+QSQ T     TL PTWDQTLIF++IEI G+PA+I E PP +++E++D+D  G DEF+GRC   P ++      R P L W+ LT+G++ AGELLAAFEL +Q +KP                        LP+ PP+R  NI+ V   I+P +QRT IEIL+WG+RNM  YQ+A+++SPS+  E GG  +Q+ +I+N   NPNF+   LF++V+LP+E+LY PP  +KV DNR FGR+P+VG   + S++ +   P   E+             GG +     +  E+++    D++     + TD + S      TP           S  SP                  +E IDWWSK++AS+GE  KC  Y + ++DTL+VY T+LE VE +   +DFC  F LYRG+  ++ ++ SV GEFKG F+IYPLPE+    +P +   + L +  P EC+VR+YI++A  LQP DP+G  DPY+++ +GKK ++++D+YIP  L P FG+MFEL C LP++KDL+I + DYD +S D+ IGET IDLENR L+KF A CGLPQTYC+SGPN+WRD  +P+++L  FC+++ I  P Y+T+    V    + + +   E    PN H GP  ERLALHVL    L  EHVE+RPL+SPLQP IEQGKLQ WIDIFP  +   G PF ITPRK + + LR I+WNTKDVIL+D +L GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRFVFPF YLPAE +  V KK+ FW LD+TE ++P   V QIWDNDKFS DDFLG+L+L+L +MP PAK +++C L+QL   F+P   V   +LFE +   G+WPC  +E     L GK+EM LE++ E E   +PAG GRDEPN NPKLE P RPDTSFLWFTSP+KT KFI+W+ F+   I  II+ ++ L + +FVY+ P   A K+V
Sbjct:    6 LARASNLPNVKKDRRSDPVASLIFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQSSELLVVVKDHETMGRNRFLGEAKIPLQEVLATPSLSASFNAPLLDAKQQPTGASLVLQVSYTPPPGAVPLFPPPASLAPSPTLPDMDLVPDTGGEEDTEDQGLTGDEAEPFLDQSAAVGPGGPTTPRKPPSHPPPHYPGAKRKRSSAPPRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIQKG-NSPLFNETLFFNVFDSPLELFDEPIFITVVDSRSLRTDALLGEFRMDVGTVYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLDKKDPSEDKEDIEGNLLRPTGVALRGAHFCLKLFRAEDLPQMDDAVMDNVKQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRVMDWDRLTHNDTVATTYLGMSKISATGGEIEEEPAGVLKSPQATDLDDNLGFLPTFGPCYVNLYGSPREFTGFPDPYAELNTGKGEGVAYRGRVLLSLETKLVEHSEQKVEDLP--ADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDTTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIEIQNQLLRVADRLEANLEQVHLALKAQCSSEDVDALVAQLTDELLADCSQ--PLCDIHEIPSATHLDQYLLRLRTRHLSQIKEAALALKLGHSELSTALEQAEDWLLHLRALAEEPQNSLPDIIIWMLQGDKRVAYQRVPAHEVLFSRRGPSYCGRNCGKLQTIFLKYPM---EGMPGARMPVQIRIKLWFGLSVDEKEFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWAWAGDWFVCPEKTLLHDADAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPKHWVPVEKMYYTHRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPA-------------------AVFALEGALGGMVDDKSEDSMSVSTLSFGVNR-----------PTISCIFDYGNRYHLRCYLYQARDLPAMDKDSFSDPYAIVSFLHQSQKTVVEKNTLNPTWDQTLIFYEIEIFGEPASIAEHPPCIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPAGELLAAFEL-IQREKPAIHHIPGFEMHETSRILDETEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQMASISSPSLVVECGGQTVQSCVIRNLRKNPNFDVCTLFMEVMLPREDLYCPPIVVKVIDNRQFGRRPVVGQCTIRSLENFLCDPYSAESP---------SPQGGPDDVSLLSPGEDVLIDIDDKEPLIPVQLTDGLSSLGPTNLTP-----------SPSSPHE----------------EEFIDWWSKFFASVGEREKCGSYLEKDFDTLKVYDTQLENVEAFGGLSDFCNTFKLYRGRTQEETDDPSVIGEFKGLFKIYPLPEDPAIPMPPRQFHQ-LAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRIKAPVYRTDR---VTFQDKDYTIEEIEAGRLPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWIDIFPKVLGRPGPPFNITPRKARRFFLRCIIWNTKDVILDDLSLTGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLPAEQVCAVAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAEKCSLDQLDDTFHPEWFV---SLFEQKTVKGWWPCVTEEGEKKMLAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRCAIILFIILFILLLFLGVFVYAFPNYAAMKLV 2100          
BLAST of Fer-1-related vs. Ensembl Mouse
Match: Dysf (dysferlin [Source:MGI Symbol;Acc:MGI:1349385])

HSP 1 Score: 1618.59 bits (4190), Expect = 0.000e+0
Identity = 949/2169 (43.75%), Postives = 1317/2169 (60.72%), Query Frame = 3
Query:  102 VINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXX--XXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSG------------SGPQIKI--------------KKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG------DN-GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNS-DYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWED-EWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQL-QAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            +  A+NL N++   +SDP   + F+G KK+TK I  ++NP W+E   +DL G  L  +  L V V D E +G ++ +G   +PL++ LA           LLD  ++PT   L L+V Y P                      +D     G EED  D    G+               GP                  +K      RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T+++   NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  +Y EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE NLLRP GV LR A F L+++RAEDLP+MD  +++ +K++F  D+ KK LVDP++   FAGK + + +   + +P+WN+ + +   FPSMCE++++++ DWDR+T +D + T  + +S I+A G      DN GFLPTFGPC++N +GSPREF+  PD +  LN GKGEGVAYRGR+++ L T L E  EQ  E LP   D +L+ +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPWGN KP  V+  +WE++S R+   N  L++ D++ +N++++ +A+KA    E+    V    D+L+  CS+  P  +  E P  T LD  L  LRT  L  I++ AL ++   + +  AL   E +   LR L+ EPQNS+PD++IWM+ G KR  Y R+PA++VL+S     Y GR CG +QTI LK P      +    +P Q+R+KLW G   DE E+++   EG+LS+ AETYENQ   +LVG W T    +T P +SD +G+++L K++ +P  GW W GDW++ PE +L +D DAG   ++E+VF N+ R+PGG W      +TD+ G+      DI  P GW+WED EW  DLNR  DE+GWEY++    +     +VPVEKMY+  RRRR+VR R+    ++           + E WEYA LF  +FH + RKTD  RRRRW R+M+P++   PA                    V  +E      VD ++ED +    +   V +           P +  +F   +++ LR Y+YQAR+L A D+  FSDPYA V+FL+QSQ T     TL PTWDQTLIF++IEI G+PA+I E PP +++E++D+D  G DEF+GRC   P ++      R P L W+ LT+G++ AGELLAAFEL +Q +KP                        LP+ PP+R  NI+ V   I+P +QRT IEIL+WG+RNM  YQ+A+++SPS+  E GG  +Q+ +I+N   NPNF+   LF++V+LP+E+LY PP  +KV DNR FGR+P+VG   + S++ +   P   E+             GG +     +  E               D +I  D+                  K P     E+E ++            WWSK++AS+GE  KC  Y + ++DTL+VY T+LE VE +   +DFC  F LYRG+  ++ ++ SV GEFKG F+IYPLPE+    +P +   + L +  P EC+VR+YI++A  LQP DP+G  DPY+++ +GKK ++++D+YIP  L P FG+MFEL C LP++KDL+I + DYD +S D+ IGET IDLENR L+KF A CGLPQTYC+SGPN+WRD  +P+++L  FC+++ I  P Y+T+    V    + + +   E    PN H GP  ERLALHVL    L  EHVE+RPL+SPLQP IEQGKLQ WIDIFP  +   G PF ITPRK + + LR I+WNTKDVIL+D +L GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRFVFPF YLPAE +  V KK+ FW LD+TE ++P   V QIWDNDKFS DDFLG+L+L+L +MP PAK +++C L+QL   F+P   V   +LFE +   G+WPC  +E     L GK+EM LE++ E E   +PAG GRDEPN NPKLE P RPDTSFLWFTSP+KT KFI+W+ F+   I  II+ ++ L + +FVY+ P   A K+V
Sbjct:    6 LARASNLPNVKKDRRSDPVASLIFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQSSELLVVVKDHETMGRNRFLGEAKIPLQEVLATPSLSASFNAPLLDAKQQPTGASLVLQVSYTPPPGAVPLFPPPASLAPSPTLPDMDLVPDTGGEEDTEDQGLTGDEAEPFLDQSAAVGPGGPTTPRKPPSHPPPHYPGAKRKRSSAPPRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIQKG-NSPLFNETLFFNVFDSPLELFDEPIFITVVDSRSLRTDALLGEFRMDVGTVYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLDKKDPSEDKEDIEGNLLRPTGVALRGAHFCLKLFRAEDLPQMDDAVMDNVKQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRVMDWDRLTHNDTVATTYLGMSKISATGGEIEVDDNLGFLPTFGPCYVNLYGSPREFTGFPDPYAELNTGKGEGVAYRGRVLLSLETKLVEHSEQKVEDLP--ADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDTTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIEIQNQLLRVADRLEANLEQVHLALKAQCSSEDVDALVAQLTDELLADCSQ--PLCDIHEIPSATHLDQYLLRLRTRHLSQIKEAALALKLGHSELSTALEQAEDWLLHLRALAEEPQNSLPDIIIWMLQGDKRVAYQRVPAHEVLFSRRGPSYCGRNCGKLQTIFLKYPM---EGMPGARMPVQIRIKLWFGLSVDEKEFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWAWAGDWFVCPEKTLLHDADAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPKHWVPVEKMYYTHRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPA-------------------AVFALEGALGGMVDDKSEDSMSVSTLSFGVNR-----------PTISCIFDYGNRYHLRCYLYQARDLPAMDKDSFSDPYAIVSFLHQSQKTVVEKNTLNPTWDQTLIFYEIEIFGEPASIAEHPPCIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPAGELLAAFEL-IQREKPAIHHIPGFEMHETSRILDETEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQMASISSPSLVVECGGQTVQSCVIRNLRKNPNFDVCTLFMEVMLPREDLYCPPIVVKVIDNRQFGRRPVVGQCTIRSLENFLCDPYSAESP---------SPQGGPDDVSLLSPGE---------------DVLIDIDD------------------KEPLIPVQEEEFID------------WWSKFFASVGEREKCGSYLEKDFDTLKVYDTQLENVEAFGGLSDFCNTFKLYRGRTQEETDDPSVIGEFKGLFKIYPLPEDPAIPMPPRQFHQ-LAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRIKAPVYRTDR---VTFQDKDYTIEEIEAGRLPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWIDIFPKVLGRPGPPFNITPRKARRFFLRCIIWNTKDVILDDLSLTGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLPAEQVCAVAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAEKCSLDQLDDTFHPEWFV---SLFEQKTVKGWWPCVTEEGEKKMLAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRCAIILFIILFILLLFLGVFVYAFPNYAAMKLV 2065          
BLAST of Fer-1-related vs. Ensembl Mouse
Match: Dysf (dysferlin [Source:MGI Symbol;Acc:MGI:1349385])

HSP 1 Score: 1616.67 bits (4185), Expect = 0.000e+0
Identity = 950/2171 (43.76%), Postives = 1314/2171 (60.53%), Query Frame = 3
Query:  147 SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXX--XXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSG------------SGPQIKI--------------KKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG--------------------DN-GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNS-DYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWED-EWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSR---RNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQL-QAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            SD Y    F G KK+TK I  ++NP W+E   +DL G  L  +  L V V D E +G ++ +G   +PL++ LA           LLD  ++PT   L L+V Y P                      +D     G EED  D    G+               GP                  +K      RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T+++   NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  +Y EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE NLLRP GV LR A F L+++RAEDLP+MD  +++ +K++F  D+ KK LVDP++   FAGK + + +   + +P+WN+ + +   FPSMCE++++++ DWDR+T +D + T  + +S I+A G                    DN GFLPTFGPC++N +GSPREF+  PD +  LN GKGEGVAYRGR+++ L T L E  EQ  E LP   D +L+ +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPWGN KP  V+  +WE++S R+   N  L++ D++ +N++++ +A+KA    E+    V    D+L+  CS+  P  +  E P  T LD  L  LRT  L  I++ AL ++   + +  AL   E +   LR L+ EPQNS+PD++IWM+ G KR  Y R+PA++VL+S     Y GR CG +QTI LK P      +    +P Q+R+KLW G   DE E+++   EG+LS+ AETYENQ   +LVG W T    +T P +SD +G+++L K++ +P  GW W GDW++ PE +L +D DAG   ++E+VF N+ R+PGG W      +TD+ G+      DI  P GW+WED EW  DLNR  DE+GWEY++    +     +VPVEKMY+  RRRR+VR R+    ++           + E WEYA LF  +FH + RKTD  RRRRW R+M+P++   PA                    V  +E      VD ++ED +    +   V +           P +  +F   +++ LR Y+YQAR+L A D+  FSDPYA V+FL+QSQ T     TL PTWDQTLIF++IEI G+PA+I E PP +++E++D+D  G DEF+GRC   P ++      R P L W+ LT+G++ AGELLAAFEL +Q +KP                        LP+ PP+R  NI+ V   I+P +QRT IEIL+WG+RNM  YQ+A+++SPS+  E GG  +Q+ +I+N   NPNF+   LF++V+LP+E+LY PP  +KV DNR FGR+P+VG   + S++ +   P   E+             GG +     +  E+++    D++     + TD + S      TP           S  SP                  +E IDWWSK++AS+GE  KC  Y + ++DTL+VY T+LE VE +   +DFC  F LYRG+  ++ ++ SV GEFKG F+IYPLPE+    +P +   + L +  P EC+VR+YI++A  LQP DP+G  DPY+++ +GKK ++++D+YIP  L P FG+MFEL C LP++KDL+I + DYD +S D+ IGET IDLENR L+KF A CGLPQTYC+SGPN+WRD  +P+++L  FC+++ I  P Y+T+    V    + + +   E    PN H GP  ERLALHVL    L  EHVE+RPL+SPLQP IEQGKLQ WIDIFP  +   G PF ITPRK + + LR I+WNTKDVIL+D +L GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRFVFPF YLPAE +  V KK+ FW LD+TE ++P   V QIWDNDKFS DDFLG+L+L+L +MP PAK +++C L+QL   F+P   V   +LFE +   G+WPC  +E     L GK+EM LE++ E E   +PAG GRDEPN NPKLE P RPDTSFLWFTSP+KT KFI+W+ F+   I  II+ ++ L + +FVY+ P   A K+V
Sbjct:   20 SDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQSSELLVVVKDHETMGRNRFLGEAKIPLQEVLATPSLSASFNAPLLDAKQQPTGASLVLQVSYTPPPGAVPLFPPPASLAPSPTLPDMDLVPDTGGEEDTEDQGLTGDEAEPFLDQSAAVGPGGPTTPRKPPSHPPPHYPGAKRKRSSAPPRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIQKG-NSPLFNETLFFNVFDSPLELFDEPIFITVVDSRSLRTDALLGEFRMDVGTVYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLDKKDPSEDKEDIEGNLLRPTGVALRGAHFCLKLFRAEDLPQMDDAVMDNVKQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRVMDWDRLTHNDTVATTYLGMSKISATGGEIEEEPAGVLKSPQATDLDDNLGFLPTFGPCYVNLYGSPREFTGFPDPYAELNTGKGEGVAYRGRVLLSLETKLVEHSEQKVEDLP--ADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDTTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIEIQNQLLRVADRLEANLEQVHLALKAQCSSEDVDALVAQLTDELLADCSQ--PLCDIHEIPSATHLDQYLLRLRTRHLSQIKEAALALKLGHSELSTALEQAEDWLLHLRALAEEPQNSLPDIIIWMLQGDKRVAYQRVPAHEVLFSRRGPSYCGRNCGKLQTIFLKYPM---EGMPGARMPVQIRIKLWFGLSVDEKEFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWAWAGDWFVCPEKTLLHDADAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPKHWVPVEKMYYTHRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPA-------------------AVFALEGALGGMVDDKSEDSMSVSTLSFGVNR-----------PTISCIFDYGNRYHLRCYLYQARDLPAMDKDSFSDPYAIVSFLHQSQKTVVEKNTLNPTWDQTLIFYEIEIFGEPASIAEHPPCIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPAGELLAAFEL-IQREKPAIHHIPGFEMHETSRILDETEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQMASISSPSLVVECGGQTVQSCVIRNLRKNPNFDVCTLFMEVMLPREDLYCPPIVVKVIDNRQFGRRPVVGQCTIRSLENFLCDPYSAESP---------SPQGGPDDVSLLSPGEDVLIDIDDKEPLIPVQLTDGLSSLGPTNLTP-----------SPSSPHE----------------EEFIDWWSKFFASVGEREKCGSYLEKDFDTLKVYDTQLENVEAFGGLSDFCNTFKLYRGRTQEETDDPSVIGEFKGLFKIYPLPEDPAIPMPPRQFHQ-LAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRIKAPVYRTDR---VTFQDKDYTIEEIEAGRLPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWIDIFPKVLGRPGPPFNITPRKARRFFLRCIIWNTKDVILDDLSLTGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLPAEQVCAVAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAEKCSLDQLDDTFHPEWFV---SLFEQKTVKGWWPCVTEEGEKKMLAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRCAIILFIILFILLLFLGVFVYAFPNYAAMKLV 2099          
BLAST of Fer-1-related vs. Ensembl Mouse
Match: Dysf (dysferlin [Source:MGI Symbol;Acc:MGI:1349385])

HSP 1 Score: 1613.97 bits (4178), Expect = 0.000e+0
Identity = 949/2183 (43.47%), Postives = 1317/2183 (60.33%), Query Frame = 3
Query:  102 VINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXX--XXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSG------------SGPQIKI--------------KKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG--------------------DN-GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNS-DYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWED-EWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQL-QAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            +  A+NL N++   +SDP   + F+G KK+TK I  ++NP W+E   +DL G  L  +  L V V D E +G ++ +G   +PL++ LA           LLD  ++PT   L L+V Y P                      +D     G EED  D    G+               GP                  +K      RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T+++   NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  +Y EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE NLLRP GV LR A F L+++RAEDLP+MD  +++ +K++F  D+ KK LVDP++   FAGK + + +   + +P+WN+ + +   FPSMCE++++++ DWDR+T +D + T  + +S I+A G                    DN GFLPTFGPC++N +GSPREF+  PD +  LN GKGEGVAYRGR+++ L T L E  EQ  E LP   D +L+ +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPWGN KP  V+  +WE++S R+   N  L++ D++ +N++++ +A+KA    E+    V    D+L+  CS+  P  +  E P  T LD  L  LRT  L  I++ AL ++   + +  AL   E +   LR L+ EPQNS+PD++IWM+ G KR  Y R+PA++VL+S     Y GR CG +QTI LK P      +    +P Q+R+KLW G   DE E+++   EG+LS+ AETYENQ   +LVG W T    +T P +SD +G+++L K++ +P  GW W GDW++ PE +L +D DAG   ++E+VF N+ R+PGG W      +TD+ G+      DI  P GW+WED EW  DLNR  DE+GWEY++    +     +VPVEKMY+  RRRR+VR R+    ++           + E WEYA LF  +FH + RKTD  RRRRW R+M+P++   PA                    V  +E      VD ++ED +    +   V +           P +  +F   +++ LR Y+YQAR+L A D+  FSDPYA V+FL+QSQ T     TL PTWDQTLIF++IEI G+PA+I E PP +++E++D+D  G DEF+GRC   P ++      R P L W+ LT+G++ AGELLAAFEL +Q +KP                        LP+ PP+R  NI+ V   I+P +QRT IEIL+WG+RNM  YQ+A+++SPS+  E GG  +Q+ +I+N   NPNF+   LF++V+LP+E+LY PP  +KV DNR FGR+P+VG   + S++ +   P   E+             GG +     +  E               D +I  D+                  K P     E+E ++            WWSK++AS+GE  KC  Y + ++DTL+VY T+LE VE +   +DFC  F LYRG+  ++ ++ SV GEFKG F+IYPLPE+    +P +   + L +  P EC+VR+YI++A  LQP DP+G  DPY+++ +GKK ++++D+YIP  L P FG+MFEL C LP++KDL+I + DYD +S D+ IGET IDLENR L+KF A CGLPQTYC+SGPN+WRD  +P+++L  FC+++ I  P Y+T+    V    + + +   E    PN H GP  ERLALHVL    L  EHVE+RPL+SPLQP IEQGKLQ WIDIFP  +   G PF ITPRK + + LR I+WNTKDVIL+D +L GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRFVFPF YLPAE +  V KK+ FW LD+TE ++P   V QIWDNDKFS DDFLG+L+L+L +MP PAK +++C L+QL   F+P   V   +LFE +   G+WPC  +E     L GK+EM LE++ E E   +PAG GRDEPN NPKLE P RPDTSFLWFTSP+KT KFI+W+ F+   I  II+ ++ L + +FVY+ P   A K+V
Sbjct:    6 LARASNLPNVKKDRRSDPVASLIFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQSSELLVVVKDHETMGRNRFLGEAKIPLQEVLATPSLSASFNAPLLDAKQQPTGASLVLQVSYTPPPGAVPLFPPPASLAPSPTLPDMDLVPDTGGEEDTEDQGLTGDEAEPFLDQSAAVGPGGPTTPRKPPSHPPPHYPGAKRKRSSAPPRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIQKG-NSPLFNETLFFNVFDSPLELFDEPIFITVVDSRSLRTDALLGEFRMDVGTVYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLDKKDPSEDKEDIEGNLLRPTGVALRGAHFCLKLFRAEDLPQMDDAVMDNVKQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRVMDWDRLTHNDTVATTYLGMSKISATGGEIEEEPAGVLKSPQATDLDDNLGFLPTFGPCYVNLYGSPREFTGFPDPYAELNTGKGEGVAYRGRVLLSLETKLVEHSEQKVEDLP--ADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDTTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIEIQNQLLRVADRLEANLEQVHLALKAQCSSEDVDALVAQLTDELLADCSQ--PLCDIHEIPSATHLDQYLLRLRTRHLSQIKEAALALKLGHSELSTALEQAEDWLLHLRALAEEPQNSLPDIIIWMLQGDKRVAYQRVPAHEVLFSRRGPSYCGRNCGKLQTIFLKYPM---EGMPGARMPVQIRIKLWFGLSVDEKEFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWAWAGDWFVCPEKTLLHDADAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPKHWVPVEKMYYTHRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPA-------------------AVFALEGALGGMVDDKSEDSMSVSTLSFGVNR-----------PTISCIFDYGNRYHLRCYLYQARDLPAMDKDSFSDPYAIVSFLHQSQKTVVEKNTLNPTWDQTLIFYEIEIFGEPASIAEHPPCIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPAGELLAAFEL-IQREKPAIHHIPGFEMHETSRILDETEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQMASISSPSLVVECGGQTVQSCVIRNLRKNPNFDVCTLFMEVMLPREDLYCPPIVVKVIDNRQFGRRPVVGQCTIRSLENFLCDPYSAESP---------SPQGGPDDVSLLSPGE---------------DVLIDIDD------------------KEPLIPVQEEEFID------------WWSKFFASVGEREKCGSYLEKDFDTLKVYDTQLENVEAFGGLSDFCNTFKLYRGRTQEETDDPSVIGEFKGLFKIYPLPEDPAIPMPPRQFHQ-LAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRIKAPVYRTDR---VTFQDKDYTIEEIEAGRLPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWIDIFPKVLGRPGPPFNITPRKARRFFLRCIIWNTKDVILDDLSLTGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLPAEQVCAVAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAEKCSLDQLDDTFHPEWFV---SLFEQKTVKGWWPCVTEEGEKKMLAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRCAIILFIILFILLLFLGVFVYAFPNYAAMKLV 2079          
BLAST of Fer-1-related vs. UniProt/SwissProt
Match: sp|O75923|DYSF_HUMAN (Dysferlin OS=Homo sapiens OX=9606 GN=DYSF PE=1 SV=1)

HSP 1 Score: 1624.37 bits (4205), Expect = 0.000e+0
Identity = 951/2166 (43.91%), Postives = 1320/2166 (60.94%), Query Frame = 3
Query:  147 SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXX--IDQTDSAGAEEDETDNAEIGN---------SGSGPQIKIKKVGKR---------------TTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN---------------------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSN-NSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDE-WQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQL-QAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            SD Y    F G KK+TK I  ++NP W+E   +DL G  L     L V V D E +G ++ +G   VPLR+ LA           LLD  K+PT   L L+V Y P   A       +  + + T   +D     G EED  D    G+          G G     +K+  R               T+RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T++    NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  IY EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE+NLLRP GV LR A F L+V+RAEDLP+MD  +++ +K++F  ++ KK LVDP++   FAGK + + +   + +P+WN+ + +   FPSMCE++++++ DWDR+T +DI+ T  + +S I+A G                       GFLPTFGPC+IN +GSPREF+  PD +  LN GKGEGVAYRGRL++ L T L E  EQ  E LP   D +L+ +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPWGN KP  V+  +WE++S R+ T N  L I D++ + ++++ +A+KA    E+    V    D+LI  CS+  P  +  E+P  T LD  L  LRT+ L  I + AL ++   + +  AL   E +  +LR L+ EPQNS+PD+VIWM+ G KR  Y R+PA+ VL+S   ++Y G+ CG +QTI LK P  K   +    +P Q+R+KLW G   DE E+++   EG+LS+ AETYEN+   +LVG W T    +T P +SD +G+++L K++ +P  GW W GDW++ PE +L +D DAG   ++E+VF N+ R+PGG W      +TD+ G+      DI  P GW+WEDE W  DLNR  DE+GWEY++    E     +VP EKMY+  RRRR+VR R+    ++           + E WEYA LF  +FH + RKTD  RRRRW R+M+P++   PA                    V  +E      +D ++ED +    +   V +           P +  +F   +++ LR Y+YQAR+L A D+  FSDPYA V+FL+QSQ T  +  TL PTWDQTLIF++IEI G+PA + E PP +++E++D+D  G DEF+GRC   P ++      R P L W+ LT+G++ +GELLA+FEL +Q +KP                        LP+ PP+R  NI+ V   I+P +QRT IEIL+WG+RNM  YQLAN++SPS+  E GG  +Q+ +I+N   NPNF+   LF++V+LP+EELY PP  +KV DNR FGR+P+VG   + S++++   P   E+             GG +     +  E               D +I  D+                  K P     E+E ++            WWSK++AS+GE  KC  Y + ++DTL+VY T+LE VE +   +DFC  F LYRGK  ++ E+ SV GEFKG F+IYPLPE+    +P +   + L +  P EC+VR+YI++A  LQP DP+G  DPY+++ +GKK ++++D+YIP  L P FG+MFEL C LP++KDL+I + DYD +S D+ IGET +DLENR L+KF A CGLPQTYC+SGPN+WRD  +P+++L  FC+++ +  P Y+T+    V    +++ +   E    PN H GP  ERLALHVL    L  EHVE+RPL+SPLQP IEQGKLQ W+D+FP ++   G PF ITPR+ + + LR I+WNT+DVIL+D +L GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRF+FPF YLPAE +  + KK+ FW LD+TE ++P   V QIWDNDKFS DDFLG+L+L+L +MP PAK +K+C L+QL  AF+P   V   +LFE +   G+WPC  +E     L GK+EM LE++ E E   +PAG GRDEPN NPKLE P RPDTSFLWFTSP+KT KFI+W+ F+W  I  II+ ++ L + +F+Y+ P   A K+V
Sbjct:   20 SDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKG-NSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEAPLERKDPSEDKEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMDNVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEEEPAGAVKPSKASDLDDYLGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVEDLP--ADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQ--PLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALAEEPQNSLPDIVIWMLQGDKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPMEK---VPGARMPVQIRVKLWFGLSVDEKEFNQF-AEGKLSVFAETYENETKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPERKPKHWVPAEKMYYTHRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPA-------------------AVFALEGALGGVMDDKSEDSMSVSTLSFGVNR-----------PTISCIFDYGNRYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPSGELLASFEL-IQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNPNFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESP---------SPQGGPDDVSLLSPGE---------------DVLIDIDD------------------KEPLIPIQEEEFID------------WWSKFFASIGEREKCGSYLEKDFDTLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSVIGEFKGLFKIYPLPEDPAIPMPPRQFHQ-LAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDR---VMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYLPAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAKKCSLDQLDDAFHPEWFV---SLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRWAIILFIILFILLLFLAIFIYAFPNYAAMKLV 2076          
BLAST of Fer-1-related vs. UniProt/SwissProt
Match: sp|A6QQP7|DYSF_BOVIN (Dysferlin OS=Bos taurus OX=9913 GN=DYSF PE=2 SV=1)

HSP 1 Score: 1620.52 bits (4195), Expect = 0.000e+0
Identity = 956/2168 (44.10%), Postives = 1321/2168 (60.93%), Query Frame = 3
Query:  147 SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXX--XXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNS-----------GSGPQIKIKKV-----------GKRTT----RKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN---------------------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYS-NNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWED-EWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQ-AFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            SD Y    F G KK+TK I  N+NP W+E   +DL G  L     L V V D E +G ++ +G  ++PLR+ LA           LLD  K+PT   L L+V Y P   A          +       +D     G EED  D    G+            G G     KK            G++ +     K  S KPQDFQIR++V++ RQL G NI PV KV    Q K+T++    NSP +N + FFN   S AELF+E I   + +SR LR+DALIG F+ D+  IY EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE+NLLRP GV LR A F L+V+RAEDLP+MD  +++ ++++F  D+ KK LVDP++   FAGK + + +   + +P+WN+ + +   FPSMCE++++++ DWDR+T +DI+ T  + +S I+A G                       GFLPTFGPC+IN +GSPREF+  PD +  LN GKGEGVAYRGRL++ L T L E  EQ  E L  + D +L+ +K+LRRRKY L AAF SA+M+  VD  V+FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPWGN KP  V+  +WE++  R+   N  L+I D++ + ++++ +A+KA   +E+    V    D+LI  CS+  P  +  E P  T LD  L  LRT  L  I + A  ++   + +  AL   E +  +LR L+ EPQNS+PD+VIWM+ G KR  Y R+PA++VL+S   + Y G+ CG +QTI LK P      +    +P Q+R++LW G   DE E+++   EG+LS+ AETYENQ   +LVG W T    +T P +SD +GR++L K++ +P  GW W GDW++ PE +L +D DAG   ++E+VF N+ R+PGG W      +TD+ G+      DI  P GW+WED EW  DLNR  DE+GWEY++    +     +VP EKMY+  RRRR+VR R+    ++           + E WEYA LF  +FH + RKTD  RRRRW R+M+P++   PA                    V  +E      VD  +ED +    +   V +           P +  +F   +++ LR Y+YQAR+L A D+  FSDPYA V+FL+QSQ T     TL PTWDQTLIF++IEI G+P++I E PP +++E++D+D  G DEF+GRC   P ++      R P L W+ LT+G++ AGELLA+FEL +Q +KP                        LP+ PP+R  NI+ V   I+P++QRT IEIL+WG+RNM  YQLA+V+SPS+  E GG  +Q+ +IKN   NPNF+   LF++V+LP+EELY PP  +KV DNR FGR+P+VG   + S++ +   P  +E+             GG +     +  E+++              +  +D +   P          LS  +P         L+   + L +E IDWWSK++AS+GE  KC  Y + ++DTL+VY T LE V+ +   +DFC  F LYRGK  ++ E+ SV GEFKG F+IYPLPE+    LP +   + L S  P EC+VRVYII+A  LQP DP+G  DPY+++ +GKK ++++DSYIP  L P FG+MFEL C LP++KDL++ + DYD +S D+ IGET IDLENR L+KF A CGLPQTYC+SGPN+WRD  +P+++L  FC+++ +  P Y+T  D VV+   +++ +   E    PN H GP  ERLALHVL    L  EHVE+RPL+SPLQP IEQGKLQ W+D+FP ++   G PF ITPR+ + + LR I+WNTKDVIL+D ++ GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRFVFPF YLPAE +  V KK+ FW LD+TE ++P   V QIWDNDKFS DDFLG+L+L+L  MP PAK +++C  +QL+  F+P    + ++LFE +   G+WPC  +E     L GK+EM LE++TE E   +PAG GRDEPN NPKLE P RPDTSFLWFTSP+KT KFI+W+ F+   I  +I+ +  L + +FVYS P   A K+V
Sbjct:   20 SDAYCSAVFAGVKKRTKVIKNNVNPVWNEGFEWDLKGIPLDQGSELLVVVKDHETMGRNRFLGEANIPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPTFPPLTPLEPSPTLPDMDTVADTGGEEDTEDQGLTGDEAEPFLDQSGALGPGAPSTPKKQPSHPPPYHPGGGRKRSAPAPSKPLSDKPQDFQIRVQVIKGRQLPGVNIKPVVKVTAAGQTKRTRIHKG-NSPVFNETLFFNVFDSPAELFNEPIFITVVDSRSLRTDALIGEFRLDVGSIYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLERKDPSEDKEDIESNLLRPIGVALRGAHFCLKVFRAEDLPQMDDAVMDNVRQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQSITLPAMFPSMCEKMRIRVVDWDRLTHNDIVATTYLSMSKISASGGEIEEEPAGVVKPPPATELDDHLGFLPTFGPCYINLYGSPREFTGFPDPYAELNTGKGEGVAYRGRLLLSLETKLVERSEQKVEAL--SADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAVQFEVSIGNYGNKFDTTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDIRHRVEAQNQLLRIADQLEAGLEQVHLALKAQCSDEDVDSLVAQLMDELIAGCSQ--PLGDVQEMPSATHLDQYLYQLRTRHLSQITEAAQALKLGHSELPAALEQAEDWLLRLRALADEPQNSLPDIVIWMLQGDKRVAYQRVPAHEVLFSRRGTSYCGKNCGKLQTIFLKYPM---EGVPRARMPVQIRVRLWFGLSVDEKEFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDITGRIKLPKDSFRPSAGWAWAGDWFVCPEKTLLHDTDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPRHWVPAEKMYYTHRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPA-------------------AVFALEGALGGVVDDRSEDSVSVSTLSFGVNR-----------PTISCIFDYGNRYHLRCYMYQARDLPAMDKDSFSDPYAVVSFLHQSQKTVVAKNTLNPTWDQTLIFYEIEIFGEPSSIAEQPPSIVVELYDHDTYGVDEFMGRCICQPSLE------RTPRLAWFPLTRGSQPAGELLASFEL-IQREKPAIHHIPGFEVQDTTGILEESEDTDLPYPPPQREANIYMVPQNIKPVLQRTAIEILAWGLRNMKSYQLASVSSPSLVVECGGQSVQSCVIKNLRKNPNFDICTLFMEVMLPREELYCPPIVVKVIDNRQFGRRPVVGQCTIRSLEGFLCDPYSEESP---------SPQGGPDDVSLLSPGEDVL--------------IDIDDKEPLIP----IQFADGLSGLAPTNMASSPSSLH--KILLEEEFIDWWSKFFASIGESEKCGSYLEKDFDTLKVYDTSLENVKAFEGLSDFCNTFKLYRGKTQEETEDPSVIGEFKGLFKIYPLPEDPAIPLPPRQFHQ-LASQGPQECLVRVYIIRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDSYIPCTLEPVFGKMFELTCTLPLEKDLKVTLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRT--DRVVF-QDKEYTVEEIEAGRVPNPHLGPVEERLALHVLQQQGLIPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWNTKDVILDDLSITGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLPAEQVCTVSKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNHMPKPAKTAEKCSADQLEDTFHPE---RFVSLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVTESEHEERPAGHGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRCAIIFFLILFIFLLFLGIFVYSFPNYAAMKLV 2103          
BLAST of Fer-1-related vs. UniProt/SwissProt
Match: sp|Q9ESD7|DYSF_MOUSE (Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3)

HSP 1 Score: 1598.56 bits (4138), Expect = 0.000e+0
Identity = 945/2176 (43.43%), Postives = 1306/2176 (60.02%), Query Frame = 3
Query:  147 SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXX--XXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSG------------SGPQIKI--------------KKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG--------------------DN-GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFD--------GTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNS-DYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWED-EWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP------------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQL-QAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            SD Y    F G KK+TK I  ++NP W+E   +DL G  L  +  L V V D E +G ++ +G   +PL++ LA           LLD  ++PT   L L+V Y P                      +D     G EED  D    G+               GP                  +K      RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T+++   NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  +Y EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE NLLRP GV LR A F L+++RAEDLP+MD  +++ +K++F  D+ KK LVDP++   FAGK + + +   + +P+WN+ + +   FPSMCE++++++ DWDR+T +D + T  + +S I+A G                    DN GFLPTFGPC++N +GSPREF+  PD +  LN GKGEGVAYRGR+++ L T L E  EQ  E LP   D +L+ +K+LRRRKY L AAF SA+M+  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FD        G  Y++LPWGN KP  V+  +WE++S R+   N  L++ D++ +N++++ +A+KA    E+    V    D+L+  CS+  P  +  E P  T LD  L  LRT  L  I++ AL ++   + +  AL   E +   LR L+ EPQNS+PD++IWM+ G KR  Y R+PA++VL+S     Y GR CG +QTI LK P      +    +P Q+R+KLW G   DE E+++   EG+LS+ AETYENQ   +LVG W T    +T P +SD +G+++L K++ +P  GW W GDW++ PE +L +D DAG   ++E+VF N+ R+PGG W      +TD+ G+      DI  P GW+WED EW  DLNR  DE+GWEY++    +     +VPVEKMY+  RRRR+VR R+    ++           + E WEYA LF  +FH + RKTD  RRRRW R+M+P++   PA                    V  +E      VD ++ED +    +   V +           P +  +F   +++ LR Y+YQAR+L A D+  FSDPYA V+FL+QSQ T     TL PTWDQTLIF++IEI G+PA+I E PP +++E++D+D  G DEF+GRC   P ++      R P L W+ LT+G++ AGELLAAFEL +Q +KP                        LP+ PP+R  NI+ V   I+P +QRT IEIL+WG+RNM  YQ+A+++SPS+  E GG  +Q+ +I+N   NPNF+   LF++V+LP+E+LY PP  +KV DNR FGR+P+VG   + S++ +   P   E+             GG +     +  E               D +I  D+                  K P     E+E ++            WWSK++AS+GE  KC  Y + ++DTL+VY T+LE VE +   +DFC  F LYRG+  ++ ++ SV GEFKG F+IYPLPE+    +P +   + L +  P EC+VR+YI++A  LQP DP+G  DPY+++ +GKK ++++D+YIP  L P FG+MFEL C LP++KDL+I + DYD +S D+ IGET IDLENR L+KF A CGLPQTYC+SGPN+WRD  +P+++L  FC+++ I  P Y+T+    V    + + +   E    PN H GP  ERLALHVL    L  EHVE+RPL+SPLQP IEQGKLQ WIDIFP  +   G PF ITPRK + + LR I+WNTKDVIL+D +L GEKMSDIYVKGW+ G +E +Q+TDVHYRSL GEGNFNWRFVFPF YLPAE +  V KK+ FW LD+TE ++P   V QIWDNDKFS DDFLG+L+L+L +MP PAK +++C L+QL   F+P   V   +LFE +   G+WPC  +E     L GK+EM LE++ E E   +PAG GRDEPN NPKLE P RPDTSFLWFTSP+KT KFI+W+ F+   I  II+ ++ L + +FVY+ P   A K+V
Sbjct:   20 SDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQSSELLVVVKDHETMGRNRFLGEAKIPLQEVLATPSLSASFNAPLLDAKQQPTGASLVLQVSYTPPPGAVPLFPPPASLAPSPTLPDMDLVPDTGGEEDTEDQGLTGDEAEPFLDQSAAVGPGGPTTPRKPPSHPPPHYPGAKRKRSSAPPRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIQKG-NSPLFNETLFFNVFDSPLELFDEPIFITVVDSRSLRTDALLGEFRMDVGTVYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLDKKDPSEDKEDIEGNLLRPTGVALRGAHFCLKLFRAEDLPQMDDAVMDNVKQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRVMDWDRLTHNDTVATTYLGMSKISATGGEIEEEPAGVLKSPQATDLDDNLGFLPTFGPCYVNLYGSPREFTGFPDPYAELNTGKGEGVAYRGRVLLSLETKLVEHSEQKVEDLP--ADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDTTCLPLASTTQYSRAVFDGGSLPLPVGCHYYYLPWGNVKPVVVLSSYWEDISHRIEIQNQLLRVADRLEANLEQVHLALKAQCSSEDVDALVAQLTDELLADCSQ--PLCDIHEIPSATHLDQYLLRLRTRHLSQIKEAALALKLGHSELSTALEQAEDWLLHLRALAEEPQNSLPDIIIWMLQGDKRVAYQRVPAHEVLFSRRGPSYCGRNCGKLQTIFLKYPM---EGMPGARMPVQIRIKLWFGLSVDEKEFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWAWAGDWFVCPEKTLLHDADAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPKHWVPVEKMYYTHRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPA-------------------AVFALEGALGGMVDDKSEDSMSVSTLSFGVNR-----------PTISCIFDYGNRYHLRCYLYQARDLPAMDKDSFSDPYAIVSFLHQSQKTVVEKNTLNPTWDQTLIFYEIEIFGEPASIAEHPPCIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPAGELLAAFEL-IQREKPAIHHIPGFEMHETSRILDETEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQMASISSPSLVVECGGQTVQSCVIRNLRKNPNFDVCTLFMEVMLPREDLYCPPIVVKVIDNRQFGRRPVVGQCTIRSLENFLCDPYSAESP---------SPQGGPDDVSLLSPGE---------------DVLIDIDD------------------KEPLIPVQEEEFID------------WWSKFFASVGEREKCGSYLEKDFDTLKVYDTQLENVEAFGGLSDFCNTFKLYRGRTQEETDDPSVIGEFKGLFKIYPLPEDPAIPMPPRQFHQ-LAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRIKAPVYRTDR---VTFQDKDYTIEEIEAGRLPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWIDIFPKVLGRPGPPFNITPRKARRFFLRCIIWNTKDVILDDLSLTGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLPAEQVCAVAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAEKCSLDQLDDTFHPEWFV---SLFEQKTVKGWWPCVTEEGEKKMLAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRCAIILFIILFILLLFLGVFVYAFPNYAAMKLV 2086          
BLAST of Fer-1-related vs. UniProt/SwissProt
Match: sp|Q69ZN7|MYOF_MOUSE (Myoferlin OS=Mus musculus OX=10090 GN=Myof PE=1 SV=2)

HSP 1 Score: 1591.63 bits (4120), Expect = 0.000e+0
Identity = 937/2134 (43.91%), Postives = 1325/2134 (62.09%), Query Frame = 3
Query:   90 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEV--QLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDET--DNAEIGNSG--SGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG----------DNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNS-DYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDE-WQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKA----DDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKP-GTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTD--KPLPFTPPKRG-NIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQ---LQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            + V V +ATN+   +  GK DP V + F+ +KKKTK++   LNP W+E L FDL G  L  +  L + V D E IG +KL+G+  V L+DL G +         +LL++  + T   ++L + Y PP         G+     G   ++        D         G SG  S  Q+  +    +++R+  S KPQDFQIR++V+E RQL G NI PV KV    Q  +T++K   N+P ++  FF+N HI+ +EL DE IS  ++NS  LR+D L+G FK D+  +Y+EP H  M KWLLL+DPED +SGAKGY+K    +LG GDE P     +  +SD++E+NLL PAG+ LR  TF L++YRAED+P+MD    + +K++F  +A KK LVDP++   FAGK++ T++   + +PEWN+ + + ++FPSMCE+IKL ++DWDR+T++D++GT  + LS IAA G          + GF+PTFGPC++N +GSPRE++  PD ++ LN GKGEGVAYRGR+ VEL+T L++ P + +++ PI+ D LL  +K+ RRRKY L A F SA+M+  V   ++FEVSIGNYGNK D T  P +STTQ + A+FDG +Y++LPW ++KP   +  +WE++S RL  VN  L + +++ SN++ +K  I+  +P  + A+  +   D++I      LP  E G++ +T LD  +  LR+  L  I + ALR+R EAT V+  L ++E + ++L  L+ EPQNSMPD++IWMI G+KR  Y RIPA+ VLYS +  +  G++CG  QTI LK P  K +      +P +LR+ +WLG    E +++    EG  ++ AE YENQA + G+W T   ++ R  +SD +G+++L +E   PP+GW W+GDW + PE SL  + DAG +++ ++V+ NENR PGG W  +   +TD  GD   +P ++  P GWEWED+ W  D+NR  DE+GWEY +    +     +V  EKMYH     R  R  +   + L    SS+++A    +D E WEYA L   +FH K+R +D  RRRRW RKM P +  G  AIF L                      E  +  D  TED  E  P   K K +   + G    P +   F + + + LR YIYQARNL+A D+  FSDPYA V+FL++S+ TE I  TL PTWDQT+IF ++EI G+P  +++ PP V IE+FD DQ+G+DEFLGR   +P+VK + +    P L W+ +  G++  G++L   EL L+      LP  P +R  N++ V  GIRP++Q T IEIL+WG+RNM  YQ+A+VTSPS+  E GG  +++ +IK+    PNF + +LF+ V LPKEELYMPP  IKV D+R FGRKP+VG   ++ +D +R  P   +  ++   P L  S       +   IE E            +T  +++                        K  + E+E+            +DWWSK+YAS GE  KC +Y    Y  L++Y  ELE V  +   TDF   F LYRGK+ ++E+ + VGEFKG+FRIYPLP++ +   P +   + LP S P EC VR+YI++ + LQP D +GL DPY+++ LGKK++ ++D YIPN L P FGRM+EL C LP +KDL+I V DYD  + D+ +GET IDLENRFL++F + CG+P+ YC+SG N WRD  +PT++L+        PPP    +   + Y G R + L  FE N   + H G   ERLALH+L    L  EHVETR L S  QP I QGKLQ W+D+FP S+   G PF ITPRK K Y LR+I+WNTKDVIL+++++ GE MSDIYVKGW++G +E +Q+TDVHYRSLDGEGNFNWRFVFPF YLPAE + IV KKEHFWS+D+TE R+P   ++QIWDNDKFS DD+LG LEL+L +   PAK S++C L+    L+A +P  + K  +LFE R   G+WPCY D+ GT  + GK+EM LE+L E EA  +PAG GR EPN NPKL+PPNRP+TSFLWFT+P KT +FI+W+ FKW  IG +++ ++ L V + +YS+P   + K+V
Sbjct:    2 LRVIVESATNIPKTKF-GKPDPIVSVIFKDEKKKTKKVDNELNPVWNEILEFDLRGIPLDSSSSLVIVVKDFETIGQNKLIGTATVSLKDLIGDQNRSLPYKQTSLLNEKGQDTGATIDLVIGYTPPSAPHPNDPSGTSVPGMGEEEEEDQGDEDRVDGIVRGPGPKGPSGTVSEAQLARRITKGKSSRRMLSNKPQDFQIRVRVIEGRQLCGNNIRPVVKVHICGQTHRTRIKRG-NNPFFDELFFYNVHITPSELMDEIISIRVYNSHSLRADCLMGEFKIDVGFVYDEPGHAVMRKWLLLNDPEDTSSGAKGYMKVSMFVLGTGDEPPPEKRDRDNDSDDVESNLLLPAGIALRWVTFMLKIYRAEDIPQMDDAFSQTVKEIFGGNADKKNLVDPFVEVSFAGKKVCTNIIERNANPEWNQVVNLQIKFPSMCEKIKLTVYDWDRLTKNDVVGTTYLYLSKIAASGGEVEATTGETEVGFVPTFGPCYLNLYGSPREYTGFPDPYDELNSGKGEGVAYRGRIFVELNTFLEKKPPE-KKLEPISSDDLLVVEKYQRRRKYSLSAVFHSATMLQDVGEAIQFEVSIGNYGNKFDATCKPLASTTQYSRAVFDGNYYYYLPWAHTKPVVTLTSYWEDISHRLDAVNTLLVMAERLQSNIEAVKSGIQGKIPANQLAEVWLKLIDEVIEDTRYTLPVTE-GKANVTVLDTQIRKLRSRFLSQIHEAALRMRSEATDVKSTLLEIEEWLDKLMQLTEEPQNSMPDIIIWMIRGEKRLAYARIPAHQVLYSTSGGNASGKYCGKTQTILLKYPQEKTN---GPKVPVELRVNIWLGLSAVEKKFNSF-AEGTFTVFAEMYENQALVFGKWGTSG-LVGRHKFSDVTGKIKLKREFFLPPKGWEWEGDWVVDPERSLLTEADAGHTEFTDEVYQNENRYPGGEWKQAEDTYTDANGDKAASPSEMTCPPGWEWEDDAWIYDINRAVDEKGWEYGITIPPDNKPKSWVAAEKMYHT---HRRRRLVRKRKKDLTQTASSTARAMEELEDREGWEYASLIGWKFHWKQRSSDTFRRRRWRRKMAPSETHGAAAIFKL----------------------EGALGADT-TEDGEEKGPE--KQKHSATTVFG-ANTPIVSCNFDRVYIYHLRCYIYQARNLMALDKDSFSDPYAHVSFLHRSKTTEIIHSTLNPTWDQTIIFDEVEIFGEPQTVLQNPPNVTIELFDNDQVGKDEFLGRSICSPLVKLNSETDITPKLLWHPVMNGDKACGDVLVTAELILRNKDGSNLPILPSQRAPNLYMVPQGIRPVVQLTAIEILAWGLRNMKNYQMASVTSPSLVVECGGERVESVVIKSLKKTPNFPSSVLFMKVFLPKEELYMPPLVIKVIDHRQFGRKPVVGQCTIDHLDRFRCDPYAGKEDIV---PQLKASLMSAPPCREVVIEIE------------DTKPLLAS-----------------------KLSEKEEEI------------VDWWSKFYASSGEHEKCGQYIQKGYSKLKIYDCELEDVADFEGLTDFSDTFKLYRGKSDENEDPSVVGEFKGSFRIYPLPDDPSVPAPPRQFRE-LPDSVPQECTVRIYIVQGLQLQPQDNNGLCDPYIKITLGKKVIEDRDHYIPNTLNPVFGRMYELSCYLPQEKDLKISVYDYDTFTRDEKVGETTIDLENRFLSRFGSHCGIPEQYCVSGVNTWRDQLRPTQLLQNVARFKGFPPPVLSEDGSRIRY-GGRDYHLDEFEANKILHQHLGAPEERLALHILRTQGLVPEHVETRTLHSTFQPNISQGKLQMWVDVFPKSLGPPGPPFNITPRKAKKYYLRVIIWNTKDVILDEKSITGEDMSDIYVKGWISGSEENKQKTDVHYRSLDGEGNFNWRFVFPFDYLPAEQLCIVAKKEHFWSIDQTEFRVPPRLIIQIWDNDKFSLDDYLGFLELDLHRTIIPAKTSEKCSLDMIPDLKAMDP-LKAKTASLFEQRSMKGWWPCYADKDGTRVMAGKVEMTLEVLNEREADERPAGKGRSEPNMNPKLDPPNRPETSFLWFTNPCKTMRFIVWRRFKWVIIGLLLLLILLLFVAVLLYSLPNYLSMKIV 2044          
BLAST of Fer-1-related vs. UniProt/SwissProt
Match: sp|Q9NZM1|MYOF_HUMAN (Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1)

HSP 1 Score: 1584.7 bits (4102), Expect = 0.000e+0
Identity = 927/2150 (43.12%), Postives = 1329/2150 (61.81%), Query Frame = 3
Query:   90 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEV--QLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGP-------QIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG-----------------------DNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYI-GRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDE-WQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKA----DDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKP-GTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTD--KPLPFTPPKRG-NIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQ---LQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            + V V +A+N+   +  GK DP V + F+ +KKKTK++   LNP W+E L FDL G  L  +  LG+ V D E IG +KL+G+  V L+DL G ++       ++LL++  + T   ++L + Y PP         G      G      +    +ED  DNA  G    GP       Q+  +    + +R+  S KPQDFQIR++V+E RQL G NI PV KV    Q  +T++K   N+P ++  FF+N +++ +EL DE IS  ++NS  LR+D L+G FK D+  +Y+EP H  M KWLLL+DPED +SG+KGY+K    +LG GDE P     +  +SD++E+NLL PAG+ LR  TF L++YRAED+P+MD    + +K++F  +A KK LVDP++   FAGK++ T++   + +PEWN+ + + ++FPS+CE+IKL ++DWDR+T++D++GT  + LS IAA G                       + GF+PTFGPC++N +GSPRE++  PD ++ LN GKGEGVAYRGR++VEL+T L++TP   +++ PI+ D LL  +K+ RRRKY L A F SA+M+  V   ++FEVSIGNYGNK D T  P +STTQ + A+FDG +Y++LPW ++KP   +  +WE++S RL  VN  L + +++ +N++ +K  I+  +P  + A+  +   D++I      LP  E G++ +T LD  +  LR+  L  I + A+R+R EAT V+  L ++E + ++L  L+ EPQNSMPD++IWMI G+KR  Y RIPA+ VLYS + +   G++CG  QTI LK P  K++      +P +LR+ +WLG    E +++    EG  ++ AE YENQA + G+W T   ++ R  +SD +G+++L +E   PP+GW W+G+W + PE SL  + DAG +++ ++V+ NE+R PGG+W P+   +TD  GD   +P ++  P GWEWED+ W  D+NR  DE+GWEY +    +     +V  EKMYH     R  R  +   + L    SS+++A     D E WEYA L   +FH K+R +D  RRRRW RKM P +  G  AIF L                      E  +  D  TED  E     ++ +K +         P +   F + + + LR Y+YQARNLLA D+  FSDPYA + FL++S+ TE I  TL PTWDQT+IF ++EI+G+P  +++ PP VI+E+FD DQ+G+DEFLGR   +P+VK + +    P L W+ +  G++  G++L   EL L+      LP  PP+R  N++ V  GIRP++Q T IEIL+WG+RNM  +Q+A++TSPS+  E GG  +++ +IKN    PNF + +LF+ V LPKEELYMPP  IKV D+R FGRKP+VG   +  +D +R  P   +  ++   P L  S       +   IE E            +T  +++                        K  + E+E++            DWWSK+YAS GE  KC +Y    Y  L++Y  ELE V  +   TDF   F LYRGK+ ++E+ + VGEFKG+FRIYPLP++ +   P +   + LP S P EC VR+YI++ ++LQP D +GL DPY+++ LGKK++ ++D YIPN L P FGRM+EL C LP +KDL+I V DYD  + D+ +GET IDLENRFL++F + CG+P+ YC+SG N WRD  +PT++L+        P P    +   + Y G R + L  FE N   + H G   ERLALH+L    L  EHVETR L S  QP I QGKLQ W+D+FP S+   G PF ITPRK K Y LR+I+WNTKDVIL+++++ GE+MSDIYVKGW+ G +E +Q+TDVHYRSLDGEGNFNWRFVFPF YLPAE + IV KKEHFWS+D+TE R+P   ++QIWDNDKFS DD+LG LEL+L     PAK  ++C L+    L+A NP  + K  +LFE +   G+WPCY ++ G   + GK+EM LE+L E+EA  +PAG GRDEPN NPKL+ PNRP+TSFLWFT+P KT KFI+W+ FKW  IG + + ++ L V + +YS+P   + K+V
Sbjct:    2 LRVIVESASNIPKTKF-GKPDPIVSVIFKDEKKKTKKVDNELNPVWNEILEFDLRGIPLDFSSSLGIIVKDFETIGQNKLIGTATVALKDLTGDQSRSLPYKLISLLNEKGQDTGATIDLVIGYDPPSAPHPNDLSGPSVPGMGG---DGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVVKVHVCGQTHRTRIKRG-NNPFFDELFFYNVNMTPSELMDEIISIRVYNSHSLRADCLMGEFKIDVGFVYDEPGHAVMRKWLLLNDPEDTSSGSKGYMKVSMFVLGTGDEPPPERRDRDNDSDDVESNLLLPAGIALRWVTFLLKIYRAEDIPQMDDAFSQTVKEIFGGNADKKNLVDPFVEVSFAGKKVCTNIIEKNANPEWNQVVNLQIKFPSVCEKIKLTIYDWDRLTKNDVVGTTYLHLSKIAASGGEVEDFSSSGTGAASYTVNTGETEVGFVPTFGPCYLNLYGSPREYTGFPDPYDELNTGKGEGVAYRGRILVELATFLEKTPPD-KKLEPISNDDLLVVEKYQRRRKYSLSAVFHSATMLQDVGEAIQFEVSIGNYGNKFDTTCKPLASTTQYSRAVFDGNYYYYLPWAHTKPVVTLTSYWEDISHRLDAVNTLLAMAERLQTNIEALKSGIQGKIPANQLAELWLKLIDEVIEDTRYTLPLTE-GKANVTVLDTQIRKLRSRSLSQIHEAAVRMRSEATDVKSTLAEIEDWLDKLMQLTEEPQNSMPDIIIWMIRGEKRLAYARIPAHQVLYSTSGENASGKYCGKTQTIFLKYPQEKNN---GPKVPVELRVNIWLGLSAVEKKFNSF-AEGTFTVFAEMYENQALMFGKWGTSG-LVGRHKFSDVTGKIKLKREFFLPPKGWEWEGEWIVDPERSLLTEADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAWSYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYH---THRRRRLVRKRKKDLTQTASSTARAMEELQDQEGWEYASLIGWKFHWKQRSSDTFRRRRWRRKMAPSETHGAAAIFKL----------------------EGALGADT-TEDGDEK---SLEKQKHSATTVFGANTPIVSCNFDRVYIYHLRCYVYQARNLLALDKDSFSDPYAHICFLHRSKTTEIIHSTLNPTWDQTIIFDEVEIYGEPQTVLQNPPKVIMELFDNDQVGKDEFLGRSIFSPVVKLNSEMDITPKLLWHPVMNGDKACGDVLVTAELILRGKDGSNLPILPPQRAPNLYMVPQGIRPVVQLTAIEILAWGLRNMKNFQMASITSPSLVVECGGERVESVVIKNLKKTPNFPSSVLFMKVFLPKEELYMPPLVIKVIDHRQFGRKPVVGQCTIERLDRFRCDPYAGKEDIV---PQLKASLLSAPPCRDIVIEME------------DTKPLLAS-----------------------KLTEKEEEIV------------DWWSKFYASSGEHEKCGQYIQKGYSKLKIYNCELENVAEFEGLTDFSDTFKLYRGKSDENEDPSVVGEFKGSFRIYPLPDDPSVPAPPRQFRE-LPDSVPQECTVRIYIVRGLELQPQDNNGLCDPYIKITLGKKVIEDRDHYIPNTLNPVFGRMYELSCYLPQEKDLKISVYDYDTFTRDEKVGETIIDLENRFLSRFGSHCGIPEEYCVSGVNTWRDQLRPTQLLQNVARFKGFPQPILSEDGSRIRY-GGRDYSLDEFEANKILHQHLGAPEERLALHILRTQGLVPEHVETRTLHSTFQPNISQGKLQMWVDVFPKSLGPPGPPFNITPRKAKKYYLRVIIWNTKDVILDEKSITGEEMSDIYVKGWIPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFDYLPAEQLCIVAKKEHFWSIDQTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDMIPDLKAMNP-LKAKTASLFEQKSMKGWWPCYAEKDGARVMAGKVEMTLEILNEKEADERPAGKGRDEPNMNPKLDLPNRPETSFLWFTNPCKTMKFIVWRRFKWVIIGLLFLLILLLFVAVLLYSLPNYLSMKIV 2057          
BLAST of Fer-1-related vs. TrEMBL
Match: A0A267FV95 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001839g4 PE=4 SV=1)

HSP 1 Score: 2351.24 bits (6092), Expect = 0.000e+0
Identity = 1256/2140 (58.69%), Postives = 1562/2140 (72.99%), Query Frame = 3
Query:   78 EMSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLA-GGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQT------DSAGAEEDETDNAEIGNSGSGPQIKIKK----VGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXX-XXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN-----GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTIN----LKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQD----SSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRG-NIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAE--------LTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMVGV 6395
            +MS + VTV +A NL N++  G+SDP+ ++E +G K +TK I  +LNP W E +  DL G  L+  D L V V D E IGPDKL+G  ++ L+DL  GGK+E+++   L D NKR     + + + Y  PK         +    +G    QT      D      D+ D    G  G G + + K+      KR TR   STK QDFQIRI++VEARQLQG NISPVC+V C NQ+KQT++K STNSP W  +FFFNF++S A+L +E +   +FNSR+LRSDA+IG+FKFDL M+YEE  H ++NKWLLLSDPED   GAKGYLK CA ILGPGDEA     +S  +E ++IE+NLLRPAGVQLRPATFTLRVYRAEDLP+MD++I +G++K+FT   + KELVDPY++FQFAGKE++T  KY +DHPEWNEEL++GLQFPSMCERIK Q+FDWDRMTEDDIIGT  ID+  I+AQGD      G+LP FGPCF+NF+GSPREFS L D++E+LN GKGEGVAYRGR+++EL T L ETPEQ +E   I  D LLK QKFLRRRKYRLHAAF SASMI+ VD+PVEFE+SIGNYGNKLDE++ P++STTQPTNA+FDG  Y+FLPWGN+KPCTVV+  WE++  RL+++NF  +I++K+  N++KI VAIKA LP+EEQAQF I+A DDLI+ C+K+LP WE G+SP  ELDLNL +LR NEL NIR+ A ++REE TSVE+A+N+L+SF NQ+R ++ EPQNS PDVVIWM+   KR  YYRIPAY+VL+S N D+ G+FCG VQ +     LK+P++K S+     IPA +RL +WLG EKDE EWHKMQ EG LS+LAETYEN+  ++ +W    P   RP WSD+SGRVE++KE + PP GW WD DWY+SPELSLFYDKDAG S++ EDV+VNE R+PGG W  + V++TD+KGDP    + + LP GW W+DEW+VD NRPCDEEGWEYTVEASMGG+VPVEKM+HMCRRRRY+R R +       ++      +   D ++ WEYA  F  +FH  +R  DMVRRRRWHRKM P KPG P  FN++E   +                                              K LMA PR+ L++  + KWQLRAY++QAR+LLAGDQ+G SDPYARV F  +S  TE ID++LCPTWDQTLIF  +E+  DP +I   PP V++E+FD DQ+GEDEFLGR  + PMVK  P DPR+PVLQW+ + KG+++ GELLAAFEL+L  D P+P TPPKRG ++F V DGI+P++QRTGIEIL WGVRNM  +QL +VTSPS+EFEIGGH + +D+IKNT  NPNF  PLLF+DV+LPKE LY+PP NI+VRD+R FGRKP+VG+HV+  +D YR  PL +E   +++FPA                   L++ HS+E   R  +     + ++ T  K       +L                V+D++ +DEDIDWWSKYYAS G+  KC KY D+ YDTL++Y   LE  E ++ F+DFC+ +   RGKNLDD+E   VGEFKGTFRIYPLPE++   LP K LEKG+P S P++CIVRVY IKAIDLQPNDPSGLADPYVE++LGKK + NKD YIPNCL P FG++FELKCILPI KDL IR+KDYDF+SSDDVIGET IDLENR+L+KF A  GLPQ+Y   GPN+WRD  KP EIL  FC KN++P P ++    + + +G + F L  FE N K N H+GP +ERLALHVLN LPL KEHVETRPL+SPLQPGIEQGKLQCW+DIFPA   T   P  I PRKPK Y+LRII+WNTKDV+LE+ ++ GE MSDIYVKGWLAGIDE+QETDVHYRSLDGEGNFNWRF FP QYLP EN+M+VKKKEH +SLD TEQ LP + V+QIWDNDKFSADDFLGTLELNL+ MPAP KKS+QC ++QL A+N +  +K INLFEC+RAYGYWPC NDE    E        + GKIEMELELLT EEAA +PAGLG+DEPNENP L+PP RP+TSFLWFTSPWKTFK+I+WKNFKWY IG ++  +  L++VLF+Y+IPGLTAR+MVGV
Sbjct:    2 KMSKLIVTVDSAANLPNVDTFGESDPFCIVEIKGLKGQTKVIDNDLNPVWKEKIELDL-GPPLSPDDKLTVTVKDHETIGPDKLLGMCEIALKDLVKGGKSEMEVNAPLQDANKRAVGATVKVMIVYVGPKGKGTGVHYTTDSSPSGGGGGQTMDAEDDDEEEEAFDQADGGGGGGGGGGKKSRRKRNVGGAAKRKTRAKLSTKLQDFQIRIRIVEARQLQGANISPVCRVTCYNQMKQTRIKKSTNSPYWGETFFFNFNVSPADLMEELVECGVFNSRRLRSDAMIGAFKFDLGMLYEEDGHVFLNKWLLLSDPEDPQGGAKGYLKICAVILGPGDEAPSFKQASSADEDEDIESNLLRPAGVQLRPATFTLRVYRAEDLPKMDTEIFQGVRKIFTG-TSTKELVDPYLVFQFAGKEVRTETKYTNDHPEWNEELRMGLQFPSMCERIKFQMFDWDRMTEDDIIGTNYIDIPLISAQGDTDKDSEGYLPMFGPCFVNFYGSPREFSELGDQYESLNEGKGEGVAYRGRVLLELKTELGETPEQSKE--EIGDDQLLKVQKFLRRRKYRLHAAFSSASMISEVDAPVEFEISIGNYGNKLDESVPPTASTTQPTNAVFDGVHYYFLPWGNTKPCTVVESQWEDIGFRLHSINFLHRILEKLDENIEKIHVAIKAKLPDEEQAQFTIAAIDDLIVMCNKDLPEWEPGQSPANELDLNLQSLRENELKNIRRAASKLREECTSVEEAVNELDSFRNQIRAIAIEPQNSFPDVVIWMLCADKRIAYYRIPAYEVLFSKNEDFCGKFCGKVQNVQFKQFLKSPTVK-SDDPKLQIPALVRLMVWLGHEKDENEWHKMQREGNLSVLAETYENEWFII-KWMKNGP--GRPAWSDASGRVEILKEKLNPPPGWKWDKDWYVSPELSLFYDKDAGHSEFTEDVYVNETRLPGGAWQDAKVKYTDVKGDPYSDMQSVKLPEGWRWKDEWKVDFNRPCDEEGWEYTVEASMGGYVPVEKMFHMCRRRRYIRARVLAQAAAVEENQPRKGPAEITDPEQCWEYAIGFGQKFHTNKRPVDMVRRRRWHRKMVPTKPGAPCFFNMTESSGDN---------------------------------------------KALMAAPRMVLLYDNSRKWQLRAYVFQARDLLAGDQSGLSDPYARVCFHTRSGVTETIDQSLCPTWDQTLIFDNVEMFSDPYSIEANPPPVVVEIFDADQLGEDEFLGRALVQPMVKLDPTDPRRPVLQWHPIFKGSKEGGELLAAFELFLSAD-PMPPTPPKRGSDLFVVPDGIKPVLQRTGIEILCWGVRNMQSFQLMSVTSPSVEFEIGGHQVISDVIKNTKRNPNFQQPLLFMDVMLPKETLYLPPMNIRVRDHRQFGRKPMVGLHVIKCLDEYRTEPLSEEFDAISNFPA-------------------LLNAHSNE---RPVNLAPKVETEVTTKAKALVNLLTSL----------------VIDISQLDEDIDWWSKYYASTGDVKKCRKYVDLGYDTLKLYTHSLEFSENFDNFSDFCSTYGFQRGKNLDDDEGNVVGEFKGTFRIYPLPEDLGLPLPLKQLEKGIPDSNPVDCIVRVYTIKAIDLQPNDPSGLADPYVEIELGKKRVDNKDKYIPNCLSPVFGQVFELKCILPIDKDLYIRIKDYDFLSSDDVIGETVIDLENRYLSKFNACVGLPQSYYAEGPNQWRDSRKPKEILADFCGKNYLPEPQFEGT--DCLRLGAKTFYLDSFEPNRKSNPHYGPDDERLALHVLNCLPLVKEHVETRPLYSPLQPGIEQGKLQCWVDIFPAQFGTPPIPINIEPRKPKDYELRIIIWNTKDVVLEEISITGEAMSDIYVKGWLAGIDEKQETDVHYRSLDGEGNFNWRFKFPMQYLPTENVMVVKKKEHIFSLDATEQFLPPNLVVQIWDNDKFSADDFLGTLELNLSSMPAPKKKSRQCGVDQLPAYNKD--IKLINLFECKRAYGYWPCVNDEKPEDERLTGFKHRIAGKIEMELELLTAEEAALRPAGLGQDEPNENPHLDPPKRPETSFLWFTSPWKTFKYIVWKNFKWYIIGALLTVVFGLLLVLFIYAIPGLTARRMVGV 2045          
BLAST of Fer-1-related vs. TrEMBL
Match: A0A1I8GWS6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 2320.04 bits (6011), Expect = 0.000e+0
Identity = 1245/2156 (57.75%), Postives = 1552/2156 (71.99%), Query Frame = 3
Query:   78 EMSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLA-GGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXX-XXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKK----VGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNG---------------------FLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRG-NIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPA-LNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDS-----MISEDNQLQTPXXXXXXXXXTLSAKSPKRKKD--------------------------EDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAE-LTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSI 6362
            +MS + VTV +A NL N++  G+SDP+ ++E +G K +TK I  +LNP W E +  DL G  L+  D L V V D E IGPDKL+G  ++ L+DL  GGK+E+++   L D NKR     + + + Y  PK                    +  D      D+ D    G  G G + + K+      KR TR   STK QDFQIRI++VEARQLQG NISPVC+V C NQ+KQT++K STNSP W  +FFFNF++S A+L +E +   +FNSR+LRSDA+IG+FKFDL M+YEE  H ++NKWLLLSDPED   GAKGYLK CA ILGPGDEAP   +S  +E ++IE+NLLRPAGVQLRPATFTLRVYRAEDLP+MD++I +G++K+FT   + KELVDPY++FQFAGKE++T  KY +DHPEWNEEL++GLQFPSMCERIK Q+FDWDRMTEDDIIGT  ID+  I+AQGD G                     +LP FGPCF+NF+GSPREFS L D++E+LN GKGEGVAYRGR+++EL T L ETPEQ +E   I  D LLK QKFLRRRKYRLHAAF SASMI+ VD+PVEFE+SIGNYGNKLDE++ P++STTQPTNA+FDG  Y+FLPWGN+KPCTVV+  WE++  RL+++NF  +I++K+  N++KI VAIKA LP+EEQAQF I+A DDLI+ C+K+LP WE G+SP  ELDLNL +LR NEL NIR+ A ++REE TSVE+A+N+L+SF NQ+R ++ EPQNS PDVVIWM+   KR  YYRIPAY+VL+S N D+ G+FCG VQ +  K+P++K S+     IPA +RL +WLG EKDE EWHKMQ EG LS+LAETYEN+  ++ +W    P   RP WSD+SGRVE++KE + PP GW WD DWY+SPELSLFYDKDAG S++ EDV+VNE            +++TD+KGDP    + + LP GW W+DEW+VD NRPCDEEGWEYTVEASMGG+VPVEKM+HMCRRRRY+R R +       ++  +   D ++ WEYA  F  +FH  +R  DMVRRRRWHRKM P KPG P  FN++E   +                                              K LMA PR+ L++  + KWQLRAY++QAR+LLAGDQ+G SDPYARV F  +S  TE ID++LCPTWDQTLIF  +E+  DP +I   PP V++E+FD DQ+GEDEFLGR  + PMVK  P DPR+PVLQW+ + KG+++ GELLAAFEL+L  D P+P TPPKRG ++F V DGI+P++QRTGIEIL WGVRNM  +QL +VTSPS+EFEIGGH + +D+IKNT  NPNF  PLLF+DV+LPKE LY+PP NI+VRD+R FGRKP+VG+HV+  +D YR  PL +E   +++FPA LN  S          +E E+ +   D+Q  +   S       S  +  Q P  ++  +   L    PK+K+                           + +    +D++ +DEDIDWWSKYYAS G+  KC KY D+ YDTL++Y   LE  E ++ F+DFC+ +   RGKNLDD+E   VGEFKGTFRIYPLPE++   LP K LEKG+P S P++CIVRVY IKAIDLQPNDPSGLADPYVE++LGKK + NKD YIPNCL P FG++FELKCILPI KDL IR+KDYDF+SSDDVIGET IDLENR+L+KF A  GLPQ+Y   GPN+WRD  KP EIL  FC KN++P P ++    + + +G + F L  FE N K N H+GP +ERLALHVLN LPL KEHVETRPL+SPLQPGIEQGKLQCW+DIFPA   T   P  I PRKPK Y+LRII+WNTKDV+LE+ ++ GE MSDIYVKGWLAGIDE+QETDVHYRSLDGEGNFNWRF FP QYLP EN+M+VKKKEH +SLD TEQ LP + V+QIWDNDKFSADDFLGTLELNL+ MPAP KKS+QC ++QL A+N +  +K INLFEC+RAYGYWPC NDE    E LTGKIEMELELLT EEAA +PAGLG+DEPNENP L+PP RP+TSFLWFTSPWKTFK+I+WKNFKWY IG ++  +  L++VLF+Y+I
Sbjct:    2 KMSKLIVTVDSAANLPNVDTFGESDPFCIVEIKGLKGQTKVIDNDLNPVWKEKIELDL-GPPLSPDDKLTVTVKDHETIGPDKLLGMCEIALKDLVKGGKSEMEVNAPLQDANKRAVGATVKVMIVYVGPKGKDTTDSSPSGGGGGQTMDAEDDDEEEEAFDQADGGGGGGGGGGKKSRRKRNVGGAAKRKTRAKLSTKLQDFQIRIRIVEARQLQGANISPVCRVTCYNQMKQTRIKKSTNSPYWGETFFFNFNVSPADLMEELVECGVFNSRRLRSDAMIGAFKFDLGMLYEEDGHVFLNKWLLLSDPEDPQGGAKGYLKICAVILGPGDEAPFKQASSADEDEDIESNLLRPAGVQLRPATFTLRVYRAEDLPKMDTEIFQGVRKIFTG-TSTKELVDPYLVFQFAGKEVRTETKYTNDHPEWNEELRMGLQFPSMCERIKFQMFDWDRMTEDDIIGTNYIDIPLISAQGDTGAFLNKNIKATCRRRDNRHPAGYLPMFGPCFVNFYGSPREFSELGDQYESLNEGKGEGVAYRGRVLLELKTELGETPEQSKE--EIGDDQLLKVQKFLRRRKYRLHAAFSSASMISEVDAPVEFEISIGNYGNKLDESVPPTASTTQPTNAVFDGVHYYFLPWGNTKPCTVVESQWEDIGFRLHSINFLHRILEKLDENIEKIHVAIKAKLPDEEQAQFTIAAIDDLIVMCNKDLPEWEPGQSPANELDLNLQSLRENELKNIRRAASKLREECTSVEEAVNELDSFRNQIRAIAIEPQNSFPDVVIWMLCADKRIAYYRIPAYEVLFSKNEDFCGKFCGKVQNVQFKSPTVK-SDDPKLQIPALVRLMVWLGHEKDENEWHKMQREGNLSVLAETYENEWFII-KWMKNGP--GRPAWSDASGRVEILKEKLNPPPGWKWDKDWYVSPELSLFYDKDAGHSEFTEDVYVNE-----------TLKYTDVKGDPYSDMQSVKLPEGWRWKDEWKVDFNRPCDEEGWEYTVEASMGGYVPVEKMFHMCRRRRYIRARVLAQAAAVEENQPAEITDPEQCWEYAIGFGQKFHTNKRPVDMVRRRRWHRKMVPTKPGAPCFFNMTESSGDN---------------------------------------------KALMAAPRMVLLYDNSRKWQLRAYVFQARDLLAGDQSGLSDPYARVCFHTRSGVTETIDQSLCPTWDQTLIFDNVEMFSDPYSIEANPPPVVVEIFDADQLGEDEFLGRALVQPMVKLDPTDPRRPVLQWHPILKGSKEGGELLAAFELFLSAD-PMPPTPPKRGSDLFVVPDGIKPVLQRTGIEILCWGVRNMQSFQLMSVTSPSVEFEIGGHQVISDVIKNTKRNPNFQQPLLFMDVMLPKETLYLPPMNIRVRDHRQFGRKPMVGLHVIKCLDEYRTEPLSEEFDAISNFPALLNAHSNERPVNLAPKVETEVTTKAKDQQQLQRQQSDGAGNSASSVHPTQQPPSRQMSETQGLIDPPPKKKRSRIPGFLKRRKKKNKELKAKKMNFNFFKSDEGKTIDISQLDEDIDWWSKYYASTGDVKKCRKYVDLGYDTLKLYTHSLEFSENFDNFSDFCSTYGFQRGKNLDDDEGNVVGEFKGTFRIYPLPEDLGLPLPLKQLEKGIPDSNPVDCIVRVYTIKAIDLQPNDPSGLADPYVEIELGKKRVDNKDKYIPNCLSPVFGQVFELKCILPIDKDLYIRIKDYDFLSSDDVIGETVIDLENRYLSKFNACVGLPQSYYAEGPNQWRDSRKPKEILADFCGKNYLPEPQFEGT--DCLRLGAKTFYLDSFEPNRKSNPHYGPDDERLALHVLNCLPLVKEHVETRPLYSPLQPGIEQGKLQCWVDIFPAQFGTPPIPINIEPRKPKDYELRIIIWNTKDVVLEEISITGEAMSDIYVKGWLAGIDEKQETDVHYRSLDGEGNFNWRFKFPMQYLPTENVMVVKKKEHIFSLDATEQFLPPNLVVQIWDNDKFSADDFLGTLELNLSSMPAPKKKSRQCGVDQLPAYNKD--IKLINLFECKRAYGYWPCVNDEKPEDERLTGKIEMELELLTAEEAALRPAGLGQDEPNENPHLDPPKRPETSFLWFTSPWKTFKYIVWKNFKWYIIGALLTVVFGLLLVLFIYAI 2088          
BLAST of Fer-1-related vs. TrEMBL
Match: A0A1I8HHA5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 2281.52 bits (5911), Expect = 0.000e+0
Identity = 1227/2133 (57.52%), Postives = 1523/2133 (71.40%), Query Frame = 3
Query:  183 KKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLA-GGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXX-XXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKK----VGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXX-XXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNG---------------------FLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRG-NIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPA-LNESSGGVEGAQFDNIEEELMSIHSD---------------EQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKD--------------------------EDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAE-LTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIP 6365
            K +TK I  +LNP W E +  DL G  L+  D L V V D E IGPDKL+G  ++ L+DL  GGK+E+++   L D NKR     + + + Y  PK                    +  D      D+ D    G  G G + + K+      KR TR   STK QDFQIRI++VEARQLQG NISPVC+V C NQ+KQT++K STNSP W  +FFFNF++S A+L +E +   +FNSR+LRSDA+IG+FKFDL M+YEE  H ++NKWLLLSDPED   GAKGYLK CA ILGPGDEA     +S  +E ++IE+NLLRPAGVQLRPATFTLRVYRAEDLP+MD++I +G++K+FT   + KELVDPY++FQFAGKE++T  KY +DHPEWNEEL++GLQFPSMCERIK Q+FDWDRMTEDDIIGT  ID+  I+AQGD G                     +LP FGPCF+NF+GSPREFS L D++E+LN GKGEGVAYRGR+++EL T L ETPEQ +E   I  D LLK QKFLRRRKYRLHAAF SASMI+ VD+PVEFE+SIGNYGNKLDE++ P++STTQPTNA+FDG  Y+FLPWGN+KPCTVV+  WE++  RL+++NF  +I++K+  N++KI VAIKA LP+EEQAQF I+A DDLI+ C+K+LP WE G+SP  ELDLNL +LR NEL NIR+ A ++REE TSVE+A+N+L+SF NQ+R ++ EPQNS PDVVIWM+   KR  YYRIPAY+VL+S N D+ G+FCG VQ +  K+P++K S+     IPA +RL +WLG EKDE EWHKMQ EG LS+LAETYEN+  ++ +W    P   RP WSD+SGRVE++KE + PP GW WD DWY+SPELSLFYDKDAG S++ EDV+VNE R+PGG W  + V++TD+KGDP    + + LP GW W+DEW+VD NRPCDEEGWEYTVEASMGG+VPVEKM+HMCRRRRY+R R +       ++  +   D ++ WEYA  F  +FH  +R  DMVRRRRWHRKM P KPG P  FN++E   +                                              K LMA PR+ L++  + KWQLRAY++QAR+LLAGDQ+G SDPYARV F  +S  TE ID++LCPTWDQTLIF  +E+  DP +I   PP V++E+FD DQ+GEDEFLGR  + PMVK  P DPR+PVLQW+ + KG+++ GELLAAFEL+L  D P+P TPPKRG ++F V DGI+P++QRTGIEIL WGVRNM  +QL +VTSPS+EFEIGGH + +D+IKNT  NPNF  PLLF+DV+LPKE LY+PP NI+VRD+R FGRKP+VG+HV+  +D YR  PL +E   +++FPA LN  S          +E E+ +   D                 S    D+  +   Q Q P  ++  +   L    PK+K+                           + +    +D++ +DEDIDWWSKYYAS G+  KC KY D+ YDTL++Y   LE  E ++ F+DFC+ +   RGKNLDD+E   VGEFKGTFRIYPLPE++   LP K LEKG+P S P++CIVRVY IKAIDLQPNDPSGLADPYVE++LGKK + NKD YIPNCL P FG++FELKCILPI KDL IR+KDYDF+SSDDVIGET IDLENR+L+KF A  GLPQ+Y   GPN+WRD  KP EIL  FC KN++P P ++    + + +G + F L  FE N K N H+GP +ERLALHVLN LPL KEHVETRPL+SPLQPGIEQGKLQCW+DIFPA   T   P  I PRKPK Y+LRII+WNTKDV+LE+ ++ GE MSDIYVK          ETDVHYRSLDGEGNFNWRF FP QYLP EN+M+VKKKEH +SLD TEQ LP + V+QIWDNDKFSADDFLGTLELNL+ MPAP KKS+QC ++QL A+N +  +K INLFEC+RAYGYWPC NDE    E LTGKIEMELELLT EEAA +PAGLG+DEPNENP L+PP RP+TSFLWFTSPWKTFK+I+WKNFKWY IG ++  +  L++VLF+Y+IP
Sbjct:  193 KGQTKVIDNDLNPVWKEKIELDL-GPPLSPDDKLTVTVKDHETIGPDKLLGMCEIALKDLVKGGKSEMEVNAPLQDANKRAVGATVKVMIVYVGPKGKDTTDSSPSGGGGGQTMDAEDDDEEEEAFDQADGGGGGGGGGGKKSRRKRNVGGAAKRKTRAKLSTKLQDFQIRIRIVEARQLQGANISPVCRVTCYNQMKQTRIKKSTNSPYWGETFFFNFNVSPADLMEELVECGVFNSRRLRSDAMIGAFKFDLGMLYEEDGHVFLNKWLLLSDPEDPQGGAKGYLKICAVILGPGDEAPSFKQASSADEDEDIESNLLRPAGVQLRPATFTLRVYRAEDLPKMDTEIFQGVRKIFTG-TSTKELVDPYLVFQFAGKEVRTETKYTNDHPEWNEELRMGLQFPSMCERIKFQMFDWDRMTEDDIIGTNYIDIPLISAQGDTGAFLNKNIKATCRRRDNRHPAGYLPMFGPCFVNFYGSPREFSELGDQYESLNEGKGEGVAYRGRVLLELKTELGETPEQSKE--EIGDDQLLKVQKFLRRRKYRLHAAFSSASMISEVDAPVEFEISIGNYGNKLDESVPPTASTTQPTNAVFDGVHYYFLPWGNTKPCTVVESQWEDIGFRLHSINFLHRILEKLDENIEKIHVAIKAKLPDEEQAQFTIAAIDDLIVMCNKDLPEWEPGQSPANELDLNLQSLRENELKNIRRAASKLREECTSVEEAVNELDSFRNQIRAIAIEPQNSFPDVVIWMLCADKRIAYYRIPAYEVLFSKNEDFCGKFCGKVQNVQFKSPTVK-SDDPKLQIPALVRLMVWLGHEKDENEWHKMQREGNLSVLAETYENEWFII-KWMKNGP--GRPAWSDASGRVEILKEKLNPPPGWKWDKDWYVSPELSLFYDKDAGHSEFTEDVYVNETRLPGGAWQDAKVKYTDVKGDPYSDMQSVKLPEGWRWKDEWKVDFNRPCDEEGWEYTVEASMGGYVPVEKMFHMCRRRRYIRARVLAQAAAVEENQPAEITDPEQCWEYAIGFGQKFHTNKRPVDMVRRRRWHRKMVPTKPGAPCFFNMTESSGDN---------------------------------------------KALMAAPRMVLLYDNSRKWQLRAYVFQARDLLAGDQSGLSDPYARVCFHTRSGVTETIDQSLCPTWDQTLIFDNVEMFSDPYSIEANPPPVVVEIFDADQLGEDEFLGRALVQPMVKLDPTDPRRPVLQWHPILKGSKEGGELLAAFELFLSAD-PMPPTPPKRGSDLFVVPDGIKPVLQRTGIEILCWGVRNMQSFQLMSVTSPSVEFEIGGHQVISDVIKNTKRNPNFQQPLLFMDVMLPKETLYLPPMNIRVRDHRQFGRKPMVGLHVIKCLDEYRTEPLSEEFDAISNFPALLNAHSNERPVNLAPKVETEVTTKAKDQQQLQRQQSDGAGNSASSVHPADAADAASLQTQQPPSRQMSETQGLIDPPPKKKRSRIPGFLKRRKKKNKELKAKKMNFNFFKSDEGKTIDISQLDEDIDWWSKYYASTGDVKKCRKYVDLGYDTLKLYTHSLEFSENFDNFSDFCSTYGFQRGKNLDDDEGNVVGEFKGTFRIYPLPEDLGLPLPLKQLEKGIPDSNPVDCIVRVYTIKAIDLQPNDPSGLADPYVEIELGKKRVDNKDKYIPNCLSPVFGQVFELKCILPIDKDLYIRIKDYDFLSSDDVIGETVIDLENRYLSKFNACVGLPQSYYAEGPNQWRDSRKPKEILADFCGKNYLPEPQFEGT--DCLRLGAKTFYLDSFEPNRKSNPHYGPDDERLALHVLNCLPLVKEHVETRPLYSPLQPGIEQGKLQCWVDIFPAQFGTPPIPINIEPRKPKDYELRIIIWNTKDVVLEEISITGEAMSDIYVK----------ETDVHYRSLDGEGNFNWRFKFPMQYLPTENVMVVKKKEHIFSLDATEQFLPPNLVVQIWDNDKFSADDFLGTLELNLSSMPAPKKKSRQCGVDQLPAYNKD--IKLINLFECKRAYGYWPCVNDEKPEDERLTGKIEMELELLTAEEAALRPAGLGQDEPNENPHLDPPKRPETSFLWFTSPWKTFKYIVWKNFKWYIIGALLTVVFGLLLVLFIYAIP 2257          
BLAST of Fer-1-related vs. TrEMBL
Match: A0A1I8GE74 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 2241.08 bits (5806), Expect = 0.000e+0
Identity = 1216/2163 (56.22%), Postives = 1517/2163 (70.13%), Query Frame = 3
Query:   81 MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLA-GGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQ---------------IKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXX-XXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNW--APSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSK---ADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEK--DTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPV-----------------------QVKVKKTNENLKGLMAVPRLF------LVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRG-NIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNV---LDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAE-LTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMVGV 6395
            MS + VTV +A+NL N++  G SDPY ++E +G K KTK I  +LNP W E   FD+ G  LT  D + + V D EKIG DKL+G  ++ L+DL  GGK  +++   L D NKR     + L + Y   K     A           A D       E DE D      S  G                   +    +R TR   S KPQDFQIR+KVVEARQLQG NISPVC+V C NQ+KQT++K STNSP W  +FFFNFH+S A+L +E +   +FNSR+LRSDALIG+FKFDL M+YEE  H +++KWLLL DPED   GAKGYLK CA ILGPGDEA     ++  +E ++IE NLLRPAGVQLRPATFTLRVYRAEDLPRMDS++ +G+KK+FT   + KELVDPY++FQFAGKE+ T  KY  DHPEWNEEL+IGLQFPSMCERIKLQ+FDWDR+TEDD+IGTA ID+S I+AQG++G+LPTFGP FINF+GSPREFS L D F ALN GKGEGVAYRGRL+ EL T L ETP+Q +    I++D L K QKFLRRRK+RLHAAF SA+MI+ VD+PVEFE+SIGNYGNKLD+T+ P++STTQPTNA+FDG  Y+FLPWG +KPC VVD  WE++S RL+ VNF  KII ++  +++KI VA+KA LPEEEQAQFVI+A DDLI+ C+K+LP WE G+SP+ ELDL L +LR N+L +IR  A ++R E TSVE+ALN+L+SF +Q+R ++ EPQNS PDVVIWM+   KR  YYR+PAY+VLY  N D+ G+FCG VQ +  K PS+K +E     IPA +RL +WLG EKDE EW +MQ EG LS+LAETYEN+   V +W    P   RP WSD+SGRVE++K+ + PP GW W+ DW++SPELSLFYDKDAG S++LEDV+VNE R+PGG W      V++TD+KGDPC   ++I  P GW W+DEW+VD NRPCDEEGWEYTVEASMGG+VP EKM+HMCRRRRY+RPR +++      ++        D ++ WEYA  F  +FHA +R  D+VRRRRW RK+ P KPG P  FN++EK  D  +    + +     +  ES     K +    +P PV                       Q+           L   P         L  +K  +WQLRAY++QAR+LLAGDQTG SDPYARV F  +S  TERIDKTLCPTWDQTLIF  +E   DP ++ + PP V++E+FDYDQ+GEDEFLGR  + PMVK  P + R+PVLQW+++TKG+++ GELLAAFEL+L T +PLP TP KRG +IF V DG++P++QRTGIEILSWGVRNM  +QL +VTSPS+EFEIGGH+  TDII NT  NPNF   LLF+DV+LPKE LY+PP NI++RD+R FGRKP+VG+HV+  +D YR  P+ +E     +FPA                   L++ HS   ++R   S                              +    VLN+   +DL+ +DEDIDWWSKYYAS G+  KC KY DM YDT++VY T LE  E+++ F DFC  F   RGKNLDDEE   VGEFKG+FRIYPLP++    +P + L KG   S P++C VR+Y+IK+ DLQPNDPSGLADPYVE++LGK+ + +KD YIPN L P                       DYDF+SSDDVIGET IDLENR+L+KF A  GLPQ+Y + GPN+WRD  KP EIL  FC KNF+P P ++    + + +G + F L  FE   K N HFGP +ERLALHVLN LPL KEHVETRPL+SPLQPGIEQGKLQCW+DIFP    T+ +P ++ PR+PK Y+LR+IVWNTKDV+LE+ ++ GE+MSDIYV+GWLAG+DE+QETDVHYRSLDG GNFNWRF FP  YLPAEN+M+VKKKEHFWSLD TEQ +P + V+QIWDNDKFSADDFLGTLELNL+ MPAP KKS+QC + QL A+     VK INLF+C+RAYGYWPC NDE    E LTGK+EMELELLT EEA  +PAG G+DEPNENP LEPP RP+TSFLWF SPWKTFK I+WKN+KWY +G  ++ +  L++ +F+Y++PGL ARK++GV
Sbjct:    1 MSKLIVTVDSASNLPNVDTFGASDPYCIVEIKGLKSKTKVIDNDLNPVWKEKFEFDV-GPPLTAEDKVIITVKDYEKIGSDKLLGMCEISLKDLVKGGKQTIEVNAPLQDANKRAIGATIKLMIAYIGKKKDGSTANERQGTVVDVRADDGDSELDYEVDEPDGDFGDPSLEGHHDQHHRRRAGGHHRRRRNVGSAARRKTRSKLSNKPQDFQIRVKVVEARQLQGANISPVCRVTCYNQMKQTRIKKSTNSPYWGETFFFNFHVSPADLMEELVECGVFNSRRLRSDALIGAFKFDLGMLYEEDGHAFLHKWLLLCDPEDPQGGAKGYLKICAVILGPGDEAPSFKQTANADEDEDIEANLLRPAGVQLRPATFTLRVYRAEDLPRMDSEMFQGVKKIFTG-TSTKELVDPYLVFQFAGKEVHTDTKYTDDHPEWNEELRIGLQFPSMCERIKLQMFDWDRLTEDDVIGTAYIDISLISAQGESGYLPTFGPAFINFYGSPREFSELGDEFCALNEGKGEGVAYRGRLLAELRTELGETPDQSKG--DISEDQLTKVQKFLRRRKFRLHAAFGSATMISEVDAPVEFEISIGNYGNKLDDTVPPTASTTQPTNAVFDGVHYYFLPWGKTKPCAVVDSQWEDISFRLHAVNFLHKIIQRLDESIEKINVAMKAKLPEEEQAQFVIAALDDLILMCNKDLPEWEPGQSPVNELDLYLTSLRENQLKSIRAAATKLRAECTSVEEALNELDSFRSQIRAVAVEPQNSFPDVVIWMLCADKRIAYYRMPAYEVLYCKNDDFRGKFCGKVQNVLFKPPSVKQNEENRLEIPALVRLTVWLGHEKDESEWLRMQREGSLSVLAETYENEWYFV-KWMKSGP--GRPAWSDASGRVEILKDKLTPPAGWKWERDWFVSPELSLFYDKDAGHSEFLEDVYVNETRMPGGAWQDVGQSVKYTDVKGDPCSEFENIKPPEGWRWKDEWKVDFNRPCDEEGWEYTVEASMGGYVPTEKMFHMCRRRRYIRPRVLISATSPIDETKKMPEEITDPEQCWEYAIGFGQKFHANKRPVDLVRRRRWQRKLLPTKPGAPCFFNMTEKAGDNLRSCRLRSINACFLMLRESAKLSKKCSWLAAQPPPVISEHRSEGWGCNSFGSSCHCSLRQLSFALVISAASSLNESPSFIWNGPTQLSTRKPRRWQLRAYVFQARDLLAGDQTGLSDPYARVIFHTRSGVTERIDKTLCPTWDQTLIFDSVEAFSDPKSLADNPPPVVVEIFDYDQLGEDEFLGRAVVQPMVKLSPTEKRRPVLQWHSITKGSKEGGELLAAFELFLLTGEPLPPTPSKRGADIFVVPDGVKPVLQRTGIEILSWGVRNMQAFQLMSVTSPSVEFEIGGHLATTDIIANTKRNPNFQETLLFMDVMLPKETLYLPPMNIRIRDHRQFGRKPMVGLHVIKCLDDYRTEPINEEYDAFANFPA-------------------LLNAHS---AQRPVGSA----------------------------PRGTTAVLNMRMKIDLSQVDEDIDWWSKYYASTGDLSKCRKYVDMGYDTMKVYTTSLESAESFHGFNDFCDTFGFVRGKNLDDEEGNIVGEFKGSFRIYPLPDDFGAPMPLRQLGKGRMDSSPVDCTVRLYVIKSFDLQPNDPSGLADPYVEIELGKRKMDSKDKYIPNTLNP-----------------------DYDFLSSDDVIGETVIDLENRYLSKFNARVGLPQSYYVEGPNQWRDVQKPKEILADFCSKNFLPEPRFEGA--DCLRLGAKTFYLDSFEPTRKSNPHFGPEDERLALHVLNCLPLVKEHVETRPLYSPLQPGIEQGKLQCWVDIFPCLAGTLPQPTDVRPREPKKYELRVIVWNTKDVVLEETSITGEQMSDIYVRGWLAGLDEKQETDVHYRSLDGVGNFNWRFKFPMDYLPAENVMVVKKKEHFWSLDATEQCIPPNLVVQIWDNDKFSADDFLGTLELNLSSMPAPKKKSRQCGVEQLPAY--GKSVKMINLFDCKRAYGYWPCINDEKPDGERLTGKVEMELELLTVEEAQLRPAGFGQDEPNENPHLEPPKRPETSFLWFASPWKTFKHIVWKNYKWYILGAFLVVIFGLLLAMFIYAVPGLAARKVMGV 2079          
BLAST of Fer-1-related vs. TrEMBL
Match: A0A1I8I3Z6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 2233.76 bits (5787), Expect = 0.000e+0
Identity = 1169/1986 (58.86%), Postives = 1447/1986 (72.86%), Query Frame = 3
Query:  666 FQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXX-XXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN-----------------------------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRG-NIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPA-LNESSGGVEGAQFDNIEEELMSIHSD---------------EQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKD--------------------------EDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAE-LTGKIXXXXXXXXXXXXXXKPAGLGRD------------XXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIP 6365
             QIRI++VEARQLQG NISPVC+V C NQ+KQT++K STNSP W  +FFFNF++S A+L +E +   +FNSR+LRSDA+IG+FKFDL M+YEE  H ++NKWLLLSDPED   GAKGYLK CA ILGPGDEA     +S  +E ++IE+NLLRPAGVQLRPATFTLRVYRAEDLP+MD++I +G++K+FT   + KELVDPY++FQFAGKE++T  KY +DHPEWNEEL++GLQFPSMCERIKLQ+FDWDRMTEDDIIGT  ID+  I+AQGD                              G+LP FGPCF+NF+GSPREFS L D++E+LN GKGEGVAYRGR+++EL T L ETPEQ +E   I  D LLK QKFLRRRKYRLHAAF SASMI+ VD+PVEFE+SIGNYGNKLDE++ P++STTQPTNA+FDG  ++FLPWGN+KPCTVV+  WE++  RL+++NF  +I++K+  N++KI VAIKA LP+EEQAQF I+A DDLI+ C+K+LP WE G+SP  ELDLNL +LR NEL NIR+ A ++REE TSVE+A+N+L+SF NQ+R ++ EPQNS PDVVIWM+   KR  YYRIPAY+VL+S N D+ G+FCG VQ +  K+P++K S+     IPA +RL +WLG EKDE EWHKMQ EG LS+LAETYEN+  ++ +W    P   RP WSD+SGRVE++KE + PP GW WD DWY+SPELSLFYDKDAG S++ EDV+VNE R+PGG W  + V++TD+KGDP    + + LP GW W+DEW+VD NRPCDEEGWEYTVEASMGG+VPVEKM+HMCRRRRY+R R +       ++  +   D ++ WEYA  F  +FH  +R  DMVRRRRWHRKM P KPG P  FN++E   +                                              K LMA PR+ L++  + KWQLRAY++QAR+LLAGDQ+G SDPYARV F  +S  TE ID++LCPTWDQTLIF  +E+  DP +I   PP V++E+FD DQ+GEDEFLGR  + PMVK  P DPR+PVLQW+ + KG+++ GELLAAFEL+L  D P+P TPPKRG ++F V DGI+P++QRTGIEIL WGVRNM  +QL +VTSPS+EFEIGGH + +D+IKNT  NPNF  PLLF+DV+LPKE LY+PP NI+VRD+R FGRKP+VG+HV+  +D YR  PL +E   +++FPA LN  S          +E E+ +   D                 S    D+  +   Q Q P  ++  +   L    PK+K+                           + +    +D++ +DEDIDWWSKYYAS G+  KC KY D+ YDTL++Y   LE  E ++ F+DFC+ +   RGKNLDD+E   VGEFKGTFRIYPLPE++   LP K LEKG+P S P++CIVRVY IKAIDLQPNDPSGLADPYVE++LGKK + NKD YIPNCL P FG++FELKCILPI KDL IR+KDYDF+SSDDVIGET IDLENR+L+KF A  GLPQ+Y   GPN+WRD  KP EIL  FC KN++P P ++    + + +G + F L  FE N K N H+GP +ERLALHVLN LPL KEHVETRPL+SPLQPGIEQGKLQCW+DIFPA   T   P  I PRKPK Y+LRII+WNTKDV+LE+ ++ GE MSDIYVKGWLAGIDE+QETDVHYRSLDGEGNFNWRF FP QYLP EN+M+VKKKEH +SLD TEQ LP + V+QIWDNDKFSADDFLGTLELNL+ MPAP KKS+QC ++QL A+N +  +K INLFEC+RAYGYWPC NDE    E LTGKIEMELELLT EEAA +PAGLG+D            +      L     P+TSFLWFTSPWKTFK+I+WKNFKWY IG ++  +  L++VLF+Y+IP
Sbjct:   13 LQIRIRIVEARQLQGANISPVCRVTCYNQMKQTRIKKSTNSPYWGETFFFNFNVSPADLMEELVECGVFNSRRLRSDAMIGAFKFDLGMLYEEDGHVFLNKWLLLSDPEDPQGGAKGYLKICAVILGPGDEAPSFKQASSADEDEDIESNLLRPAGVQLRPATFTLRVYRAEDLPKMDTEIFQGVRKIFTG-TSTKELVDPYLVFQFAGKEVRTETKYTNDHPEWNEELRMGLQFPSMCERIKLQMFDWDRMTEDDIIGTNYIDIPLISAQGDTATVSSNIKILGAFLNKNIKARRRDNRHPAGYLPMFGPCFVNFYGSPREFSELGDQYESLNEGKGEGVAYRGRVLLELKTELGETPEQSKE--EIGNDQLLKVQKFLRRRKYRLHAAFSSASMISEVDAPVEFEISIGNYGNKLDESVPPTASTTQPTNAVFDGVHFYFLPWGNTKPCTVVESQWEDIGFRLHSINFLHRILEKLDENIEKIHVAIKAKLPDEEQAQFTIAAIDDLIVMCNKDLPEWEPGQSPANELDLNLQSLRENELKNIRRAASKLREECTSVEEAVNELDSFRNQIRAIAIEPQNSFPDVVIWMLCADKRIAYYRIPAYEVLFSKNEDFCGKFCGKVQNVQFKSPTVK-SDDPKLQIPALVRLMVWLGHEKDENEWHKMQREGNLSVLAETYENEWFII-KWMKNGP--GRPAWSDASGRVEILKEKLNPPPGWKWDKDWYVSPELSLFYDKDAGHSEFTEDVYVNETRLPGGAWQDAKVKYTDVKGDPYSDMQSVKLPEGWRWKDEWKVDFNRPCDEEGWEYTVEASMGGYVPVEKMFHMCRRRRYIRARVLAQAAAVEENQPAEITDPEQCWEYAIGFGQKFHTNKRPVDMVRRRRWHRKMVPTKPGAPCFFNMTESSGDN---------------------------------------------KALMAAPRMVLLYDNSRKWQLRAYVFQARDLLAGDQSGLSDPYARVCFHTRSGVTETIDQSLCPTWDQTLIFDNVEMFSDPYSIEANPPPVVVEIFDADQLGEDEFLGRALVQPMVKLDPTDPRRPVLQWHPILKGSKEGGELLAAFELFLSAD-PMPPTPPKRGSDLFVVPDGIKPVLQRTGIEILCWGVRNMQSFQLMSVTSPSVEFEIGGHQVISDVIKNTKRNPNFQQPLLFMDVMLPKETLYLPPMNIRVRDHRQFGRKPMVGLHVIKCLDEYRTEPLSEEFDAISNFPALLNAHSNERPVNLAPKVETEVTTKAKDQQQLQRQQSDGAGNSASSVHPADAADAASLQTQQPPSRQMSETQGLIDPPPKKKRSRIPGFLKRRKKKNKELKAKKMNFNFFKSDEGKTIDISQLDEDIDWWSKYYASTGDVKKCRKYVDLGYDTLKLYTHSLEFSENFDNFSDFCSTYGFQRGKNLDDDEGNVVGEFKGTFRIYPLPEDLGLPLPLKQLEKGIPDSNPVDCIVRVYTIKAIDLQPNDPSGLADPYVEIELGKKRVDNKDKYIPNCLSPVFGQVFELKCILPIDKDLYIRIKDYDFLSSDDVIGETVIDLENRYLSKFNACVGLPQSYYAEGPNQWRDSRKPKEILADFCGKNYLPEPQFEGT--DCLRLGAKTFYLDSFEPNRKSNPHYGPDDERLALHVLNCLPLVKEHVETRPLYSPLQPGIEQGKLQCWVDIFPAQFGTPPIPINIEPRKPKDYELRIIIWNTKDVVLEEISITGEAMSDIYVKGWLAGIDEKQETDVHYRSLDGEGNFNWRFKFPMQYLPTENVMVVKKKEHIFSLDATEQFLPPNLVVQIWDNDKFSADDFLGTLELNLSSMPAPKKKSRQCGVDQLPAYNKD--IKLINLFECKRAYGYWPCVNDEKPEDERLTGKIEMELELLTAEEAALRPAGLGQDEPNENPHLDPPKKNLILFSLRRRKAPETSFLWFTSPWKTFKYIVWKNFKWYIIGALLTVVFGLLLVLFIYAIP 1941          
BLAST of Fer-1-related vs. Ensembl Cavefish
Match: myofl (myoferlin like [Source:ZFIN;Acc:ZDB-GENE-111116-2])

HSP 1 Score: 1554.65 bits (4024), Expect = 0.000e+0
Identity = 906/2095 (43.25%), Postives = 1268/2095 (60.53%), Query Frame = 3
Query:   90 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG---------------DNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSD-YIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEA----SMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKP-GTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRG-NIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEAS-VGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYF 6302
            M   V+ +   I  + +G  DP   + F+G+KKKTK I   LNP W+E L FDL G+AL  +  + V V D E IG DK +GS+ V LR+LA G+T    + N+   N++     +    Q+        +A             + T   G +    + A  G  G  PQ  I+   KR  +K+ + KPQDFQIRI+++E RQL G NI PV KV    Q  +T+++   N+P ++  FF+N ++  +ELFDE I  ++          +   F F +S       H+ M +WLLLSD +D +SGA+GYLK    ILG GD+ P     + EE D+IE+NLL PAGV LR AT  L+VYRAED+P+MD    + +K +F  +  KK LVDP++   FAGK++ T +   + +PEWN+ + + ++FPSMCERIKL +FDWDR + +D IGT  ++L+ IA+ G               + GFLP FGPC++N +GS REFS+LPD +E LN+GKGEGVAYRGR+++ELST LD+  ++  +   I+ D +L +QK+ R+RKY L A F SA M+     P++FEVSIGNYGNK+D T  P +STTQ + A+FDG  Y++LPW ++KP  ++   WE++S RL +VN  L I D++ S++  +K A+ A +PE   A+  +     LI H    LP  +  ++ LT LD+ L  LR + +  IR+ A R+REEAT V+  L D+E +  +L+ ++ EPQNSMPD++IWM+ G+KR  Y RIPA  VL+S  S+   G++CG  QTI ++ P  K+  +    IP QLRL +WLG    E +++    EG  S+ AE YENQA + G+W T   ++ R  +SD +G+++L +E   PP+GW W+G+W+I PE  L  + DAG +++ ++V+ N++R PGG W P+   +TD+ G+   +P ++  P GW+WEDEW  D NR  DE+GWEY +          +V  EKMYH+       +      +K+AN  +   K   D  WEY+ L   +FH KER +D  RRRR  RKM P    G  AIF L                    E    +++D++T             KK    L G    P +  +F +++ + LR Y+YQARNLL  D+  FSDPY  V+FL+ S+ TE I   L PTWDQTLIF+ IEI+GDP  I   PP V++E+FD DQ+G+DE +GRC   P+VK +P  P  P L W+ +    R  GE+L A EL L+    +P  PP+RG  ++ V  GIRP++Q T IEIL+WG+RNM  YQ+A ++SPS+  E GG  +QT +IKN   NPNF   +LFL VLLPKEE+Y PP  +KV D+R FGRKP+VG   + S++ +R  P  D A                                  E SR   D +I  +++ Q                             +LD  + +E +DWWSK +AS+GE  KC  Y    Y TL VY+ ELE V  ++  TDFC  F L+RGK  DDEE+ S VGEFKG+FRIYPL ++  E LP     + LP S P EC+VR+Y+++ IDLQP D +G+ DPY+++ LGKK++ ++D+Y PN L PEFGR FE+ C LP  KDL+I V D+D +S DD +G+T IDLENR L++F + CGL QTYC+SG N+WRD  KP++IL+       +PPP    +   + + G R++ L   E     + H GP+ ER+ LHVL    L  EHVETR L S  QP + QG++Q W+D+FP S+   G P +ITPRK K + LR+++WNT DVIL++ ++ GE+MSDIYVKGW+ G++E +Q+TDVHYRSLDG+GNFNWR+VF F YLPAE + +V +KEHFWSLD+TE R+P   ++QIWDNDKFS DD+LGT+EL+L  +  P+K  ++C LN L    P+  +   +LF  +   G+WPC  +E G   LTGK+EM LE++ E+E   +PAG GRDEPN NP+LE PNRPDTSFLWFT+P KT KFI+W+ FKW F
Sbjct:    1 MLKVVVESAKGIPKKTLGNPDPIAGVVFRGEKKKTKAISNELNPVWNEVLEFDLKGSALDSSSFVEVVVKDYETIGKDKPIGSVKVFLRELASGQTRSLPSRNIPLINEKKQD--IGPGTQFLCSPAGVSSAGKDGTDAD-----EDTGDWGDQRTPGEPATPGQPGKPPQKMIRTGRKR--QKALANKPQDFQIRIRIIEGRQLAGNNIKPVVKVNVCGQTHRTRIRRG-NNPFFDEIFFYNVNMLPSELFDENIYIQL---------CMFFLFCFVIS-----EAHSIMRRWLLLSDTDDSSSGARGYLKASMIILGTGDDPPVEKREESEEQDDIESNLLLPAGVTLRSATLALKVYRAEDMPQMDDAFAQSVKNMFGGEGDKKNLVDPFLEVGFAGKKLCTKIIEKNANPEWNQLVNVQVKFPSMCERIKLTMFDWDRFSSNDAIGTTYLNLTKIASSGGEFEGSVPHFYSVGNEVGFLPAFGPCYLNLYGSLREFSDLPDPYEELNFGKGEGVAYRGRVLIELSTRLDDKVDKKVDD--ISNDDILVAQKYQRKRKYSLCAVFHSACMLQEPGEPIQFEVSIGNYGNKMDSTCKPLASTTQYSCAVFDGNHYYYLPWADTKPVVILTSFWEDISHRLDSVNIILFIADRLQSSLTSLKTAMLAKVPETRLAEIWLK----LINHFP--LPELDT-KANLTALDIQLKKLRDSAIAGIREAARRMREEATDVKATLPDIEEWLERLQQIADEPQNSMPDIIIWMLRGEKRMAYARIPANQVLFSTLSEQATGKYCGKKQTIFMQYPMDKNKGV---KIPVQLRLNVWLGLSAHEKKFNSF-AEGMFSVFAEMYENQAQVFGKWGTTG-LVGRHKFSDVTGKIKLKQECFLPPRGWEWEGEWFIDPERCLLTEADAGHTEFTDEVYENQSRFPGGEWKPAAEPYTDVNGEKAQSPNEVECPPGWKWEDEWSFDSNRAVDEKGWEYGITVPPSDKPSSWVAAEKMYHI----HRRKRMVRPRKKIANAPTIEKKESGD-GWEYSSLIGWKFHRKERSSDTFRRRRKRRKMAPADSVGASAIFKL--------------------EGALGVDIDEKTS------------KKDAAKLFG-ANTPTVSCIFNRSYLYHLRVYVYQARNLLPMDKDSFSDPYCHVSFLHVSKTTEIIKANLNPTWDQTLIFNNIEIYGDPQTIALNPPSVVMEIFDSDQVGKDEAMGRCVCPPVVKLNPSSPVSPKLLWFPVLMKGRSGGEMLVAAELILKDKSEMPLVPPRRGEKLYMVPQGIRPVVQLTAIEILAWGLRNMKTYQMAAISSPSLVVECGGQTVQTGVIKNIKKNPNFPGSVLFLKVLLPKEEMYTPPIVLKVIDHRPFGRKPIVGQCTIESLEEFRCDPYTDTA----------------------------------EVSRTARDVIIDMEDRRQ-----------------------------ILDGQM-EEAVDWWSKLFASIGENEKCGPYLQKGYSTLTVYQQELEAVTGFHGLTDFCNTFKLHRGKTDDDEEDPSVVGEFKGSFRIYPLSDD-PEILPPPRQFRELPESGPQECLVRIYVVRCIDLQPKDSNGMCDPYIKISLGKKVIDDRDNYKPNTLNPEFGRTFEMSCFLPQDKDLKISVYDFDLLSRDDKVGDTVIDLENRLLSRFGSHCGLSQTYCVSGVNQWRDQLKPSQILQNLARLRGVPPPQIADDGSWLSFAG-REYNLQDLEAGKVLHQHLGPAKERICLHVLRKQGLVPEHVETRTLHSSYQPTLSQGRIQMWVDVFPKSLGMPGPPVDITPRKAKKFFLRVVIWNTTDVILDETSITGERMSDIYVKGWMPGMEEDKQKTDVHYRSLDGDGNFNWRYVFGFDYLPAEQLCLVSRKEHFWSLDKTEFRIPPKLIIQIWDNDKFSLDDYLGTVELDLIHLLPPSKTPEKCSLNMLTQ-GPSKNLPFKSLFAQKSVRGWWPCAMEEDGKKVLTGKVEMTLEIVEEKEVEERPAGKGRDEPNMNPRLEHPNRPDTSFLWFTNPCKTMKFIVWRRFKWVF 1952          
BLAST of Fer-1-related vs. Ensembl Cavefish
Match: dysf (dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) [Source:ZFIN;Acc:ZDB-GENE-070501-1])

HSP 1 Score: 1426.38 bits (3691), Expect = 0.000e+0
Identity = 859/1919 (44.76%), Postives = 1174/1919 (61.18%), Query Frame = 3
Query:  666 FQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFD----LSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN-------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVRE-EATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWED-EWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPM-KPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKP--------------------LPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEAS-VGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGID-ERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFK 6293
             Q+R++++E RQL G NI PV KV    Q K+T++K   N+P ++ +FF NF  + A+LFDE I   +F+S+ LR+D++IG FK      LS+++   +H  + KWLLL+DP+D ++GA+GYLK    +L  GDE P+      +E ++IE NLLRPAG+ LR A FTL+VYRAEDLP+MD   ++G+K+    D+ +K LVDP +   FA       V ++              QFPSMCE++++++ DWDR + +D+IGT  + +S I A G         GFLPTFGPCF+N +GS REF+   D  EALN GKGEGVAYRGR+++EL+T L E  EQ  E   I  D LL  +KF+R+RKY L AAF SA+ +  VD  ++FEVSIGNYGNK D T  P +STTQ + A+FDG  Y++LPW N KP  V+   WE++S R+  +N  L I+D + SN+  +++ +++   +++  Q V+   DD+I  CS+ELP ++     +T LD +L  LR   L  I + AL ++    T +   L   E +  +LR+L+ EPQNS+PD+VIWM+ G +R  Y+RIPA++VL+S    Y G+ CG +QT+ +K P           IPAQLR+K+W G   D   +++  +EG LS+ AETYENQ   +LVG W T    +T P +SD +GR+ L KE+ KP  GW W GDW I PE +L YD DAG   ++E+VF N+ R+PGG W      +TD+ G+   A  +I  P GW WED EW  DL R  D++GWEY +    +     +VP EKMYH  RRRR++R R+   +K+           + EHWEYA LF  +FH K+RKTD  RR RW R+M+P+ K G  AIF L                  E     ++N  K T  E+                 G +              + LR Y+YQAR+LLA D+  FSDP+A V+FL+QSQ T  +   L PTWDQTLIF+++EI GD     ++PP +++E++D D  G DEF+GR    P + + P       L WY + K  ++AGELLAAF+L ++ DKP                    LP  PP R  NIF V   I+P++QRT IEIL+WG+RN+  +QLA+VTSPS++ E GG ++Q+ +I+NT  NPNF+   LF+DV LP+EELYMPP  IKV DNR FGRKP+VG   + S++ +R  P   EA         NE        +FD +           Q+ R+ D +I  D+                  K P     +DE +            DWWSK+YAS GE  KC  Y +   DTLQVY+ ELE+VE + +  DFC  F LYRG+  ++ E+ S VGEFKG F+IYPLP + +   P +   + LP +    C+VRVYII+A +LQP D +G  DPYV++ LGKK + + D+YIP  L P FG+MFEL C LP++KDL+I + DYD +S D+ IGET IDLENRFL+++ A  GLPQ+YC+SG N+WRD  KPT++L++ C++     P YK +    VY    ++  +  +   +P+ H GP  ERLAL VL    L  EHVETRPL+SPLQP IEQG+LQ W+DIFP S+   G PF ITPRK K + LR I+WNT DVIL+D ++ GE+MSDIYVKGW+ G +  +Q+TDVHYRSL GEGNFNWRF+FPF YLPAE +  + KKEHFWSLD+ E ++P    +QIWDNDKFS DD+LG LE++L  M  PAK  ++C L  L      +Q K ++LFE +   G+WPC  D+ G   L GK+EM LE+++E+E   +PAGLGRDEPN NP LE P RP+TSFLWF+SP+KT KFI +   K
Sbjct:  175 IQVRVRIIEGRQLPGVNIKPVVKVTVGGQTKRTRIKKG-NNPFFDETFFLNFFETPADLFDEPIFITVFDSKSLRTDSVIGEFKVMCACFLSVLFG--RHAILRKWLLLADPDDLSAGARGYLKASMFVLAAGDEPPTDKKEGVQEKEDIEANLLRPAGLTLRGANFTLKVYRAEDLPQMDDAFMDGMKQFLGFDSNRKNLVDPLVEINFAVLLTHVHVPFS--------------QFPSMCEKMRIRILDWDRASHNDVIGTTHLCMSKICAPGGEIEVDDSLGFLPTFGPCFVNLYGSLREFTAFSDPHEALNLGKGEGVAYRGRVLLELNTKLCERVEQRVE--DIQPDDLLVVEKFMRKRKYSLFAAFYSATHLQDVDDAIQFEVSIGNYGNKFDCTCLPLASTTQYSRAVFDGCHYYYLPWKNVKPVVVLSSEWEDISPRIEALNMLLSIVDHLESNLKLVQLELQSGGDQDDLEQTVVKLLDDVIADCSEELPEFDNWPC-VTPLDKSLRRLRKVNLKQIEQAALTLKHGPETELSSVLEQAEDWAQRLRSLAEEPQNSLPDIVIWMLQGDRRVAYHRIPAHEVLFSQG--YCGKHCGQLQTVFMKYPQGGGGCT---KIPAQLRVKVWFGLAADVKHFNQF-SEGHLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGRISLPKESFKPSPGWSWAGDWCIQPEKTLLYDADAGHMSFVEEVFENQMRLPGGQWIGMPEGYTDVNGEKATAKDEIECPPGWVWEDPEWSEDLKRAVDDQGWEYGITIPPDRRPKSWVPAEKMYHTNRRRRWIRLRRRDQQKMEALRKQHPDDSEREHWEYASLFGWKFHLKQRKTDSFRRCRWRRRMEPLEKTGPAAIFAL------------------ECSLVMRVNSMKFTRLEL-----------GRGKFGGTL--------------YHLRCYLYQARDLLAMDKDSFSDPFAIVSFLHQSQKTVTVRNNLNPTWDQTLIFYELEIFGDAEVTEKSPPNIVVELYDQDTYGTDEFMGRSVCQPSLVSSPR------LAWYPILKNGKEAGELLAAFQL-IRRDKPSIHRIPGQEVGNVSVLYDTDLPCPPPLREPNIFMVPLNIKPVLQRTAIEILAWGLRNLKSFQLASVTSPSLQVECGGRMVQSCVIRNTKKNPNFDINTLFIDVRLPREELYMPPLVIKVIDNRQFGRKPVVGQCTIRSLEEFRCQPESQEAE------PPNE--------EFDEV----------PQTPRD-DVLIDIDD------------------KEPLISGQDDEFM------------DWWSKFYASTGETKKCGSYLEKGLDTLQVYERELEKVEGFEQLADFCHTFKLYRGRTQEESEDPSVVGEFKGMFKIYPLPNDPSAPCPPRQFSQ-LPPNGIEVCLVRVYIIQAFNLQPKDANGKCDPYVKITLGKKSVNDHDNYIPCTLEPVFGKMFELTCSLPLEKDLKIMLYDYDMLSKDEKIGETVIDLENRFLSRYGARSGLPQSYCVSGVNQWRDQLKPTQLLQRLCQRRNYKLPIYKQDR---VYFRGHEYTAADLDEAKQPSPHLGPLEERLALLVLRRQGLVPEHVETRPLYSPLQPEIEQGRLQMWVDIFPKSLGPPGPPFNITPRKAKKFFLRCIIWNTSDVILDDVSVTGERMSDIYVKGWMHGHEGNKQKTDVHYRSLGGEGNFNWRFLFPFHYLPAEQLCTIDKKEHFWSLDKAESKIPPKITIQIWDNDKFSFDDYLGCLEMDLNHMLRPAKSPEKCGLELLS----RTQDKLVSLFEQKTVKGWWPCVCDKEGEKILAGKVEMSLEIVSEQEQDERPAGLGRDEPNMNPHLEDPQRPETSFLWFSSPYKTLKFINYAAMK 1952          

HSP 2 Score: 55.4546 bits (132), Expect = 9.758e-7
Identity = 30/88 (34.09%), Postives = 48/88 (54.55%), Query Frame = 3
Query:   90 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPL 353
            + V ++ A N++  +    SD Y  + ++G KKKTK I  N+NP W+E   +DL G  L  T  + V V D EK+G ++ +     P+
Sbjct:    2 LRVFILCAQNVLTHD-EDISDAYCCVAYEGSKKKTKVIKNNVNPVWNEGFEWDLKGIPLDSTAEIHVVVKDHEKMGRNRYVCVCVCPV 88          
BLAST of Fer-1-related vs. Ensembl Cavefish
Match: myof (myoferlin [Source:ZFIN;Acc:ZDB-GENE-040426-1138])

HSP 1 Score: 821.231 bits (2120), Expect = 0.000e+0
Identity = 505/1240 (40.73%), Postives = 722/1240 (58.23%), Query Frame = 3
Query:  666 FQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWN--ASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKF---DLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG----------DNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFC----NQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSN-NSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSK--ADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPM-KPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETE-DEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQT---DKPLPFTPPKRGN-IFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLI 4289
            F+IR++V+E RQL G NI PV KV    +  +T++K   N+P +N   SF+  F I          +  I N  K+       SF F   D+  IY+EP H  M KWLLL+DP+D + GAKGYLK  A I+G GD+ P   + +  +SD++E+NLL PAG+ LR  T  L+V+RAED+P+MD  I + +K  F     KK LVDP++   FAGK+I T +  ++ +PEWN+ + + ++FPSMCERIKL ++DWDR+T +D +GT  ++L+ IA+ G          D GFLP FGP +IN +GSPREF+ LPD +E LN+GKGEG AYRGR+++ELST LD   +   E   I+ D +L +QK+ RRRKY L A F SA+MI     P++FEVSIGNYGNKLD T  P +STTQ + A+FDG  Y++LPW ++KP   +   WE++S RL  VN  L I +++  N+ ++K A++A  P+   A+                   W+   S + E     +  R      I    L +          L    S+C        ++  +PQNSMPDV+IWM+ G+KR  Y R+PA+ VLYS       G++CG  QTI L+ P  K+       +PAQ+R+ +WLG    E +++   + G  ++ AE YENQA ++G+W T   ++ R  +SD +G+V+L  E   PP+GW W+GDW + P+ SL  + DAG S+++++V+ N+ R PGG W  +   +TD+ G+    P ++  P GW+W DEW  D  R  DE GWEY +    +     +V  EKMYH+       R +    +K+A   +++      D E WE++ L   +FH KER +D  RRRRW RKM P  + G  AIF L                      E  + +D E + D+   +   + +   N         P +  VF + +++ LR Y+YQARNL+A D+  FSDPY  V+FL+ SQ TE I  +L P WDQTLIF+++EI+GDP  I   PP V++E+FD DQ+G+DE LGR    P+VK  P     P L W  +      AGE+L + EL L+    +  LP  PPKRG+ ++ V  G+RP++Q T IEIL+WG+RNM  YQLA V+SPS+  E GG  +Q+ +IKN   +PNF+  +L L VLLPKEE+Y PP  +KV D+R FGRKP+VG   +NS++ YR  P +
Sbjct:  138 FKIRVRVIEGRQLPGNNIKPVVKVNVCGETHRTRIKRG-NNPFFNEVISFYTIFLIPGLMYLIRNYAV-IVNKVKIYIFICFTSFIFPQIDIGYIYDEPAHCVMRKWLLLNDPDDSSCGAKGYLKVSAFIVGTGDDPPVEKTDRDTDSDDVESNLLLPAGIALRWVTLQLKVFRAEDIPQMDDSISQSLKAAFGGTGDKKNLVDPFLEAWFAGKKICTKIIESNANPEWNQLVNLHVKFPSMCERIKLTVYDWDRLTRNDAVGTTYLNLTKIASSGGEVEAETGEPDVGFLPAFGPSYINLYGSPREFTGLPDPYEDLNFGKGEGAAYRGRVLIELSTKLDGKADTDVEA--ISNDDILVAQKYQRRRKYCLCAVFHSATMILEPGEPIQFEVSIGNYGNKLDSTCKPLASTTQYSCAVFDGNHYYYLPWADTKPVVAIMSFWEDISHRLDAVNIILNIANRLECNITELKTAVQAKAPDLRLAEI------------------WQKLVSQVLE-----DISRCFYFPTIHHTNLFLLNILNETALKLFLYVSYCIFCITWTLHMFPQPQNSMPDVIIWMLRGEKRVAYSRVPAHQVLYSVLGEQACGQYCGKTQTIVLQYPMDKNK---GSKLPAQVRVNMWLGLSTHEQKFNAFAS-GLFTVSAELYENQAKVLGKWGTTG-LLNRSKFSDVTGKVKLKHEYFLPPRGWQWEGDWMVEPQKSLLTEADAGHSEFVDEVYENQTRFPGGEWKDAAEPYTDVNGEKSHRPDELECPPGWKWMDEWTFDDKRAVDERGWEYGITIPPDDKPKSWVAAEKMYHV----HRRRRKIRPRKKVAGGTAATEVWLTGDSEDWEFSTLVGWKFHKKERSSDSFRRRRWIRKMAPSDRVGASAIFKL----------------------EGSLGIDTEGKGDDKGSKSDAINLLDAN--------TPNVSCVFDQGYEYHLRVYVYQARNLMALDKDSFSDPYVHVSFLHMSQTTEIIKASLNPMWDQTLIFNRVEIYGDPQTIARDPPQVVLEIFDSDQVGKDELLGRSTCPPLVKLDPGMDTPPKLLWRPVIHKGTPAGEVLVSAELILRNKTGETDLPLVPPKRGDELYMVPQGVRPVVQLTAIEILAWGLRNMKMYQLAPVSSPSLVVECGGERVQSAVIKNIKKSPNFSGNVLQLKVLLPKEEMYTPPIVLKVIDHRPFGRKPVVGQCTINSLEEYRCDPYV 1311          

HSP 2 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 324/614 (52.77%), Postives = 442/614 (71.99%), Query Frame = 3
Query: 4566 EDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASV-GEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQL-QAFNPNSQVK---NINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            E IDWWSK+YAS+GE  KC  Y    YDTL+V++ ELE V  Y   TDFC  F LYRGK  DDE++ +V GEFKG+F++YPL ++     P +   + LP S P EC+VR+Y+++ IDLQP D +GL DPY+++ LGKK++ ++D+YIPN L P FGRMFE+ C LP  KDL+I V D+D ++ D+ +GET IDLENR L++F + CGLPQTYC SG N+WRD  KP++IL+       + PP  + N + + + GQ +++LS FE N + + H GP+ ER++LHVL    L  EHVETR L+S  QP + QG LQ W+D+FP S+   G PF+I+PRK K Y LR+IVWNT +VIL++ ++ GE+MSDIYVKGW+ G +E +Q+TDVHYRSLDG+GNFNWRF++ F YLPAE + +V KKEHFWSLD+TE ++P   ++QIWDNDKFS DD+LGT+EL+L  + +PAK  ++C+L  L QA    S +K   + +LF  +   G+WPCY ++ G  EL GK+EM LE++ E+EA  +PAG GR+EPN NPKL PPNRP+TSF WFT+P KT KFI+W+ FKW FIG +++ LV L + + +YS+P   + K+V
Sbjct: 1337 ETIDWWSKFYASIGEHEKCGPYLQKGYDTLKVFENELENVTEYKGLTDFCNTFKLYRGKTEDDEDDPTVVGEFKGSFKVYPLSDDPAIPSPPRQFRE-LPDSGPQECVVRIYVVRGIDLQPKDNNGLCDPYIKISLGKKIVDDRDNYIPNTLNPVFGRMFEVSCFLPQDKDLKISVYDFDLLTHDEKVGETVIDLENRLLSRFGSYCGLPQTYCTSGLNQWRDQLKPSQILQNVARLKGVSPPRSEDNGNTLAFNGQ-EYRLSDFEANKELHQHLGPATERISLHVLRTQGLIPEHVETRTLYSTFQPTLSQGCLQMWVDVFPKSLGLPGPPFDISPRKAKKYVLRVIVWNTTNVILDETSITGERMSDIYVKGWMPGKEEDKQKTDVHYRSLDGDGNFNWRFIYEFDYLPAEQLCLVSKKEHFWSLDKTEFKIPPQLIIQIWDNDKFSLDDYLGTVELDLHHLISPAKMPEKCNLKMLEQAKASKSPLKFDSSKSLFAQKSVRGWWPCYIEKDGKKELGGKVEMTLEIVHEKEAEERPAGKGREEPNMNPKLNPPNRPETSFFWFTNPCKTMKFIVWRRFKWLFIGLLLLILVLLFIGILLYSLPNYISMKIV 1948          

HSP 3 Score: 75.485 bits (184), Expect = 6.902e-13
Identity = 43/104 (41.35%), Postives = 60/104 (57.69%), Query Frame = 3
Query:   90 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNL 401
            + V V +A+ L   +L G  DP   I F+G+ KKT+ I   +NP W E L FDL G+ L  +  + V V D E IG DKL+GS  + L+DLA G+ +   + NL
Sbjct:    2 LRVVVESASGLPKKKL-GNPDPITYILFKGETKKTRSINSEVNPVWKETLEFDLKGSPLDSSSFIDVIVKDFETIGKDKLIGSAKIYLKDLASGQAKSLPSKNL 104          
BLAST of Fer-1-related vs. Ensembl Cavefish
Match: fer1l6 (fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GENE-070912-312])

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 403/1044 (38.60%), Postives = 585/1044 (56.03%), Query Frame = 3
Query: 3468 FLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPP---KRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPL-------------IDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEW----------------------GKCNKYQDMNYDTLQ-------------VYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEAS---VGEFKGTFRIYPLP--ENINEKLPAKY-LEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTY---KTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNM---LP-----LTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLL-GEKMSDIYVKGWLAGI-DERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
             +++K  H++QLRA++YQAR L+A D TG SDP+ARV+F + +  T  I++TL PTW+Q L+  K+ +HG    + + PP + IEV+D D +G+ E+LG     P+VK   +    P L +  L  G+   G++L AFEL           PP     G+I+ V   IRP++++  IE+L WG+R + K QL  V  P +  E  G  + + +I++   NPNF+  +   +V LP++E   PP  I V D R FGR  LVG HV+N++  +++ P              I E +  +DF +L++ +       F      + + HS       +DS   E    ++ ++    K  T + +S                   D  IDWWSKYYAS+ +                       G  N    M  +T Q             +Y  ELE    +  F D+   F LYRGK  ++E  ++   VG FKG F +Y LP  E  +      Y + +G+P +  +  ++RVYI+ A +L P DP G ADPY+ ++LGK ++ ++D+YIP  L P FGR FE++   P +  L+I + DYD +  DD+IGET IDLENRF ++ RA CG+P  Y I G N WRDC KPT++L + C+ N +  P +   +    E VY G+  F                 S E LAL VL+    +P     L  EH+ETR L+   +PG++QG++Q W+DIFP  +   G P +I+PRKPK Y+LRII+WNT+DVILED N + G++ SDIYVKGWL G+ D+ QETDVHY SL GEGNFNWRFVFPF YLPAE +++V K+E+ +SLD+TEQ+LP   V+Q+WD ++ S+DDFLG++EL+L   P  AK +K C +  L+  N      NI++F+ +R+ G+WP    E    ELTGK+E E  L+T EEA   P G  R    E   LE PNRPDT+F WF +P+K F  +IWKN+K Y I  +++ ++AL + L  Y++PG  + K+V
Sbjct:  729 IVLYKDHHEFQLRAHMYQARGLIAADNTGLSDPFARVSFQSHTHVTAIINQTLTPTWNQMLMMDKLSLHGMLTELAQEPPLITIEVYDDDALGKPEYLGSTVAVPVVKLAEEPYTAPSLHYSPLFCGSLSGGDILGAFELIEVPKSGKHSLPPYDDPEGSIYPVPSYIRPVLRKYRIEVLFWGLRELKKVQLLTVDRPQVFIECAGKGVSSSVIQSYKSNPNFSMIVDAFEVELPEDEYLHPPLTITVVDWRAFGRSTLVGNHVINNLILFKYTPPSLPPPRAQPQEPDIIERNGFSDFTSLHKYTAHQRCPVF---SPPVYNPHS-------SDSFTQERESKKSKRRSTKRKKRTAADES------------------ADCVIDWWSKYYASVEKIQMVRLNSSHQFRFQLKPKSEKVGCFNIADSMILETFQSSTCIPGKDALLKIYDKELE--AEFGPFDDWVKTFELYRGKANEEESSSAERFVGNFKGRFCLYKLPDSEEYDCVDSGDYKINQGIPPNTAVNVLIRVYIVSASNLHPADPDGKADPYIVLKLGKTVIKDRDNYIPKQLNPVFGRSFEIQASFPKESLLKILIYDYDVIGGDDLIGETQIDLENRFYSRHRAMCGIPSEYAIDGYNAWRDCIKPTDLLIKLCKDNRLDSPRFTPGRITIGEKVYTGKTVF---------ADEDQMVESYEHLALKVLHRWEEMPGVGCKLVPEHIETRALYIKDKPGLDQGQVQMWVDIFPMDMPHPGPPVDISPRKPKGYELRIIIWNTEDVILEDTNFITGQQSSDIYVKGWLKGLEDDGQETDVHYNSLTGEGNFNWRFVFPFHYLPAEKLVVVSKRENIFSLDKTEQKLPAVLVMQVWDFERLSSDDFLGSVELDLHGFPRGAKTAKDCKMEMLKESN-----DNISIFQQKRSKGWWPFIKSE----ELTGKVEAEFHLVTAEEAEKNPVGRAR---KEPEPLEKPNRPDTTFSWFVNPFKCFFHLIWKNYKKYIIIALLLLILALFLALLFYTLPGALSNKIV 1721          

HSP 2 Score: 295.434 bits (755), Expect = 5.175e-80
Identity = 218/735 (29.66%), Postives = 349/735 (47.48%), Query Frame = 3
Query:  603 IKIKKVGKRTTRK-SYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRP-ATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIA--AQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDS------------------------LLKSQKFLR-----RRKYRLHAAFLSASMI--TAVDSPVEFEVSIGNYGNKLDEXXXXXXXXX------------XXXNAIFDGT---------------------FYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGW---EAGESPLTELDLNLNTLRTNELGNIRKEALRVRE---EATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEG 2585
            IK+K+  K+  +   ++ +     I I + EARQL G NI P   ++  ++ KQ+ VK  TN+P +N  F F+F       FD+ I   + +S+ ++S   IG+FK D+  +Y +P H + NKW  L DP D ++G KG+LK    + G GD +P        E    +  L+      +RP A + ++VYRAE LPRM+S I+  + K F SD     L+DPY++  F  +  +TS + ++  P WNE++     FP +C R+K+Q+ D   M  D  IGT  IDL  I+    GD GFLPTFGP +IN +GS R  S L D  + +N G GEGV+YRGRL ++L+  +     + + +  +   S                        ++ +  F++        + L  A   A+MI     D P+ FE +IGN GN +D    P++                 T  + +G                       Y++LP    KPC  V C WE+ + RL+  N            +D+I               FV +A+     +C +E       +  ++ LT LD    TL   EL ++ + A  + E   +  ++++ L +      ++R L  EPQ+++PD+ +WM++  KR  Y RIPA ++LYS N    G+ CG + T+ LK P  + +    +++ A++ + LWLG+  +     K   EG
Sbjct:   14 IKMKRRKKKADKGLVFANRGAQGTISINITEARQLVGENIDPSVVIEIGDEKKQSSVKEGTNAPFYNEYFVFDFFAHQEIFFDKVIKLSVMHSKIMKS-YCIGTFKIDVGTVYNQPGHQFTNKWAALIDPNDISTGVKGHLKCDICVTGKGDVSPRSQKFSDAEEQIEKNPLVPEGFPSMRPWARYYVKVYRAEGLPRMNSSIMANVTKAFVSD--NTALIDPYVVVSFFSQVGRTSTQKSTADPVWNEQVVFKEMFPPLCRRLKIQVLDEGSMN-DVAIGTHYIDLCRISNDQDGDKGFLPTFGPAWINIYGSARN-STLVDDNQEMNEGIGEGVSYRGRLYIQLAVEILTGGAESKSMFSLKLPSKDAKGGKTAGKDPKAGTGGADTSFIVGNLVFVKVSEENMENFILFGAMFEATMIDRRIGDKPISFEFTIGNCGNFIDGAAPPAAKKRGERGFDHPGQEGAMTTPLLEGQAALSCKSTTRPEKPHTGHGNRVYYYLPISTQKPCIHVQCSWEDRTYRLHHSNM-----------LDRIAFL------------FVSTAY-----YCGQEFIASVEKKVKDNCLTMLDKKRLTLCKQELESMIEVAGTITEPKRKVLTIKEMLQESRKLTQKIRFLVEEPQHTLPDIFVWMLSNNKRLAYARIPARNLLYSENVVEKGKDCGKISTLFLKPPGKRGA---TWAVQAKVDVYLWLGKCTESSNMLKNLPEG 712          
BLAST of Fer-1-related vs. Ensembl Cavefish
Match: otofb (otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5])

HSP 1 Score: 455.292 bits (1170), Expect = 2.243e-130
Identity = 267/638 (41.85%), Postives = 394/638 (61.76%), Query Frame = 3
Query: 4572 IDWWSKYYASLGEWGKCNKYQDMNYDTL----QVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEAS------VGEFKGTFRIY--PLPENINEKLPAKY---LEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTY----KTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNM---LP-----LTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLL-GEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWP-CYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMVGV 6395
            +DWWSKY+AS+    +    Q+ NY +     QV+  ELE    +  F D+   F LYRGK+ DD+E+ +      +G+FKG+  +Y  P+ +++  ++       + + +P + PI  +VRVY+I+A DL P D +G ADPY+ ++LGK  + +K++YI   L P FG+ F+++   P+   L + V D+D + +DD+IGET IDLENR+ TK RATCG+  +Y I G N WRD  KPT IL + C+   + PP Y    +      VY G  + +          N     ++E LAL VLN    +P     L  EHVETRPL +P +PGIEQG+++ W+D+FP  +   G   +I+PRKPK ++LR+I+WNT +V+LED+++  GEK SDI+V+GWL G  E +Q+TDVHY SL GEGNFNWRF++PF YL AE  +++ KKE  +S DETE ++P    +Q+WD D FSADDFLG +EL+L + P  AK +KQC ++ +       ++  +N+F+ +R  G+WP    DE    E+TGK+E EL L+T EEA   P G GR+   E   LE PNRPDT+ LWF  P K  K ++  ++KW  I  +++ L+  ++ LF+YS+PG   +K++G 
Sbjct: 1200 LDWWSKYFASIETLMELQLLQN-NYSSHSSCEQVFNRELEN--EFEHFEDWLHTFNLYRGKSGDDDEQNASDEDRLIGKFKGSLCMYKVPMTDDMGREMGIDSNMGMFQNIPHNDPINILVRVYVIRATDLHPADINGKADPYIAIKLGKTEIKDKENYISKQLNPVFGKSFDIEATFPMDSSLTVSVYDWDLVGTDDLIGETKIDLENRYYTKHRATCGITASYAIHGYNVWRDPMKPTHILAKLCKDGKLDPPQYGPGGRVKVANRVYTGPTEIE--------DENGLKKQTDEHLALAVLNHWEDMPRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPKDMPAPGPALDISPRKPKKFELRVIIWNTDEVVLEDDDIFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLMAEEKIVISKKESMFSWDETEYKIPARLNIQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTIDMVLN---EQEMPMVNIFKQKRIKGWWPFVARDENDELEITGKVEAELHLMTGEEAEKSPVGEGRN---EPEPLEKPNRPDTTLLWFLMPLKAIKHLVCNSYKWLIIKIVVVLLLLAMLGLFLYSMPGYMVKKLLGA 1820          

HSP 2 Score: 369.777 bits (948), Expect = 4.744e-103
Identity = 250/752 (33.24%), Postives = 391/752 (51.99%), Query Frame = 3
Query:  576 IGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKL-RSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGV--QLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDET--PE-------QGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMI--TAVDSPVEFEVSIGNYGNKLDEXX-----------------------------------XXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKAN--LPEEEQAQFVISAFDDLIMHCSK--ELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLES--FCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMT 2666
            + N  S P IKI+    R         P DFQI + V+E RQL G N+ PV  V+  ++ K T +K STN P +N  F F+FH+    +FD+ +   + +S+ L RS  ++G+FK D+  +Y +  H + +KW +L DP+D  +G KGY+K   A++  GD   +   + + + D+IE NLL P GV  + + A F L++YRAE LP+M++ I+  +KK F  +   K+L+DPY+  QFAG++ KTSV+ +   P WNE++    QFP +C+R+K+Q+ D D++  D  +GT  IDL  I+  GD GFLPT GP ++N +GS R ++ L D ++ LN G GEGV++R RL+V L+  + +T  PE       Q + +  I+ ++  K ++F       L  AFL A+MI     D P+ FEV+IGNYG+++D+T                                       S+T      I D  ++H LP+   KPC  +   W++   RLY  N    I DK+   ++ ++   K     PE      +    +DL   CS   EL   +  +S  T+LD         EL N+ ++A  +R +           ++  F  +LR L+ EPQ+S+PD+ IWMI+  KR  Y R+P+ D+LYSN  +  G+ CG V+TI  K P  K      +++ A+  + LWLG  +   ++        LS L   +E   ++ G     AP ++
Sbjct:  151 VSNKRSKPDIKIEPGAGR---------PMDFQISVTVIECRQLVGLNMDPVVCVEIGDEKKYTSMKESTNCPYYNEYFVFDFHLPPDVIFDKILKLSVIHSKNLLRSGTVVGTFKMDVGTVYSQADHQFYHKWAILCDPDDITAGCKGYVKCDIAVVAKGDNIKTPHKANETDEDDIEGNLLLPEGVPAERQWARFYLKIYRAEGLPKMNTSIMANVKKAFIGE--NKDLIDPYVQVQFAGQKGKTSVQKSCYEPIWNEQIVFTEQFPPLCKRMKVQIRDSDKVN-DVALGTHFIDLRKISNDGDKGFLPTLGPAWVNMYGSTRSYT-LMDEYQDLNEGLGEGVSFRARLLVSLAVEILDTSSPEVMCSTEVQVEGVPNISDNAAGKIEEFF------LFGAFLEATMIDRKIGDKPINFEVTIGNYGSEVDDTPTKPKSKKSKKGDGDDEESELIQGSSDEEVTDDGELVSVSTTPPMKPVITDRNYFH-LPYFERKPCIYIKSWWQDQRRRLYNANIIDNIADKLEEGLNDVQEIFKTEKAFPERR----LRGVLEDLSHGCSNFLELANKDQNQSGKTKLDRERLKSCMRELENMSQQAKTMRTQVKKKTVKDKFKQAQIFLQKLRFLADEPQHSVPDIYIWMISNGKRIAYARVPSKDILYSNVEEETGKDCGKVKTIFFKLPGKKGFGPAGWTVQAKTEMYLWLGLNRQRKDF--------LSGLPNGFEENKAVKGPGMQSAPPIS 870          

HSP 3 Score: 204.142 bits (518), Expect = 5.805e-52
Identity = 121/292 (41.44%), Postives = 178/292 (60.96%), Query Frame = 3
Query: 3444 GLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRC---QITPMVKTHPDDPR-KPVLQWYNLTKGNRDAGELLAAFELYL-----QTDKPLPFTPPK---RGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPP 4283
            G+ + P + L++     +QLR ++YQAR+L A D TG SDP+ARV F   SQ TE +++TLCPTWDQ L+F  +E++G+   + + PP ++IE++D D +G+ +F+GR     IT M   H   PR  P L++Y + +GN  AGE+LAAFEL       + D P P   P    RG I  V  GIRP++ +  IE+L WG+R++ +  LA V  P ++ E  G  IQ+ +I+N   NPNF+  + + +V LP+ EL  PP NI+V D R FGR  LVG H + S+  + + P
Sbjct:  862 GMQSAPPISLIYTMKQIFQLRVHLYQARSLFAADSTGLSDPFARVFFSTHSQVTEILNETLCPTWDQLLVFDNVELYGEACELRDDPPIIVIEIYDQDTVGKADFMGRTFAKPITKMSDEHYGPPRFPPQLEYYQVYRGNCTAGEMLAAFELLQIGPGGKADLP-PIDGPTDMDRGPILPVPIGIRPVLSKYRIEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGIQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTSLRKFIYRP 1152          
BLAST of Fer-1-related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001770.1 (pep scaffold:Pmarinus_7.0:GL479034:2422:33544:1 gene:ENSPMAG00000001575.1 transcript:ENSPMAT00000001770.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 438/1012 (43.28%), Postives = 627/1012 (61.96%), Query Frame = 3
Query:  624 KRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN------------------------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESP-LTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDY-IGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPM-KPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFS 3560
            K  + ++ S KP+DFQ+RI+V+EARQL G NI PV KV    Q K+T+++   N+P ++ +FFFNFH+S+AELFDE I F++ +S  LR+D+ IG+FK D+  +Y+EP+H +  KWLLL DPED +SGAKGYLK    +LG GDE P   S   EE ++IE NLLRPAGV LR A  TLR YRAED+P+MD  +L+ +K++F  D+ KK LVDPY+   FAGK + T +   + +PEWN+ + + ++FPSMCER+++ L+DWDR+T +D +GTA + +S I+  G +                        GFLPTFGPCFIN +GSPREF+  PD +E LN+GKGEGVAYRGR++VEL+T L++      ++ PI  D LL+ +K+LRRR+Y L A F SA+M+  V+ P++FEVSIGNYGNK D T  P +STTQ + A+FDG   ++LPWGN KP   +  +WE+V  RL  +N  +    ++  N+ +++  ++A  P E  A   + A D LI  CS+ LP  E  E P +T LD  +   R+  L  I + A R+REEAT VE+ L++L+ +  +L  L+ EPQNS+PDVV+WM+ G +R  + RIPA++V++S+   +  G+ CG  QTI LK P     +   F IP Q+R+++WL    D   +++  +EG+L++ AETYENQ   +LVG W T    +TR  +SD +G ++L   +  PP GW WDGDW++SPE SL ++ DAG  ++ ++VF +  R+PGG W      +TD+ G+  P   DI  P+GW WE+ W VD  R  DE GWEY V    +A    +VP EKMYH  RRRR+ R R+    K A         +  E WEYA LF  R+H + RKTD  RRRRW R+M+P  + G  A+F L                      E  + VD   +D+        + KK ++ + G+ + P +  +F++ +++ LR Y+YQAR L+A D+  FS
Sbjct:  197 KTPSTRAVSRKPRDFQVRIRVIEARQLPGNNIKPVVKVTVAGQSKRTRIRKG-NNPFFDETFFFNFHLSSAELFDELIYFKVLHSHSLRADSEIGTFKLDVGTVYDEPRHTFQRKWLLLCDPEDLSSGAKGYLKVTLLVLGAGDEPPEDRSEAVEEREDIENNLLRPAGVSLRGAFLTLRAYRAEDVPQMDDAVLDTVKQIFGFDSNKKNLVDPYLEVSFAGKTLCTKIIEKNANPEWNQAISLPIRFPSMCERLRITLYDWDRLTHNDAVGTAFLSMSQISCPGGDEPEAFITMRCLRLNLLRLIEDEGTGFLPTFGPCFINLYGSPREFTGFPDPYEELNFGKGEGVAYRGRILVELTTKLED--HINNKVEPIPSDDLLRVEKYLRRRRYNLCATFYSATMLREVNEPIQFEVSIGNYGNKYDVTCPPLASTTQYSRAVFDGCSSYYLPWGNIKPVVTLTSYWEDVGHRLEALNILMHTQRRLEVNIGRVRATLQAREPVEAVAVSWLHAIDTLIEDCSQALP--EITERPNVTPLDREVWRARSATLALILRSAQRLREEATRVEETLSELDDWLERLTELTREPQNSIPDVVVWMLRGDRRVAFARIPAHEVMHSSLGPHACGKNCGITQTIVLKYP----QDTHGFKIPGQVRVRIWLSLAADSKSFNET-SEGKLAVFAETYENQTRLALVGGWGTTG--LTRHKFSDVTGHIKLPMHSFLPPLGWQWDGDWFVSPERSLLHEADAGHMEFTDEVFESNLRLPGGQWRALSDNYTDVNGEKLPPLADIECPAGWFWEEAWTVDTKRAVDESGWEYGVTIPPDARPRAWVPAEKMYHTNRRRRWARARRRDTRKAAKLPRVLKPEEQGEGWEYASLFGWRYHLEMRKTDTSRRRRWRRQMEPSERLGPSAVFQL----------------------EGAIQVDSAWDDD--------EGKKVSKPVLGVSS-PTISCIFEQGYRYHLRCYLYQARELIALDKDSFS 1165          
BLAST of Fer-1-related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001654.1 (pep scaffold:Pmarinus_7.0:GL479999:3392:42224:1 gene:ENSPMAG00000001492.1 transcript:ENSPMAT00000001654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 644.81 bits (1662), Expect = 0.000e+0
Identity = 410/1044 (39.27%), Postives = 592/1044 (56.70%), Query Frame = 3
Query: 3420 KKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHP---DDPR-KPVLQWYNLTKGNRDAGELLAAFELYL-----------QTDKPLPFT--PP---------------KRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTL---QVYKTELERVETYNEFTDFCTKFLLYRGKNLDD----EEEASVGEFKGTFRI--YPLPENINEKL---PAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLN-------MLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLL-GEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWP-CYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            KK   +     A+P + L++K+   +QLR ++YQAR+L A D TG SDP+ R+ F   SQ TE I +TLCPTWDQ L+F  IE++G+   + + PP ++IEVFD D +G+ +F+GR    P+VK      D PR  P L +Y + +GN  AGELLAAFEL             +T  P P T  PP               + G I  V  GIRP++ +  IE+L WG+R++ + QL  V  P ++ E  G  +Q+ +I +   NPNF+      +V LP  EL  PP NI+V D R FGR  LVG H + S+  +                 +  +    + A    I +                     D +L             ++A  P   + ++E+L            DWWSKY+ S+    K  K +     +    +++  ELE    ++ F D+   F LYRGK  DD    EE+  VG FKG+  +  YPLPE +  ++   P   + +G+PS+ PI  +VRVY+++A DL P D +G ADPY+ V+LGK  + +K++YI   L P FG+ F+++ + P+   L + + D+D + +DD+IGET IDLENR  +K RATCG+ Q Y I G N WRD  KP++IL + C++  + PP Y  + +  V +  R F  +    +   N    P++E +AL VL+          L  EH+ETRPL  P +PGIEQG+++ W+D+FPA V   G P +I PRKPKS ++R+I+WNT DVILED++LL GEK SDI+V+ WL G  E +Q+TDVHY S+ GEGNFNWRFVFPF YL AE  +++ KKE  +S DETE ++P    LQ+WD D FSADDFLG +EL+L + P  AK SK C L+ L+    +  V  I++F+ +R  G+WP    +E    ELTGK+E E+ LLT EEA   PAGLGR+   E   LE PNRPDTSF+WF +P ++ K++I   +KW  +  ++  L+  ++ LF+Y++PG   +K++
Sbjct:    8 KKAKNSSPIAQALPPISLIYKEKQMFQLRVHMYQARSLFAADSTGLSDPFGRIIFSTHSQATEVIPETLCPTWDQMLVFDSIELYGEAQELRDDPPIIVIEVFDQDTVGKADFIGRALAKPVVKMSNEKYDAPRFPPQLDYYQIYRGNSTAGELLAAFELLQVATSPTHHHAPRTTAPRPATLIPPSGKGDLPPISGPTDTEHGTILPVPRGIRPILSKYRIEVLFWGLRDLKRIQLVTVDRPRVDVECSGKSVQSVVIPSYKQNPNFSTLFKHFEVDLPDNELLHPPLNIRVVDCRAFGRYTLVGTHTVTSLRKF-----------------ILRAPSKTKAANIRTIGD-------------------PNDPRLPASGSVCQSVCPQVTAHQPIIHQPDEELL------------DWWSKYFVSIETLNKRCKKKLKKKRSPILEKMFDKELE--GEFDNFEDWLHTFSLYRGKIEDDDSSMEEDRLVGRFKGSLCVYKYPLPEELAREVGYDPQFGMFQGIPSNDPIGVLVRVYVVRANDLHPADVNGKADPYIVVKLGKHEVKDKENYISKQLNPVFGKSFDIEAVFPMDSMLTVSIYDWDLVGTDDLIGETKIDLENRLYSKHRATCGISQRYSIHGYNMWRDPLKPSQILARLCKEVKVDPPQY--SPEGRVKVANRTFTAATEVEDE--NGQKKPTDEHMALTVLHHWEEIPGACKLIPEHIETRPLLHPEKPGIEQGRIEMWVDMFPADVPRPGPPIDIAPRKPKSLEMRVIIWNTDDVILEDDSLLTGEKSSDIFVRSWLKGQQEDKQDTDVHYNSVTGEGNFNWRFVFPFDYLVAEEKIVMSKKESVFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTSKLCSLDMLKT---DGSVPMISIFKQKRIKGWWPFAARNENDELELTGKVEAEIHLLTSEEAEKSPAGLGRN---EPDPLEKPNRPDTSFMWFLTPLRSIKYLICHRYKWLIVKIVLALLLLAMLALFLYNMPGYMVKKLL 991          
BLAST of Fer-1-related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008905.1 (pep scaffold:Pmarinus_7.0:GL477019:1719:83156:1 gene:ENSPMAG00000008043.1 transcript:ENSPMAT00000008905.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 475.322 bits (1222), Expect = 5.774e-138
Identity = 276/614 (44.95%), Postives = 392/614 (63.84%), Query Frame = 3
Query: 4617 KCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDE----EEASVGEFKGTFRIY--PLPENINEKL--PAKY-LEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFK-LSHFERNTKPNAHFGPSNERLALHVLNM--------LPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLL-GEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWP-CYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMVGV 6395
            +  K   +  + L+VY  ELE    ++ F D+   F LYRGK  D++    EE  VG FKG+  +Y  PL +N+ +++   A++ + +G+P++ PI  +VRVYI++A DL P D +G ADPY+ ++LGK  + + ++YI   L P FG+ F+++   P++  L ++V D+D +  DD+IGET IDLE+R+ ++ RATCG+ Q Y + G N WRD  KPT+IL + C+ N +  P Y       V +  R F   +  E ++    H   + E LAL VL+           L  EHVETRPL  P + GIEQG+L+ W+D+FP  +   G P +I+PRKPKSY+LRII+WNT +VILED+  + GEKMSDIYV+GWL G  E +Q+TDVHY SL GEGNFNWRF++PF YL AE  +++ KKE  +S DETE ++P    LQ+WD D FSADDFLG +EL+L + P  AK SKQC LN L+    +  V  I++F+ +R  G+WP    DE    ELTGK+E EL LLT EEA   PAGLGR+   E   LE PNRPDTSF+WF +P K+ K++I   +KW  I  ++  L+ +++ LF+Y++PG   +K++G 
Sbjct: 1169 QLKKKPHLQVEELKVYDKELE--AEFDNFEDWLHTFNLYRGKTSDEDDILDEERVVGRFKGSTCVYKWPLADNVLKEVGYDAQFGMFQGIPTNDPINVLVRVYIVRATDLHPADINGKADPYIVIKLGKTEVKDNENYISKQLNPIFGKSFDIEATFPMESMLTVQVMDWDLVGMDDLIGETKIDLESRYYSRHRATCGIAQQYAVHGYNTWRDPMKPTQILAKLCKDNKVDGPHYGPGGR--VKVANRIFNGPTEMEDDS---GHKKQTEEHLALKVLHSWEEIARVGCKLVPEHVETRPLLHPDKTGIEQGRLEMWVDMFPKDMPHPGPPVDISPRKPKSYELRIIIWNTDEVILEDDAFMTGEKMSDIYVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLVAEEKIVISKKESLFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKSSKQCTLNMLKM---DGSVPMISIFKLKRVKGWWPFVSRDENDEQELTGKVEAELHLLTAEEAEKNPAGLGRN---EPDPLEKPNRPDTSFIWFLNPLKSIKYVICHRYKWIIIKLVVALLMLVLLGLFIYNMPGYMVKKLLGA 1769          

HSP 2 Score: 336.65 bits (862), Expect = 1.613e-93
Identity = 233/697 (33.43%), Postives = 351/697 (50.36%), Query Frame = 3
Query:  648 STKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKL-RSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGV--QLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTA--------LDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMI--TAVDSPVEFEVSIGNYGNKL---------------------------------------DEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPL--TELDLNLNTLRTNELGNIRKEALRVREEA---TSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQ-KRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEW 2564
            + KPQ +Q+ + ++EARQL G N+ PV  V+   + KQT  K STN P +N  F F+FH     +FD+ I   + +S+ L RS  L+G+FK D+  +Y +P H + +KW +L+DP+D  +G KGY+    A++G GD   +   S   ++D IE NLL P G+    + A F +R+Y+AE LP+M++ I+  +KK       +++LVDPY+   FAG++ KTSV+ +S  P WNE++     FP +C R+KLQ+ D D++  D  IGT  IDL  I   GD GFLPTFGP ++N +GS R ++ L D  + LN G GEGV++R RL++ +S          L    E   E +P   D         +  ++ L  AFL A+MI     D  + FE+SIGNYGN L                                       D+  S SS+T        D  ++H +P+   KPC  V   W +   RLY  N   KI DK+   +  +   +K   P  E+   +  A +++ + CS+ L       S    T LD +   +   EL  +  +A   R      T+     +   S       L   PQ+S+PD+ IWM+  + KR  Y RIPA D+LYS   +  G+ CG V+T+ L+ P  +      +++ A+L   LWLG  K   ++
Sbjct:   12 AGKPQSYQVSVMIIEARQLVGLNMDPVVIVEVGEEKKQTSQKESTNCPYYNEYFVFDFHTPPNMMFDKIIKLSVIHSKNLIRSGTLVGTFKLDVGTVYSQPDHRFYHKWAVLTDPDDITAGIKGYVNCDIAVVGKGDNIKTPHKSVDNDADSIEGNLLLPEGIPADRQWARFFVRIYKAEGLPKMNTAIVANVKKALM--GQERDLVDPYVQVSFAGQKGKTSVQRSSYEPVWNEQVVFTELFPPLCRRMKLQIRDSDKVN-DTAIGTHFIDLKKICNDGDKGFLPTFGPAWVNMYGSTRNYT-LMDEHQELNDGLGEGVSFRARLLLGISMEILDITSPELSTNTEISVESIPHVADESCSG----KMEEFFLFGAFLEATMIDRKISDKLISFEISIGNYGNSLDGLNKSNILDRSDDEDEYDEGDEDDETELLNDETDDAEMDDDTSGSSTTPSYKPETNDRQYFH-MPYYEQKPCVYVRSAWHDQRRRLYNSNIIDKIADKLEEGISDVLETMKMERPHPERR--LRGALEEMSVGCSRFLTLANKDPSAFGRTRLDRDRLKICMRELEQMGPQAKLGRARTRIHTAPHSTRHTTSSTLRSTAALMAAPQDSIPDIFIWMLVNKTKRVAYARIPAKDILYSIVEEETGKDCGKVKTLFLRLPGKRVFGSGGWTMQAKLEAYLWLGLNKQRKDF 697          

HSP 3 Score: 199.134 bits (505), Expect = 3.279e-51
Identity = 126/317 (39.75%), Postives = 186/317 (58.68%), Query Frame = 3
Query: 3360 MNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVK--THPDDPRK--PVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPP-------KRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRF 4277
            + ++K+ +D +   P   + KK      G+  VP   L + K  +++LRA++YQAR+L A D TG SDP+ARV F    + TE   +TLCPTWDQ L F  + ++G+P  + + PP V+IEVFD D +G+ EF+GR    P+VK  T P +P +  P+L +Y + +G   AGELLA+FEL           PP        RG I  V  GIRP++ +  IE+L WG+R++ + QL +V  P ++ E  G  IQ+ +I +   NPNF++ + F +V LP+ EL+ PP NI+V D R FGR  LVG   + S+  + F
Sbjct:  688 LGLNKQRKDFLTGLPSGFEEKKI-----GVTGVPPSVLNYHKRSQFELRAHMYQARSLFAADSTGLSDPFARVIFSTHCKSTEVFQETLCPTWDQLLQFQDVYMYGEPRELRDDPPMVVIEVFDQDTVGKAEFIGRALAKPVVKISTEPYEPPRFPPMLDYYQIYRGPVTAGELLASFELLQVPPADNCKFPPVSGLNDTDRGPIIPVPKGIRPVLAKYRIEVLFWGLRDLKRVQLQSVDRPRVDIECAGKGIQSVVIADFNKNPNFSHLVKFFEVDLPENELFHPPLNIRVVDCRAFGRYILVGSQTVTSLRKFIF 999          
BLAST of Fer-1-related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002265.1 (pep scaffold:Pmarinus_7.0:GL483084:292:10410:1 gene:ENSPMAG00000002063.1 transcript:ENSPMAT00000002265.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 372.859 bits (956), Expect = 3.986e-116
Identity = 210/389 (53.98%), Postives = 276/389 (70.95%), Query Frame = 3
Query: 5208 SGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQ-GKLQCWIDIFPASVETIGEPFEITPRKPKS-YQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIP 6365
            SG N+WRD   P+ IL+        P P Y+ +    + +  R + +S FE     N H GP  ERLALH+L  + L  EHVETR L   +QPG+EQ GKL  W+D+FP ++   G PF+ITPRK K  YQLR I+WNTKDVIL++ ++ GEKMSDIYVKGW+ G D+ +Q+TDVHYRSL GEGNFNWR++FPF+Y+PAEN+ +V +KEHFWSLD+TE RLP    +QIWDNDKFS DD+LG L+LNL+ MP PAK +++C L  ++      + K  +LFE +   G+WPC  +E G   + GK+EM LE+L ++EA  +PAGLGR+EPN NPKL+PPNRP+TSFLWFTSP KTFK+IIW+ +KW FIG +I+  V L + +  YS+P
Sbjct:    1 SGQNQWRDQMTPSMILEGVARAKSWPQPIYEGDR---LTLKGRDYLMSDFEAKAPTNPHLGPVKERLALHLLRSMGLIPEHVETRTLEHSIQPGLEQQGKLMMWVDVFPKNMGPPGPPFDITPRKAKKRYQLRCIIWNTKDVILDETSITGEKMSDIYVKGWIDGRDDAKQKTDVHYRSLGGEGNFNWRYIFPFEYVPAENICVVSRKEHFWSLDKTELRLPPKFTIQIWDNDKFSPDDYLGYLDLNLSHMPVPAKSAEKCSLEMVETPTGKKKHKTTSLFEQKNVKGWWPCIAEEDGKKIIAGKVEMTLEILADKEAEERPAGLGREEPNMNPKLDPPNRPETSFLWFTSPLKTFKYIIWRRYKWIFIGLLILLFVVLFLAILFYSLP 386          
BLAST of Fer-1-related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004363.1 (pep scaffold:Pmarinus_7.0:GL477737:887:58689:-1 gene:ENSPMAG00000003981.1 transcript:ENSPMAT00000004363.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 327.405 bits (838), Expect = 6.424e-93
Identity = 223/734 (30.38%), Postives = 378/734 (51.50%), Query Frame = 3
Query:  525 DQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSR-KLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGV--QLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMV--------ELSTALDETPEQGQEILPINQDSLL-KSQKFLRRRKYRLHAAFLSASMI--TAVDSPVEFEVSIGNYGNKLDE---------------------------XXXXXXXXXXXXNAIFDGT-----------FYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSK--ELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALND----LESFCNQLRNLSGEPQNSMPDVVIWMITGQ-KRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEK 2549
            D  D+      + + +++ N  S P+ ++            + KPQ +Q+ + ++ A++L G NI P+  ++  +  K+T+++ STN P +N  F F+F+ +   +FD  I   + +++  +RS   IG+FK D+  +Y +P H + +KW  L DP+D  +  +GY++    ++G GD       S + + D +E NL+ P G   + + A F + +Y+A  LP+M++ I+  +KK       +K+LVDPY+   FAG++ KTSV+ NS  P WNE++ +   FP +C R+KLQ+ D D++  D  IG+  IDL+ I   GD GF+PTFGP ++N +GS R ++ L D  + LN G GEGV++R RL++        + S  L+ T E   E +P   DS+L K ++F       L  AF+ A+MI  +  +  + FE+SIGNYGN +D                              +  +  T   +++F  T           ++H +P+   KPC  V+  W +   RLY  N   KI DK+   +  +K A+K + P  E+   +  A +++   C +   L   ++     T+LD     +R  EL    + + +       + Q +ND    + +  + L     +PQ+S+PDV IWM+  + KR  + RIPA D+LY+N  + +G+ CG V+T+ LK P  +      +++ A+L + LWLG  K
Sbjct:  229 DNLDTISIASGKVETSDVSNKRSKPEQRVDPT---------AGKPQSYQVSVMIIRAQKLVGLNIDPMVILEVGDAKKKTRIEKSTNCPNYNEYFVFDFNTAPNTMFDTMIKLTVVHNKDAIRSGTPIGTFKLDVGTVYSQPDHRFYHKWATLIDPDDITADVRGYVQCDITVVGKGDNIKKSHKSIESDDDSLEGNLILPDGCKGERQWARFYVNIYKAVGLPKMNTAIVANVKKALM--GQEKDLVDPYVQVSFAGQKGKTSVQNNSYEPVWNEQVVLTDIFPPLCRRMKLQIRDSDKVN-DVAIGSHFIDLTKICNNGDKGFMPTFGPAWVNMYGSTRNYT-LVDEHQELNDGLGEGVSFRARLLLQLTTELLDKTSPELNNTTEVMVEDIPRINDSVLGKMEEFF------LFGAFMEATMIDRSISEKLISFEISIGNYGNSIDGLNKSNPQERSDDEDEDDDEDDEEETVLLTAQKAKGTDELSSMFSTTPPMKPETNDRQYFH-MPYYEQKPCVYVESTWHDQRRRLYNSNIIDKIADKLDEGISDVKEAMKTDKPHPERR--LRGALEEMSSGCERFCSLANKDSSSIDCTDLDRKRLKMRLKELIYNIQHSFKTMLCMLFI-QIINDMMRVMRNLLSALIACIKDPQHSIPDVFIWMLVNKTKRIAFARIPAKDILYANADEELGKDCGKVKTLFLKLPGKRSFGPGGWAMQAKLEVYLWLGTNK 939          

HSP 2 Score: 140.584 bits (353), Expect = 1.561e-33
Identity = 67/149 (44.97%), Postives = 98/149 (65.77%), Query Frame = 3
Query: 3453 AVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVK--THPDDPRK--PVLQWYNLTKGNRDAGELLAAFEL 3887
             VP   L + K  +++LRA++YQAR+L A D TG SDP+ARV F    + TE   +TLCPTWDQ L +  + ++G+P  + + PP V+IEV+D + +G+ EF+GR    P+VK  T P +P +  P+L +Y + +G   AGELLA+FEL
Sbjct:  961 TVPPRVLTYSKRSQFELRAHMYQARSLFAADSTGLSDPFARVIFSTHCKSTEVFQETLCPTWDQLLEYQDVYMYGEPRELRDDPPMVVIEVYDQNTMGKSEFIGRALAKPVVKISTEPYEPPRFPPMLDYYQIYRGPLTAGELLASFEL 1109          
BLAST of Fer-1-related vs. Ensembl Yeast
Match: TCB2 (ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to plasma membrane (PM) and regulate PM phosphatidylinositol-4-phosphate (PI4P) levels by controlling access of Sac1p phosphatase to its substrate PI4P in the PM; contains 3 calcium and lipid binding domains; mRNA is targeted to bud; TCB2 has a paralog, TCB1, that arose from the whole genome duplication [Source:SGD;Acc:S000005031])

HSP 1 Score: 49.2914 bits (116), Expect = 7.386e-6
Identity = 28/76 (36.84%), Postives = 44/76 (57.89%), Query Frame = 3
Query: 1248 KELVDPYMIFQFAGKEI-KTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAA 1472
            K+ VDPY+ F+ +GK + KT V  NS +P WNE + I LQ  S  + + + ++D      D  +GT I +L+ + A
Sbjct:  398 KKTVDPYLTFELSGKIVGKTKVFKNSANPVWNESIYILLQ--SFTDPLTIAVYDKRETLSDKKMGTVIFNLNKLHA 471          
BLAST of Fer-1-related vs. Ensembl Yeast
Match: TCB1 (Lipid-binding ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to plasma membrane and regulate PI4P levels by controlling access of Sac1p phosphatase to its substrate PI4P in PM; contains 3 calcium and lipid binding domains; non-tagged protein also localizes to mitochondria; C-termini of Tcb1p, Tcb2p and Tcb3p interact; TCB1 has a paralog, TCB2, that arose from the whole genome duplication [Source:SGD;Acc:S000005612])

HSP 1 Score: 48.9062 bits (115), Expect = 9.209e-6
Identity = 36/120 (30.00%), Postives = 63/120 (52.50%), Query Frame = 3
Query:  108 NATNLINMELVGKSDPYVLIEFQGQKK---KTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDL-AGGKTEVQLTLNLLDKNKRPTAGVLNLKVQY 455
            +A NLI  +L G SDPY+      ++    KTK + + LNP+W++  +  +      + DVL +KVMD +    D  +G+ ++PL  +   G TE+ + +  L+ N     G+L+L   +
Sbjct: 1000 SAENLIASDLNGYSDPYLKYYINNEEDCAYKTKVVKKTLNPKWNDEGTIQINNR---LNDVLRIKVMDWDSTSADDTIGTAEIPLNKVKVEGTTELDVPVEGLE-NAGQDGGMLHLAFSF 1115          
BLAST of Fer-1-related vs. Ensembl Nematostella
Match: EDO43088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZG6])

HSP 1 Score: 1366.29 bits (3535), Expect = 0.000e+0
Identity = 847/1981 (42.76%), Postives = 1165/1981 (58.81%), Query Frame = 3
Query:  636 RKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXX--XXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSD-AAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNG-------------FLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQA--QFVISAFDDLI--------------MHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNF-SIPAQLRLKLWLGQEKDEMEW-HKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENR-IPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWED-EWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDD---EHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEP-ESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQT-------------------------DKPLPFTP-PKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXX-XXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFC---EKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGI-DERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIP 6365
            R+ +S K QDFQIR+K++E RQL G NI PV +V   NQ ++TK+  STN P +N SF FNFH S AELFD+  S  +      R        K  L      PK  Y++ +  L    +     +GYLK  A +LGPGDE P  +    K+E+ D+IE+N L P GV  +PA F LR+++AED+P+MDS +   IKK F       K LVDPY+   F GK+I+TS+KY  D+PE+ E++KI L FPSMCERIK+QL+DWDR+  DD IGTA + LS I+ QGD G             F PTFGPCF+NF+GSPREFS LPD+ +ALN G GEGVAYRGR+++EL T L    E  QE+  I  + +++ Q FLRR KY+L A F  A+MI  VD PVEFEVSIGNYGNK+DE  S + + T P+N +FDG  Y++LPWGN KP  VV+  WE+++ RL  +N   ++ DK+  N+ +++ A+ A  P +E A    V S  + LI               HCS ++ G +    PL   D +LN   T EL    K AL       ++EQ + +L  +  +LR+++ EPQN +PDV++WMI+G +R  YYRIPA +VL+S   D  G+ CG    + LK P  K  ++ +   IPA +R++LW G EK +  W  + ++EG+  + AETYEN+  +   WT +A    RP +S   G +EL  +    P GW + GDW   PELSL +DKD+G   ++E+++    R  PGG W  + +Q+TD+ GD   +P++   P GW W   +W VD NR  D EGWEYTV+ S G + PV+K YH+       R R V    L + +S+  +       E WEYAP+F M+FHAKERK D VRRRR  RK+ P   G                         +I+P +SK+           P  ++ K K         +++ +  ++    HK+Q+ AY+YQAR+LLA D++G +DPY RVAF NQSQ TE   KTLCPTWDQTLIFH +++      I   PP V++E+FD DQ+G+D+FLGR +  P  + H ++     L WY ++ G+ D GE+LAA EL+L +                         + P P TP    G I  V D IRP++Q+T +E+L WGVRNM KYQLA++ SPS++FEIGG +IQ+DI+ +           L    + LP EE+Y PP NI++ DNR FGRKP V +H + S+  +R         +  + PA         G   + +  E  S   D  S+       +  NQ +  K +K     T    SP+ +K E       +   +++ I  +S Y       GK  K  D + +T +V            EF      + L   + +D +                LPE +   LP          ++PI+C+VRVYI+ AIDLQP DP GLADPYV VQLGKK L NKD Y PN L P FG+MFEL  ++P+ KDL+I + DYD ++ DD+IGET IDLE R LT++RA CG+P+TYC SGPN+WRD  +P E+L+++C   EKNF      K    + + +G R ++L  F     PN H G  ++RLALHVLN L    EHVETR L SP+QP IEQGK+Q W+DIFP +   +    +IT R+P +Y+LR+IVWNT  VI+++ ++ GE+MSDIYVKGWL G+ D++++TDVHYRSLDG+GNFNWR VF F YLP E  M++++KEHFWSLD  E RL     +QIWDND FS DDFLG+ +L+L K+P P + +K+C  ++    +P    + ++LF+     G+W CY +  G  E TGKIEM +E+L   EAA KPAG GRDEPN+NP L+ PNRP TSFLWFTSP+KT K+IIW+N+KW  IG +I+ ++  +VV+FVYS+P
Sbjct:    1 RRRWSDKVQDFQIRVKILEGRQLSGNNIHPVVRVAMSNQKRETKIVRSTNKPVYNESFTFNFHTSEAELFDDLFSPAVSAHSYWRWGI---RPKKQLFQGLPRPKCAYISSFAFL----NVVFLFQGYLKVTAMVLGPGDEPPIKAKLPPKEEDEDDIESNCLMPMGVARQPALFNLRIFQAEDIPQMDSGMGRSIKKFFKGIFGGAKGLVDPYVKVNFCGKKIETSIKYQDDNPEFKEQVKIPLMFPSMCERIKIQLYDWDRVGNDDCIGTAFLSLSSISGQGDEGNELLVILHPSLLCFPPTFGPCFVNFYGSPREFSELPDQDDALNKGIGEGVAYRGRVLIELETTLGSN-EIEQEVSQIETEDIVRVQPFLRREKYKLFACFYEATMIKDVDGPVEFEVSIGNYGNKMDE--SVAPANTAPSNPLFDGCHYNYLPWGNEKPVVVVESFWEDIAFRLEPLNLISRLCDKLEVNVKRVRSALDAPTPPKEDAFVPMVTSILEVLISDCIPHVGVLSKSSKHCSYDILGRKV--LPLNHRDHDLNL--TTEL----KSALDFPGAEINMEQTVGELNGYLQRLRDVAIEPQNCIPDVIVWMISGSERIAYYRIPAQEVLFSTTPDACGKICGKTVELRLKYPGKKGQDLKDHPEIPALVRVELWFGHEKYQDNWTAREKSEGDFIVYAETYENEIKIGPVWTKKA--CPRPGFSSPDGELELPPDKFIEPSGWKFLGDWEKKPELSLMHDKDSGRKTFVEELYEQGARNFPGGEWGGAKIQWTDVGGDQTTSPQEKATPPGWVWASPQWVVDKNRAVDGEGWEYTVDLSYGVYSPVQKAYHLS-----RRRRWVRRRDLKHPESTKKQVRRKLLLEGWEYAPVFTMKFHAKERKMDFVRRRRMMRKLIPEGGG-------------------------KIDPKKSKL-----------PPILRNKAKGITFFRTPSLSISKS-VISCTPHKFQMWAYVYQARDLLAKDESGMNDPYVRVAFANQSQMTEVKQKTLCPTWDQTLIFH-VDLFDSLENIQRNPPTVVMELFDKDQVGKDDFLGRTEFKPYPRIHGNEGPACKLLWYPISHGDEDGGEILAACELFLVSFIFFQCTTKLETGLLNFHLQDDGVVNIPHPPTPRDAEGEILPVRDRIRPVLQKTVVEVLCWGVRNMKKYQLASIKSPSVQFEIGGEIIQSDILTDAKKFPNFGRPILPRKIINLPVEEMYTPPMNIRIHDNRTFGRKPTVAVHSIKSLTRFRCAAPTPAGQIQVEGPA-------APGQPAEGVVPEAESHKFDWWSK-----YYASLNQTEDSKSEKVGDGTTGRTLSPELEKIE-------EFGGLEDMIASFSLYR------GKAKKRDDDDEETQKV----------VGEFKGTFRIYPLPEAEGVDPD----------------LPETVFTNLPP---------NEPIDCVVRVYILSAIDLQPQDPGGLADPYVVVQLGKKKLDNKDQYKPNTLNPIFGKMFELDAVIPVHKDLKITLMDYDLLTRDDMIGETVIDLEQRLLTRYRAKCGIPKTYCDSGPNQWRDHKRPMELLREWCEETEKNFKFYKGTKDGTPDRIVVGYRVYQLDEFGAFRNPNEHLGAKHQRLALHVLNQLEFIPEHVETRGLRSPMQPNIEQGKVQLWVDIFPKNEGVLKPSVDITAREPTNYELRVIVWNTSGVIMDETSITGEQMSDIYVKGWLEGMGDDKEKTDVHYRSLDGDGNFNWRMVFNFLYLPIEKKMVIREKEHFWSLDAKEVRLAPRLNMQIWDNDTFSYDDFLGSCQLDLIKLPKPCQTAKRCGTSR----DPGKNGEYVDLFQQHSIQGWWACYQE--GIEEPTGKIEMTIEVLNSNEAAVKPAGKGRDEPNQNPHLDEPNRPATSFLWFTSPFKTLKYIIWRNYKWLIIGLLILIVIIALVVIFVYSMP 1852          
BLAST of Fer-1-related vs. Ensembl Nematostella
Match: EDO36863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHC0])

HSP 1 Score: 1174.46 bits (3037), Expect = 0.000e+0
Identity = 627/1245 (50.36%), Postives = 844/1245 (67.79%), Query Frame = 3
Query:  624 KRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNG---------FLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNF-SIPAQLRLKLWLGQEKDEMEW-HKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQT--------------DKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPP 4283
            ++  R   S KPQDFQ+R++++E RQL G NISPV +V   NQ +QTKVK STN P ++ +FFFNF++S  ELFDE ISFE+FNSRKLR++A+IG FK D+   YEEP H  + KW+LL+DP+D  +G KGYLK    +LGPGDEAP  S+    +  E  TNLL+P+GV LRPATF+L+VYRAED+P+MDS  +EGIK+V      +KELVDPY++F FAG + +T + YNSDHPE+N+EL +  +FPSMCER+KLQ+FDWDR+T DD IGTA + +S I+ QG++G         FLP FGPCFIN +GS RE+S+LPD ++ LN G GEGVAYRGR++VEL T L  TP+   + L  ++  ++  Q +LRRRKY+L A FL ASM++  D PVEFEVSIGNYGNKLD ++ PSSSTT PTNA++DG +Y+FLPWG++KPC  V+ HWE++  RL T N   ++ +++  NMDK+ ++++AN    E A  +IS  D LI    K LP  +     + +LDL L  +R  E  +I +EA+++RE AT V +AL ++E F  +LR+L+ EPQNSMPDV+IWM++G KR  YYRIPA+DVLY   S+  G  CG VQ I +K P  K   I ++  +PA +R+ +WLG EK + +W ++  TEG+  + AETYEN+ +++G+WT +   ++RP +S++ G V L K+A   P GW +DGD       SL YD+D+G   +LEDVF  E+R+PGG+W P+ V +TD++GD   A  +I     WEW  EW VDLNR  DE+G+EYTVE+++GG+ PVEK YH+CRRRR+VR RK++ E   ++D   ++    E WEYAP+F M+FHAKERK D+VRRRRWHRKM    P  PA                              ++++ET                      +M  PR+F+ ++K H++QLRAY++QAR+LLA D  G SDPYARV F  +S  TE + +TLCPTWDQTLIF ++ I+G    + E PP VIIE++D D +G+DEF+GRC + P+VK +   P  P L WY++ +G+   GE+LAAFEL+L +                 LPF PP +GN+F V +GIRP+MQRT IE+L WGVRNM K+QLA+V+SPSIEFE GGHV+ + IIKNT  NPNF+ PL F DV LPKEELY PP NIKVRDNR FGRKP+VG+H L S+  +R  P
Sbjct:    3 EKDQRHKLSNKPQDFQVRVRIIEGRQLSGQNISPVARVTVANQTRQTKVKISTNKPFYDETFFFNFNMSPMELFDEIISFEVFNSRKLRANAMIGYFKCDIGFFYEEPGHAAIRKWVLLTDPDDKMAGVKGYLKVTVMVLGPGDEAPVKSAQDDNDDIE--TNLLQPSGVMLRPATFSLKVYRAEDIPQMDSGFIEGIKRVLRVGEEQKELVDPYLLFSFAGMKARTRIHYNSDHPEFNQELNVQFKFPSMCERLKLQMFDWDRLTADDCIGTAHLPMSAISGQGEDGESWVERNISFLPMFGPCFINVYGSTREYSDLPDEYDDLNLGNGEGVAYRGRVLVELETKLGVTPQSPTDDLQSHE--IISVQPYLRRRKYKLFACFLEASMVSCSDGPVEFEVSIGNYGNKLDLSVPPSSSTTPPTNAVYDGCYYYFLPWGDTKPCVCVESHWEDIGFRLGTKNILTRMCERLEVNMDKVNLSLEANAQPAETATLLISLLDQLINDVRKPLPKIDNNTPGVNDLDLKLQEVRLMEKLSISEEAIKLRESATDVREALGEIEGFLQRLRDLTVEPQNSMPDVIIWMLSGTKRIAYYRIPAFDVLYEPYSEACGENCGQVQNIFMKYPGKKQQNIEDYPEVPAHVRMMIWLGLEKHQEDWTNRELTEGDFCVYAETYENEMNILGKWTAKG--LSRPNFSNTRGDVSLPKKAFIAPDGWRFDGDCLFHCCFSLSYDRDSGHKTFLEDVFQCESRLPGGSWGPATVPWTDVRGDAATAKDEIQCDEDWEWTSEWMVDLNRAVDEDGYEYTVESTIGGYGPVEKTYHLCRRRRWVRSRKLIAELEIDEDDVYAEQLAKEGWEYAPMFTMKFHAKERKMDLVRRRRWHRKMVQEDPSAPA------------------------------DLERET----------------------MMNAPRMFITYEKPHRYQLRAYLFQARDLLASDPDGVSDPYARVVFGTRSSVTETLARTLCPTWDQTLIFDEVNIYGSIEQVAENPPAVIIELYDKDPVGKDEFMGRCVVKPLVKLNGQGPPAPRLLWYDVERGDEYGGEILAAFELFLVSITKVQNASKRGNDEGTDLPFAPPMKGNLFLVPNGIRPVMQRTAIEVLCWGVRNMKKFQLASVSSPSIEFECGGHVVNSTIIKNTQKNPNFDQPLFFFDVYLPKEELYTPPMNIKVRDNRSFGRKPMVGLHALKSLQRFRCDP 1189          
BLAST of Fer-1-related vs. Ensembl Nematostella
Match: EDO36866 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHC4])

HSP 1 Score: 1077.39 bits (2785), Expect = 0.000e+0
Identity = 582/1231 (47.28%), Postives = 789/1231 (64.09%), Query Frame = 3
Query:  669 QIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGD----------NGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNF-SIPAQLRLKLWLGQEKDEMEW-HKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQT--------------DKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPP 4283
            Q+R++V++ RQ+ G NISPV KV   NQ +QTKVK STN P ++  FFFN+   A+  FD  ISFE+FNS+KLR++ALIGSF+ D+   +++  H    KW+LL+DPED   GAKGYLK    +LGPGDEAP     + +       NLL+PAGV +R + F L+VYRAED+P+MDS   + +KKVF  +A  KELVDPY++  FAGK+ +T     SDHPE+ EEL +  + PSMCER+K+Q++DWDR T DD IGTA + LS I+ Q +          +GFLPTFGPC++NF+GS RE+S+LPD F+ LN G GEGVAYRGRL+VEL T L E      E L  + + +++ Q FLRRRK++L A FL A+M+   DS V+FEVSIGNYGN+LD ++ PSSS+T   N +FDG+FY+FLPW +SKPC  V+ HWE+++ RL   N   + ++++  NMDK+++A+ A +P  E A  VI+   DLI  C + LP   +  +   +LD      R  E   I +EA ++R+ AT +E+A+N++E +  +L  ++ EPQN MPDVVIWM+ G KR  Y+RIPAY+VL+S++    G+ CG V ++ LK P  K  +I +   +P ++ + LWLG EKD+  W  +  T GE  + AETYEN    +G+WTT+     RP WS+  G  +L+KE+  PP GW WDGDW+I PE S  YD+D G   ++ED+F NE R+PGGNW P+   +TDI G+       +  P GW+W  EW VD+NR  DE+G+EY+V+ S+G +VPVEK YH+ RRRR+VR RKV+ +K + +        + + WEYAP F +RFH KER  D+V+RRRWHRKM    P  PA+F +   +T                                                   + PR+F+ F+K  K+QLR Y++QA +LLA D  G +DPYARV F  QSQ T     TLCP WDQTLIF  + I+     +VE+PP ++IE+FD DQ+G+DE++GRC  TP VK H   P  P L WY +TKG+ + GE+LAAFEL+L                   LP+ PP   +++ V  GIRP++QRT IE+L WGVRNM K+QLA+V+SPSIEFE GGHV+ + IIKNT  NPNF+ PL F DV LPKEELY PP NIKVRDNR FGR+P+VG+H +NS+  +R  P
Sbjct:    1 QVRVRVIQGRQIAGANISPVVKVTVGNQARQTKVKKSTNRPYFDEMFFFNYQEIASTFFDNLISFEVFNSQKLRANALIGSFESDVGFFFDQQDHMVNRKWVLLTDPEDKMEGAKGYLKVTVIVLGPGDEAPINHDDEDDLE----NNLLQPAGVIMRTSIFALKVYRAEDIPQMDSSFADSVKKVFMGEA-NKELVDPYVLVSFAGKQSRTRCHEKSDHPEFKEELFVSFRLPSMCERLKIQMYDWDRFTADDCIGTAYLPLSAISGQTEEEVISSLCNCSGFLPTFGPCYVNFYGSTREYSDLPDEFDDLNLGIGEGVAYRGRLLVELETTLGENAMSPSEDL--DDEDIIRIQPFLRRRKFKLFACFLEATMVACPDSSVQFEVSIGNYGNRLDTSVEPSSSSTAACNPVFDGSFYYFLPWSDSKPCCSVESHWEDIAFRLEAFNMLTRTLERLQKNMDKVELALDAKMPAPELAALVIALLGDLIQDCRRPLPEVSSKTAGANDLDFKKYAQREKEKLAIAEEARKLRDNATDIEEAMNEIEGYQKRLELVAVEPQNCMPDVVIWMLNGNKRVAYHRIPAYEVLFSHSEQARGKHCGKVLSVFLKYPGKKQFDIEDHPEVPCKIDVALWLGLEKDQDAWTDRSNTGGEFIVFAETYENMTKFLGKWTTKC--AARPSWSNLEGNEKLLKESFIPPLGWRWDGDWFIDPEKSGGYDQDTGHMVFMEDLFENEARLPGGNWEPATTPWTDIHGNEAVDKDTVTCPEGWDWNQEWTVDMNRAVDEDGFEYSVDPSVGAYVPVEKTYHLSRRRRWVRTRKVIKKKPSIEPKKEKDLLEGDGWEYAPAFSLRFHNKERTVDLVKRRRWHRKMLQEDPTEPAVFQMEGGNT---------------------------------------------------STPRMFIKFEKYQKFQLRVYLFQASDLLAADSDGLADPYARVVFQKQSQTTCTKYHTLCPMWDQTLIFEDVMIYRTQELVVESPPKIVIELFDKDQVGKDEYMGRCVATPEVKLHGQGPPAPRLLWYPVTKGDMEGGEILAAFELFLSIWGMRPCTKFLRGDEGADLPYYPPMNKDLYMVPSGIRPVVQRTAIEVLCWGVRNMKKFQLASVSSPSIEFECGGHVVNSTIIKNTQKNPNFDQPLFFFDVYLPKEELYTPPMNIKVRDNRSFGRRPIVGVHCINSLQPFRCEP 1171          
BLAST of Fer-1-related vs. Ensembl Nematostella
Match: EDO47415 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLZ1])

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 431/1094 (39.40%), Postives = 629/1094 (57.50%), Query Frame = 3
Query: 3360 MNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKP----VLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPK-------RGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTY-------------RFPPLIDEASLLTDFPALNESSGGVEGA-QFDN---IEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASL-----GEWGKCNKYQDM------------------------------NYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNL---DDEEEASVGEFKGTFRI--YPLPENIN-EKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNH---DEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNM-------LPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLL-GEKMSDIYVKGWLAGI-DERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCY-NDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMVGV 6395
            + + K  +D ++  P   K  +T +N   LMA P   L++ +  K+ LRA++YQAR+L+  D +G SD +ARV F +    T  I +T  PTWDQTLIF ++ + GD   I   PP +++E+FD D  G+ EF+GR    P+VK   +   KP     L+W+ + +G  +AGE+LAAFEL LQ      F P +        G I  V  GIRP+M++  IE+L WGVR M +  L  V  P ++ ++ GHVIQ+ +I N   NPNF NP+ + DV LP+ E Y PP  I+VRD R FGR  LVG HVLNS+  Y                  +D   LL + P+   S GG E A + D+   IE E M +    Q+R  TD+        +TP          + A +   KK E    +  +    ++ +DWWS+YY +L     G+ G     Q                                 + +++++K ELE +  +N F D+   F L+RGK     DD++   VG+FKG+ ++  YPLPE++  + +   +L+  LPS++P+  +VRVY++KA++L P+D +G ADPY+ V LGK  + ++D+Y+   L P FGR FE + I+P+   L + + D+D + SDD+IGET +DLENRF ++ RATCGL   Y   G NKWRD  +PT+IL + C++  +  P Y T     D  V++   Q          + + H+  S+E  AL  L           L  EHVETR LF+P +PG+EQGKL+ W+D+FP  + + G P +ITPRKP SY+LR+I+WNT+DV+LE+ N+L GEK SDI++KGWL G+ D++Q+TDVHYRSL GEGNFNWRF+FPFQY  AE  +++ +K  F+S DE+E+++P    LQ+WD D FSADDF+G L L+L +MP  AK SK C L+ L+    +  V  ++ F+ +   G+WP + N E    EL GK+E ELELLT+EEA  KPAG  R+   +   LE PNRPD +++   +P +  K +IW N++   I  ++I L+  ++ LF YS+PG T +K+ G 
Sbjct:  927 LGLHKHKKDYLKDAP---KGYQTPKNAHKLMAPPPNHLIYTEKQKFVLRAHVYQARSLIGSDASGLSDAFARVIFTHLVSDTRVIWETRSPTWDQTLIFQEVVLWGDVNEIAVNPPTIVVEIFDKDIGGDSEFIGRALARPIVKMACEPYEKPFFPPALEWFQVCRGEENAGEMLAAFEL-LQVTSGTCFLPSEVEPVNTPDGPITPVPVGIRPVMKKHRIEVLFWGVREMKRINLTTVDRPQVDIDLAGHVIQSTVITNAKKNPNFQNPVCYFDVELPENERYCPPLTIRVRDCRTFGRFTLVGTHVLNSLHRYLQTGEKEKERIEKAGKSCLDRKRLLANGPSRPTSPGGGEVALEMDDAPPIEMEQMEL----QARLITDT--------ETPIAVVATD---MHASTDHEKKKEKGDKDKKEDDDDEDSLDWWSRYYETLKDQEKGDSGTHTSGQGKKKPKKEEESEEEKRKKAIPRLNVSSGSRSDGFCSMKIFKLELECMHDFNGFNDWLHSFPLFRGKKTSEDDDDDHRIVGKFKGSLKVWKYPLPEHVEMDPIVGTFLK--LPSNEPVNVLVRVYVVKALNLHPSDVNGKADPYLVVNLGKHRVRDRDNYVSKQLNPTFGRCFEFEAIIPMDSMLTVGIYDWDLVGSDDLIGETKVDLENRFYSRHRATCGLQDQYATFGFNKWRDPLRPTQILAKLCKEEGLDGPHYSTGRVRVDNKVFVAAPQI--------LEESGHWKQSDEPSALRCLKQFQTLKRGFTLVPEHVETRALFNPEKPGVEQGKLEMWVDMFPMDMPSPGAPVDITPRKPTSYELRVIIWNTEDVLLEEANMLTGEKCSDIFIKGWLEGLKDDKQQTDVHYRSLTGEGNFNWRFIFPFQYQKAEERIVITRKASFFSWDESEEKVPARLHLQVWDADAFSADDFIGDLCLDLTRMPRGAKTSKSCTLDLLKQ---DGSVPQVSFFKMKHMKGFWPFFVNTEEEEIELAGKVEAELELLTQEEAEKKPAGRARE---DPQALEKPNRPDVAWMMMMNPLRGLKAMIWNNYRMCLIKMLVIALLLALMGLFFYSMPGYTVKKIFGA 1985          

HSP 2 Score: 353.984 bits (907), Expect = 2.446e-98
Identity = 240/707 (33.95%), Postives = 370/707 (52.33%), Query Frame = 3
Query:  621 GKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSD-ALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPED--GNSGA--KGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQL-RP-ATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETP-EQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMI--TAVDSPVEFEVSIGNYGNKLD----EXXXXXXXXXXXXNAIF-------------------------------DGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCS------KELP-GWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEG 2585
            G + +  S  +    + I+I++ EARQL G  I PVC V   NQ K T +K  TN P ++  F F+F +    LFD+ + F+ +  R L S  ALIGSFK D+  +Y +P H +  +W +L+DPE+  G SGA  KGY +    +LG GD A      K  + D    NLL P GV   RP A   +++YRAE LP+M+S ++  +KK FT +   ++LV+PY+  QFAG   +T+VK N+  P+WNE++     FP +C RIK+QL D D +T D++IGT  IDLS I+  G NGF+PTFGPC+ N +GS R++S L D    LN G GEGVA+RGRL++ +     E+  E G   + +   + +      +  +++L A F  ASMI     D  V FE+SIGN+GN +D    + +S ++     +N                                  D  +YH +PW +SKPCT +   W++   RLY  N  LKI +++   +      +K +LP     +++     +LI  C+      K +P     G + L +  L L       +    +E     ++ T ++  L    +   +L N++ EPQ+++PDV IWM+ G KR  Y RIP+  ++YS   +  G+  G +QT+ L+ P  +      ++I A+L + +WLG  K + ++ K   +G
Sbjct:  245 GSQISVHSDRSMSMKWYIQIRIHEARQLAGTQIDPVCTVSVGNQKKSTTIKEQTNCPFYDEFFVFDFKMPPMVLFDKIVMFQFYTGRNLVSQGALIGSFKLDVGTVYAQPDHRFCRRWAVLTDPEETLGASGAGVKGYARVDITVLGKGDPAKEQPGIKDNDDDIE-GNLLLPDGVPAERPKARVIIKIYRAEGLPKMNSGLMANVKKAFTGEV--RDLVNPYVEVQFAGHRARTTVKKNTYEPKWNEQVVFSELFPPLCRRIKIQLKDSDSVT-DEVIGTHFIDLSRISNDGANGFMPTFGPCWANLYGSTRDYS-LFDEHNDLNNGLGEGVAFRGRLLIAVHAEFGESASESGIRQVEVEPTAPISDTAAGKDEQFQLFACFYEASMIDRKVGDKMVSFEMSIGNWGNSIDGQPIDEVSHATHIQHTSNTQHTQSTMGGDEDRRDGDNPFLYSLTPPVKPVTNDRQYYH-IPWEDSKPCTHIKFMWQDHRRRLYNSNVLLKICERLEDGLTDCIERVKMDLP--NTFRWLSRVLSELINGCNQYLNLIKSMPTASHVGRTKLDKERLKLCQYEVESVCTSAQELKTSTKDDTHMKDNLKAANALLQRLLNIAVEPQDTIPDVFIWMLCGGKRVAYSRIPSQHIMYSLVEEERGKDSGRMQTVFLRLPGKRGDGPKGWAIQAKLNIMIWLGLHKHKKDYLKDAPKG 943          
BLAST of Fer-1-related vs. Ensembl Nematostella
Match: EDO34141 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ91])

HSP 1 Score: 444.891 bits (1143), Expect = 7.068e-134
Identity = 246/555 (44.32%), Postives = 334/555 (60.18%), Query Frame = 3
Query: 4551 LTLMDEDIDWWSKYYASLGEWGKCNK--YQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGK--NLDDEEEASVGEFKGTFRIYPLPENINE----KLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVV--YIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAF--NPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGR 6179
            +    E+ DWWSKYY SL    K  +  Y+   YD L ++  ELE++  Y E  DF + F L RGK  + D+E+E  VGE K +FR+YPL E+       +L   + E       P++CIVRVYII  +DLQ  D  G  DPY+ V +GKK  + +  Y    L P FG MFE    +P  KDL+I V DYD +S DD+IGET IDLE R L+ + ATCGLP+TY  SGP  WRD   P EIL++ C    +  P +    D+ V   +G+ QF +   +     +   G S +RL+LH L+ + +  EHVETRPL+SPLQP IEQGKLQ W+DIFP +  +I  P EI PRKPK + LR+I+W+T DV L++ ++ GEKMSDIY+KGWL  IDE+ +TDVHYRSL G+GNFNWR  FPF +L  E  + + KK+ +   +E   ++     +QIW+NDKFS DDFLGT  L L ++P P   S+ C          NP+    ++         G+W C+  ++ + +  GK++M LE+LT EEA A+P GLGR
Sbjct:  371 VIFQGEEFDWWSKYYFSLKYQSKQARHYYEKSGYDVLTIFPKELEKM-GYEELQDFVSSFPLKRGKAKHEDEEDEGVVGELKASFRVYPLEEDTRPDDVPRLHGSHQETH--RKWPLKCIVRVYIICGMDLQSQDTDGFGDPYLVVSIGKKEFSTRKDYKKKTLNPVFGEMFEFHASIPSSKDLKITVMDYDRLSRDDLIGETTIDLEQRLLSGYHATCGLPKTYFKSGPYAWRDSKTPKEILREVCLDRGLNRPDFYHKGDQAVTVVVGEDQFNIEDLDDYQLESNELGSSEQRLSLHALHAMGMVPEHVETRPLYSPLQPRIEQGKLQLWVDIFPCTEGSIKPPIEIEPRKPKDFVLRVIIWDTTDVELQETSITGEKMSDIYLKGWLEEIDEKLKTDVHYRSLSGDGNFNWRMEFPFSFLTIEKKLHLSKKKLWGKCEEV--KVDAKLKIQIWENDKFSPDDFLGTRSLPLHRLPKPCSNSRWCGTKYDPGVRQNPDDDFVDLFTLHTHSIRGWWACWQHDSPSGKPKGKVDMSLEILTAEEAKARPVGLGR 920          

HSP 2 Score: 226.098 bits (575), Expect = 2.004e-60
Identity = 126/277 (45.49%), Postives = 180/277 (64.98%), Query Frame = 3
Query:  648 STKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDX-XXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQ 1475
            S+KPQ +Q+R+K+ E RQ+ G NI P+ +V   N+ + T VK STNSP +N + FFNFH S AELFDE ++ E+FNSR   SD+L+G F+ D+  +YE P H ++ KW+LL+      S  +GYLK  A +LGPGDE   S   +     +   +NLL PAGV+ + A F LRVY AEDLP+  S IL  +K    S   +K+ VDPY+ F F GK+I+T  +++ ++P +N+ L++ +  PSMCE IKLQL+DWD  ++ D I TA + LS I+ +
Sbjct:   15 SSKPQHYQVRVKIHEGRQIPGTNIHPLVRVSVGNKKQSTSVKRSTNSPTYNQTLFFNFHASEAELFDELMTLEVFNSRTFLSDSLLGFFESDIGTLYELPDHAFLRKWVLLTGAGVQESEDEGYLKVTAMVLGPGDEPPLSVFVAIVNNYNFFGSNLLLPAGVRRQQAVFQLRVYFAEDLPQ-KSAILFFLK----SAEERKKSVDPYLTFSFCGKQIQTKTQHHENNPVFNQMLQLPVMLPSMCENIKLQLWDWDSFSKHDCIATAYLPLSEISGK 286          

HSP 3 Score: 58.5362 bits (140), Expect = 3.515e-8
Identity = 27/79 (34.18%), Postives = 45/79 (56.96%), Query Frame = 3
Query: 2316 QNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKD 2552
              +MPDV+IWMI+G KR  Y+R+PA D++YS +    G++CG      L   ++ +      S+  +L   ++ G+E D
Sbjct:  301 HGNMPDVIIWMISGGKRVAYHRVPARDIMYSPHKHASGKWCGKPMENTLPGIAIANQIHKYSSMRTKLSHVIFQGEEFD 379          
BLAST of Fer-1-related vs. Ensembl Medaka
Match: myof (myoferlin [Source:NCBI gene;Acc:101172285])

HSP 1 Score: 1147.5 bits (2967), Expect = 0.000e+0
Identity = 691/1665 (41.50%), Postives = 977/1665 (58.68%), Query Frame = 3
Query:   90 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLN--LLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGS-GPQIKIKK---VGKRTTR----KSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQG----------DNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSD-YIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMG----GFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKAD--DDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPM-KPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQ---TDKPLPFTPPKRG-NIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLD-DEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKML 4985
            + V V +A  L   +L G  DP   + ++  KKKTK I   LNP W+E L FDL G+ L  +  L V V D E IG +  +GS  +PLRDLA G+     + N  LL +N +      N+ V +                          ++ G E D     ++G SGS G    IK+   V +R TR       +TKPQDFQIR++VVEARQL G NI PV KV    Q  +T++K S N+P ++  FF+N H+  ++LF+++ISF ++NS  LR+D+L+G FK D+  +Y+EP H  M KWLLL+DP+D +SGAKGYLK    ++G GDE         ++ D+IE+NLL PAG+ LR AT +L+V+RAED+P+MD   ++ IK++F ++  KK LVDP++  +FAGK++ T +   + +PEWN+ L + ++FPSMCER+KL +FDWDR+T +D +GT  +DL+ IA+ G          + GFLP FGPC+IN +GSPREF+ LPD ++ LN+GKGEGVAYRGR++VELST LDE  E+  + + I + S++     + RRKY L A F SASMI     P++FEVSIGNYGNKLD T  P +STTQ + A+FDG  Y++LPW N+KP  V+   WE++S RL  VN  L I  ++ SN++  KVAI A +P+ + A+  +   D LI    +       G S LT LD+ L   R   L +I++  LR+R+EA+ +   L+D+E++ ++L+ L+ EPQNSMPDVVIWM+ G+KR  Y RIPA+++L+S  S+   G+ CG  QT+ LK P  K        +P Q+R+ +WLG   DE +++   +EG  S+ AE YENQA + G W T   ++ R  +SD +G+++L +E   PP+GW W+ DW+I PE +L  + DAG ++++++VF NE R PGG W  +  Q+TD+ G+    P +   P GW WED W VD+NR  D++GWEY V    G     +VP EK+YH+         R+    +   +D+SSS+ +  D E WE++ L   +FH KER +D  RRRRW RKM P  + G  AIF L                      E  + VD E ++         K  K N         P +   F +++ + LR Y+YQARNL++ D+  FSDPYA V+FL+ S+ TE++  TL PTWDQTLIF+ +EI+GDP  I   PP V++E +D DQ+G+DE LGR   TP+VK  P+  + P L W+ + +  + AGE+L A EL L+    D  LP  PP R  N++ V  GIRP++Q T +EIL+WG+RNM  YQLA+V+SPS+  E GG  ++T IIKN   +PNF   +LF+ VLLPK+E+Y PP  +KV D+R FGRKP+VG   + S++ +R  P +  +                EGA+   +   + S H D                             T+   SP  +  E E             +DWWSK+YAS GE  KC  Y    YDTL+VY  ELE V  +   TDFC  F L RGKN + DE+   VGEFKG F++YPLP++     P +   + LP S P EC+VR+YI++ IDLQP D +G     V +QL KK +
Sbjct:    2 LRVVVESAKGLPKKKL-GSPDPIATVIYKDDKKKTKRIDNELNPVWNEVLEFDLKGSPLDSSSFLEVVVKDYETIGRNIHIGSAKIPLRDLAAGQVRSLPSKNVPLLGENGQ------NIGVGFI---------------------FSACEAGGDENDGETATDLGQSGSAGVPSSIKQSANVRQRLTRGQSRHRLATKPQDFQIRVRVVEARQLPGNNIKPVVKVHVCGQTHRTRIK-SGNNPFFDEMFFYNVHMLPSDLFEQSISFRVYNSYSLRADSLMGEFKLDVGYVYDEPAHCVMRKWLLLNDPDDSSSGAKGYLKVSLFVIGTGDEPLVEKRDCDDDQDDIESNLLLPAGMTLRWATLSLKVFRAEDIPQMDDAFVQSIKEIFGAEENKKNLVDPFLEARFAGKKLCTQIIEKNANPEWNQVLHLQVKFPSMCERVKLTVFDWDRLTGNDAVGTTYLDLAKIASSGGEIEGNPVESEVGFLPVFGPCYINLYGSPREFTGLPDPYDDLNFGKGEGVAYRGRILVELSTKLDEKAEKTIDNIHIKRTSIIS----ILRRKYCLCAVFHSASMIQEPGEPIQFEVSIGNYGNKLDTTCKPLASTTQYSCAVFDGNQYYYLPWANTKPVVVLTSFWEDISHRLNAVNIILCITHRLQSNLEAFKVAILAKVPDNKLAEVWLQLLDQLIEDLERFPTPELEGCSNLTSLDIQLKKRRDITLNSIKEAVLRMRQEASEIRDTLSDIETWVDKLKQLAEEPQNSMPDVVIWMLRGEKRVAYSRIPAHEILFSTYSEQACGKNCGKTQTVFLKYPMDK---AKGLKVPVQIRVSMWLGLSADEKKFNSY-SEGTFSVFAELYENQAKVFGNWGTTG-LVGRHKFSDVTGKLKLKQEYFIPPRGWEWESDWFIDPEKALLTEADAGHTEFMDEVFQNETRFPGGEWKAASEQYTDVNGEKSRNPSEFDCPPGWIWEDSWTVDINRAVDDQGWEYGVTIPPGDKPLSWVPAEKVYHV--------HRRRRLVRPRKRDASSSRRNKGDPEGWEFSSLIGWKFHRKERSSDTFRRRRWRRKMAPEDRLGASAIFQL----------------------EGALGVDTEEKE---------KTSKANATKMFGANTPTVSCTFDRSYMYHLRVYVYQARNLMSMDKDSFSDPYAHVSFLHVSKTTEKLKATLNPTWDQTLIFNSVEIYGDPQKIAHRPPDVVLEFYDEDQVGKDEMLGRSICTPLVKLSPEMDQSPRLFWHPIIQKGQRAGEVLVAAELILKDKSGDSDLPLLPPMRAENLYMVPQGIRPVVQLTAVEILAWGLRNMKPYQLASVSSPSLVVECGGQRVETAIIKNMKKSPNFPGNILFIKVLLPKDEMYTPPIVLKVIDHRPFGRKPVVGQCTIASLEDFRCDPYVIVS----------------EGARSSKMALMMASPHKD--------------------------VAITMEESSPLLEAQEKET------------VDWWSKFYASTGEQDKCGPYLKKGYDTLKVYDNELENVPEFKGLTDFCNTFKLQRGKNDNGDEDPTVVGEFKGAFKVYPLPDDPGIAPPPRQFRE-LPESGPQECLVRIYIVRGIDLQPKDNNG----RVRIQLPKKQI 1530          
BLAST of Fer-1-related vs. Ensembl Medaka
Match: dysf (dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) [Source:ZFIN;Acc:ZDB-GENE-070501-1])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 514/1253 (41.02%), Postives = 709/1253 (56.58%), Query Frame = 3
Query:  666 FQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFA------GKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN-------GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVRE-EATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQA--SLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWED-EWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPM-KPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELY-LQTDKPLPFTPPKR-GNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLI-----DEASLLTDFPALNESS 4337
            FQ+R++V+EARQL G NI PV KV    Q K+T+++   N+P ++ +FF NF  + +ELFDE I   + ++        +GS         + P H ++ KWLLLSDP+D +SG KGYLK    +L  GDE P     +  E      NLLRPAG+ LR A FT+R++RAEDLP+MD  I++G++++   D+ +K LVDP +   F        + I+    +        +     L FP    R        DR + +D+IGTA + +S I+A G         GFLPTFGPCF+N +GSPREF+   D  EALN GKGEGVAYRGR++VEL+T L E PE   + +P   D LL  +KFLR+RK+ L  AF SA+++  VD  ++FEVSIGNYGNK D +  P +STTQ + A+FDG  Y++LPWGN KP  V+   WE++  R+  +N    IID++V  +         +L  +  + +++                       +T LD ++  +RT  L  I   AL  +    T +   L   E + N+LR ++ EPQNS+PD+VIWM+ G +R  Y+RIPA+ V +S    + G+ CG +Q+I LK P           +P QLR+K+W G   D   +++  TEG+LS+ AETYENQ   +LVG W +    +T P +SD SGRV+L KE+ KP  GW W GDW+ISPE +L +D DAG   Y E+VF  + R+PGG W      +TD+ G+   +  D+  P GW WE+ EW  DLNR  D++GWEY V    +     +VP EKMYH  RRRR+VR R+   +K+             E WEYA LF  +FH K RKTD  RRRRW R+M+P+ K G  AIF L               ++V I                                 G   V R F       ++ LR ++YQAR+L A D+  FSDPYA V+FL+QSQ T  I  TL P WDQTLIF+++EI GD  A   TPP V++E++D D  G DEF+GRC   P +   P       L WY + +G++ AGELLAAF+L   + +  LP+ PP+R  ++F V  GI+P++QRT IEIL+WG+RN+  YQ+A+V SPS++ E GG +IQ+ +I N    PNF+   L LDV LP+EELYMPP  IKV DNR FGRKP+VG   +  ++ YR   L+     + AS L  F    E S
Sbjct:   38 FQVRVRVIEARQLPGINIKPVVKVGVAGQTKRTRIRKG-NNPVFDETFFMNFFETPSELFDEPIFITVSST--------LGS--------KDIPGHCFLRKWLLLSDPDDLSSGVKGYLKVSLFVLAAGDEPPCVEEKEDIE-----GNLLRPAGLSLRGAVFTVRIFRAEDLPQMDDAIMDGMRQILGFDSNRKNLVDPMVELHFQTLMTNDNRSIEEFGSFECFSWFGIKNNTTFLAFPLSYIR--------DRASHNDVIGTAHLCMSKISAPGGEIDVDDSLGFLPTFGPCFVNMYGSPREFTTFHDPHEALNLGKGEGVAYRGRVLVELTTKLLEKPEHRTQDIPT--DDLLVVEKFLRKRKFSLFVAFYSATLLQDVDDAIQFEVSIGNYGNKFDYSCLPLASTTQFSRAVFDGCHYYYLPWGNIKPVVVLSSEWEDIRPRIEALNMLHAIIDRLVGML--------LHLLHDSSSTWLVPC---------------------VTPLDRSIRHIRTLHLKQIAAAALAFKHGPETELSTMLEHAEDWANRLRTIAEEPQNSLPDIVIWMLQGDRRVAYHRIPAHSVFFSKQ--HCGKHCGQLQSIFLKHPQGSGGAA---KLPGQLRVKVWFGLAADAPHFNQC-TEGKLSVFAETYENQTRLALVGSWGSTG--LTYPKFSDISGRVKLPKESFKPSPGWTWAGDWFISPERTLLFDVDAGHMTYTEEVFETQMRLPGGQWIGMQEGYTDVNGEKTLSKDDVECPPGWVWEEVEWSEDLNRAVDDQGWEYGVTIPPDRRPKSWVPAEKMYHTNRRRRWVRMRRRDLQKM-------EALRKKEGWEYASLFGWKFHLKPRKTDSFRRRRWRRRMEPLEKTGPAAIFALE-------------CSLVRI---------------------------------GWGGVRRFF----GGSRYHLRCHMYQARDLPAMDKDSFSDPYAIVSFLHQSQKTVTICNTLNPIWDQTLIFYEVEIFGDNEATATTPPSVVVELYDQDTYGADEFMGRCVCRPSLSPSPR------LAWYPIQRGDKSAGELLAAFQLIRREKESDLPYLPPQREPDVFMVPQGIKPVLQRTAIEILAWGLRNLKSYQMASVKSPSLQVECGGIMIQSCVIHNVKKKPNFDINTLILDVRLPQEELYMPPIVIKVIDNRQFGRKPVVGQCSIRLLEDYRVSRLLVDLMHETASHLKQFHDRGEES 1158          

HSP 2 Score: 149.828 bits (377), Expect = 1.287e-35
Identity = 73/143 (51.05%), Postives = 99/143 (69.23%), Query Frame = 3
Query: 4563 DEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEAS-VGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLT 4988
            +E +DWWSK+YAS+G+  KC  Y +   DTL+VY  ELERVE ++  +DFC  F LYRGK  D+ ++ S VGEFKG F+IYPL ++     P +  +K LP +   +C+VRVYII+A  LQP DP+G  DPYV++ LGKK +T
Sbjct: 1156 EESVDWWSKFYASVGDKNKCGTYLEQGLDTLEVYDRELERVEEFDGLSDFCQTFKLYRGKTQDEGDDPSVVGEFKGMFKIYPLSDDPAAPAPPRQFKK-LPPNGIEDCLVRVYIIQANGLQPKDPNGKCDPYVKISLGKKTIT 1297          
BLAST of Fer-1-related vs. Ensembl Medaka
Match: myofl (myoferlin [Source:NCBI gene;Acc:101156429])

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 521/1412 (36.90%), Postives = 755/1412 (53.47%), Query Frame = 3
Query:   90 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLN--LLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDN---GFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNS-DYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTV----EASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMK-PGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAG-ELLAAFELYLQTDKPLPFTPPKRG-NIFCVADGIRPMMQRTGIE-ILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPP 4283
            M   ++     I  + +G  DP   + F+ +KKKTK +   LNP W+E L FDL G+ L  +  + V V D E  G    +GS  + L DLAGG      + N  L+++ ++     ++L + Y                                 ++  NA+        Q  +    KR   K  +++ QDFQIR++V+E R L G +I PV +V    +  +T V+   N+P ++  FF+N ++S ++L DE                                 H  M KWLLL DP+D   GA+GYLK    I+G GDEAP  +   + E D++E+NLL PAGV +R AT +L+VYRAED+P+ D+ + + +K+    +  KK LVDPY+   FAGK++ T +   + +PEWN+ + + ++                    DD+IGT  ++LS I+  G N   GFLP FGPCF+N +GSPRE+ +LPDRFE LN+G GEGVAYRGR++VELST LD+  E+  + +P  +D +L +Q F RRR+Y L + F SA M+     P+ FEV++GNYGNKLD T  P  STT    A+FD  +Y +LPW ++KP  ++  +WE++S RL  +N  L   D++ SN++ +K AI A  PE    +  +   D +I      LP  E   + +T LDL    LR   + NI + A  ++EEA  +   + D+E + ++++ L+ EPQNSMPDV+IWM  G+KR  Y R+PA  +LYS+ S    G+ CG +QTI ++ P  K+  +    IPA+LR  +WLG    E E+ +  +EG  SI  E YENQA L+G+W T A ++    +SD +G+++L +E   PPQGW W+G        SL  + DAG S++ ++VF NE R PGG W P+   +TD+ G+   +PK+   P GW WED+W  D NR  DE  WEY V          +V  EK +H+       R       KL+ + + + + D +E WEY+ LF  +FH KER +D  RRRRW R M P    G  AIF L                                         +  + KT E+       P +   F  ++ + LR YIYQ RNL   D   FS PYA V+FL+ S+ T  I  TL P WDQTLIF  IEIHGDP  +   PP V++E++D DQ+G+DE +G C+  P++   P+   +P LQW  +TK   +AG  LLAA  L    D  LP  PP+R   ++ V  GI+P++Q T IE +L+WG+RNM  +QL+ V+SPS+  E GG  ++T I              + L  LLPKEE+Y PP  +KV D++ FG KP+VG   + S+  +R  P
Sbjct:    1 MLRVIVECAKGIPKKKLGNPDPITTVVFR-EKKKTKAVNSELNPVWNEILEFDLDGSPLDASSFIDVVVKDYETFG-KHFIGSSKILLGDLAGGHVASLPSKNVPLINEKQQIIGATISLLIVY---------------------------------EKPSNAD-------DQKPLCLTRKRN--KPLASEAQDFQIRVRVIEGRHLPGIDIKPVVRVLFDGKTHRTNVR-GGNNPFFDEMFFYNVNMSLSDLSDE---------------------------------HAIMRKWLLLKDPDDSTMGARGYLKVSIIIMGTGDEAPIENRLFRAEQDDLESNLLVPAGVSMRTATLSLKVYRAEDMPQDDATV-QTLKQFLGGEGDKKNLVDPYLEVSFAGKKVCTKIIQKNANPEWNQLISLNVK--------------------DDVIGTTFLNLSQISHSGGNVEVGFLPAFGPCFVNLYGSPREYGDLPDRFEELNFGNGEGVAYRGRVLVELSTHLDKKVEKNVDDIP--RDDVLVAQ-FQRRRRYSLCSVFHSACMLQEPGGPIRFEVTLGNYGNKLDSTCKPLVSTTPNCFAVFDNHYY-YLPWADTKPVVILTSYWEDISHRLDAINILLFTADQLESNLNLLKTAISAKEPESRLTEIWLKLLDHIIEELV--LPALEDRLN-VTVLDLQKKNLREAAVYNIMQMACCMKEEARDIGSTVADIEDWLDRIKQLAEEPQNSMPDVIIWMFRGEKRVAYARVPANQILYSSFSKQACGKHCGKIQTIFMQYPMDKNKGV---KIPAELRFNMWLGLSVHEKEFSRF-SEGNFSICVEMYENQA-LLGKWGT-AGLINCHKFSDVTGKIKLKQELFLPPQGWEWEG--------SLLAEADAGCSKFTDEVFQNEIRFPGGEWKPAAELYTDLNGEKVASPKEFECPPGWTWEDDWSFDSNRAVDER-WEYGVTLPPNEKPSSWVAAEKTFHV----HRRRRLIRPRRKLSGKKTVAKRRDSEEGWEYSSLFGSKFHIKERCSDTFRRRRWRRNMIPSHCSGCSAIFKL-----------------------------------------EGVLSKTEEDKLFGAKTPTVSCHF-SSYIYHLRVYIYQGRNLCPMDHNSFS-PYAHVSFLHMSKTTHVIQNTLNPIWDQTLIFEDIEIHGDPQTVASCPPEVVLELYDSDQVGKDEPMGHCKYPPLINLQPNIGCRPKLQWLPITKKGHNAGELLLAAELLLKLDDDDLPIVPPRRSEKLYMVPQGIKPVVQLTAIEQVLTWGLRNMEAFQLSPVSSPSLIVECGGETVKTAI-IKNFKKNPNFPGSVLLLKLLPKEEMYAPPIVLKVIDHKPFGWKPVVGQCTIRSLGEFRCDP 1243          

HSP 2 Score: 443.736 bits (1140), Expect = 1.418e-126
Identity = 270/614 (43.97%), Postives = 373/614 (60.75%), Query Frame = 3
Query: 4563 DEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEAS-VGEFK-GTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPN--SQVKNINLFECRRAYGYWPCYNDETGTAELT-GKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMV 6389
            DE +DWWSK+Y+SLGE  KCN Y    YDTL+VY  ELE+VE +   TDFC    L++GK +DD+E+ S VG+FK G+F+IYPL ++ +   P     K LP S P EC+VR+Y+++ I++Q  D +G  DPY+++ LGKK L ++D+Y PN L PEFG MFEL C LP  KDL+I V D+D  S D+ +GET IDLE+R L+ FR  CGLPQTYC SG N+WRD  KP++IL+   +   +PPP+ + +   +++ G+R + L  F  N   ++H GP  ERL+LHVL  L L  EHVETR L S  +  + QG++Q W+DIFP  +   G P EI+PRK K Y LR+I+WNT DVIL+D ++  EK SDIYV                                              K+E FW+ D+TE R P   ++QIWDND+ S DD+L ++EL+L ++  PAK  ++C L  L        S+ K  +LF  +   G+WPC N + G+  LT GK+EM LE++ E+EA  +PAG GR+EPN NPKL+PP    TSF WFT+     KF+    F+W F+ G+++ L    + +   SIP   A K+V
Sbjct: 1279 DEAVDWWSKFYSSLGEQQKCNPYLRKGYDTLKVYNCELEKVEQFQGLTDFCRTINLHQGKTVDDDEDPSVVGQFKQGSFKIYPLSDDPSVPAPPCQF-KELPESGPQECLVRIYVVRCIEVQSKDSNGKCDPYIKITLGKKTLDDRDNYKPNTLSPEFG-MFELSCTLPQDKDLKIAVYDFDKWSRDEEVGETVIDLEDRLLSYFRPCCGLPQTYC-SGVNQWRDQLKPSQILQNVAKMRGVPPPSIEEDGRSLLFSGKR-YHLQDFA-NILIHSHLGPEKERLSLHVLRNLGLVPEHVETRTLSSSYKSNLSQGRIQMWVDIFPKRLGLPGPPCEISPRKAK-YFLRVIIWNTSDVILDDASITAEKTSDIYV----------------------------------------------KQEQFWNWDKTEYRNPPKLIVQIWDNDRISLDDYL-SVELDLLRLVPPAKTPEKCTLKMLPGMKGTVASKAKPTSLFSRKSVRGWWPCANAQNGSCVLTQGKVEMTLEIVDEKEAEERPAGRGRNEPNMNPKLDPPRPA-TSFAWFTNVSSILKFMTRIKFRWIFVWGVLLVLAIFFLGIMFLSIPSYFAMKIV 1838          
BLAST of Fer-1-related vs. Ensembl Medaka
Match: otofa (otoferlin [Source:NCBI gene;Acc:101155482])

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 417/1082 (38.54%), Postives = 617/1082 (57.02%), Query Frame = 3
Query: 3360 MNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKT---HPDDPR-KPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPP-------KRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWG------------KCNKYQDMN--------------------------YDTLQVYKTELERVETYNEFTDFCTKFLLYRGK-----NLDDEEEASVGEFKGTFRIY--PLPENINEKL---PAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNM---LP-----LTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLL-GEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWP-CYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMVGV 6395
            + V+++ +D +   P   +  K  E   G +++P L LV+     +QLRA++YQAR+L A D +G SDP+ARV F   SQ TE + +TLCPTWDQ L+F  +E+ G+ + + E PP +++E++D D +G+ EF+GR    P +K    H   PR  P L+++ + +GN  AGELLAAFEL           PP       +RG I  V  GIRP++ R  IE+L WG+R++ +  LA V  P ++ E  G  +Q+ +I+N   NPNF+  + + +V LP+ EL  PP NI+V D R FGR  LVG H ++S+  + + P         D  + N +S G          + ++++ ++ Q R+  D+++  D   ++ K+KK  K         + + DE               +DWWSKY+AS+                K +K ++ +                           D L V+  ELE    +  F D+   F LYRGK         +++  VG FKG+  +Y  PL E I  +    P   + + +P + PI  +VR+Y+++A DL P D +G ADPY+ ++LGK  + +K++YI   L P FG+ F+++   P++  L + V D+D + +DD+IGET IDLENRF +KFRATCG+  +Y + G N WRD  KPT+IL + C++  I  P Y       V +  R F  +        N     + E LAL VLN    +P     L  EHVETRPL +P +PGIEQG+++ W+D+FP+ +   G   +I+PRKPK Y+LR+I+WNT +VILED++   GEK SDI+V+GWL G  E +Q+TDVHY SL GEGNFNWRFVFPF+YL AE  +++ KKE  +S DETE ++P    LQ+WD D FSADDFLG +EL+L + P  AK +KQC L+ ++      ++  I++F+ +R  G+WP    DE    ELTGK+E EL L+T EEA   P GLGR+   E   LE PNRPDTS +WF  P K+ ++ IW N++W  +  + + L+ L++ LF+YSIPG   +K++G 
Sbjct:  920 LGVNRQRKDFLSGLPNGFEEVKAVEGGPGFLSLPPLSLVYSMKQVFQLRAHMYQARSLFAADSSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDDVELFGEASELREDPPIIVVEIYDQDTVGKAEFIGRTFAKPTIKMCDEHYGPPRFPPQLEYFQIYRGNCTAGELLAAFELLQIGQGGKADLPPIEGSTDSERGPILPVPLGIRPVLSRYRIEVLFWGLRDLKRINLAQVDRPRVDIECAGRGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYILVGTHAVSSLRRFIYSP--------PDKTSNNWASAG----------DVIVNLDTEPQIRK-MDTVVKLDAVKESDKEKKKKKKKKKGGLDEEEETDE-------------RVLDWWSKYFASIETLKEVIYVKPNDLLLKGSKIKEKSREKKGVKDKKKGQPPESSEKQPLKAKVDELVVFNKELE--SEFGNFEDWLHTFNLYRGKAGDDDEHALDDDRIVGRFKGSLCMYKLPLSEEITREAGYDPNMGMFQSIPHNDPINVLVRIYVVRATDLHPADINGKADPYIVIRLGKTEVKDKENYISKQLNPVFGKSFDIEATFPMESMLTVSVYDWDLVGTDDLIGETKIDLENRFYSKFRATCGISSSYSVHGYNIWRDPMKPTQILTRLCKEGKIDGPHYGPGGK--VKVANRIF--TGPTEIEDENGLKKQTEEHLALTVLNHWEEIPRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPSDMPAPGPALDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFEYLVAEEKIVISKKESMFSWDETEYKIPPRLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSLDMIRN---EHELPTISIFKQKRVKGWWPFVARDENDEMELTGKVEAELHLVTAEEAEKSPVGLGRN---EPDPLEKPNRPDTSLMWFLGPLKSIRYFIWHNYRWLILKALGLILLLLMLGLFLYSIPGYLVKKLLGA 1957          

HSP 2 Score: 377.481 bits (968), Expect = 3.123e-105
Identity = 253/717 (35.29%), Postives = 387/717 (53.97%), Query Frame = 3
Query:  576 IGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKL-RSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGV--QLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDET--PE-------QGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMI--TAVDSPVEFEVSIGNYGNKLD-----------------------------------EXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKAN--LPEEEQAQFVISAFDDLIMHCSK--ELPGWEAGESPLTELDLNLNTLRTNELGNIRKEA--LRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLG---QEKD 2552
            + N  S P IK++           S +P D+QI I VVEARQL G N+ PV  V+  +  K T +K STN P +N  F F+FH+    LFD+ I   + +S+ L RS  L+G+FK D+  +Y +P+H + +KW +LSDP+D  +G KGY+K   A++G GD   +   + + + D+IE NLL P G+  + + A F +++YRAE LP+M++ I+  +KK F  +   ++LVDPY+  QFAG++ KTSV+ +S  P WNE++     FP +C+RIK+Q+ D D++  D  IGT  IDL  I+  GD GFLPT GP ++N +GS R+++ L D  + LN G GEGV++R RL+V ++  + +T  PE       Q + +  I++ +  K ++F       L  +FL A+M+     D P+ FE++IGNYGN++D                                   E    S STT     +     Y  LP+   KPC  +   W++   RLY  N   KI DK+   ++ ++  IK     PE      +    ++L + CS+   L   +   +  T+LD         EL ++ ++A  LR + +  +V+  L   +SF  +LR L+ EPQ+S+PDV IWM++  KR  Y RIP+ D+LYS   +  G+ CG V+   LK P  K      +++ A+L L LWLG   Q KD
Sbjct:  235 VSNKRSKPDIKME---------PGSGRPVDYQISITVVEARQLIGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVPPDVLFDKIIKLSVIHSKNLLRSGTLVGTFKMDVGTVYFQPEHQFYHKWAILSDPDDITAGCKGYVKCDIAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGIPAERQWARFYVKIYRAEGLPKMNTTIMANVKKAFIGE--NRDLVDPYVQVQFAGQKGKTSVQKSSYEPIWNEQIVFTELFPPLCKRIKVQIRDSDKVN-DVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNMYGSTRQYT-LMDEHQDLNEGIGEGVSFRARLLVSVAVEILDTTSPEIISSSDVQVEGVSNISESATGKMEEFF------LFGSFLEATMVDRKIGDKPITFEITIGNYGNQIDGVSKSPAAKKKKKDGENEEDENELILNSSEDEAEEEGDLVSVSTTPLMKPVITDRNYFHLPYFEKKPCVYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEIIKTEKAFPERR----LRGVLEELSVGCSRFVALANKDVNLAGRTKLDRERLKSCMRELDSMGQQAKQLRTQVKKNTVKDRLKLAQSFLQRLRFLADEPQHSIPDVFIWMMSNNKRIAYARIPSKDILYSTVEEETGKDCGKVKAAFLKLPGKKSFGPAGWTVQAKLELYLWLGVNRQRKD 928          
BLAST of Fer-1-related vs. Ensembl Medaka
Match: otofb (otoferlin-like [Source:NCBI gene;Acc:101160130])

HSP 1 Score: 382.489 bits (981), Expect = 1.206e-107
Identity = 227/562 (40.39%), Postives = 340/562 (60.50%), Query Frame = 3
Query: 4572 IDWWSKYYASLGEWGKCNKYQDMNYDTL-QVYKTELERVETYNEFTDFCTKFLLYRGKNLDDE------EEASVGEFKGTFRIYPLPENINEKLPAKY---LEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTY----KTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNM---LP-----LTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLL-GEKMSDIYVKGWLAGIDE-RQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWP-CYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRD 6182
            +DWWSKY+AS+              +TL +VY  ELE    ++ F D+   F L+RGK  DD+      E+  VG+FKG+  +Y + ++    +       + + +P++ P+  +VR+Y+++A DL P D +G ADPY+ ++LGK  + +K++YI   L P FG  F+++   P+   L + + D+D + +DD+IGET IDLENRF +K RATCG+       G N WRD  KPT IL + C+   +  P Y    +   +  V++   + +  + ++ T         +E LAL VL     +P     L  EHVETRPL  P +PGIEQG+++ W+D+FP  +   G   +I+PRKPK ++LR+I+WNT +V+LED+++  GEK SDI+V+ WL G  E +Q+TDVHY S+ GEGNFNWRFV+PF YL AE  +++ KKE  ++ DETE ++P    LQ+WD D FSADDFL  +EL+L + P  AK +KQC    ++     +++  +++F+ +R  G+WP    +E    ELTGK+E EL LLT EEA   PAG GR+
Sbjct: 1096 LDWWSKYFASI--------------ETLTEVYPKELE--SEFDNFEDWLHTFYLFRGKAGDDDDQTVADEDRIVGKFKGSMCMYKVSDDAPRDMSFDSNMGMFQNIPNNDPVNVLVRIYVVRATDLHPADINGKADPYIAIKLGKTEIKDKENYISKQLNPLFGS-FDVEATFPMDSTLTVSIYDWDLVGTDDLIGETKIDLENRFYSKHRATCGVAN----HGYNVWRDPMKPTHILAKLCKDGKLDGPHYGPGGRVKVENRVFMAPTEIEDENLKKKT---------DEHLALCVLTHWEEIPRVGCKLVPEHVETRPLLHPDKPGIEQGRIELWVDMFPKEMTAPGPALDISPRKPK-FELRVIIWNTDEVVLEDDDIFTGEKSSDIFVR-WLKGQQEDKQDTDVHYHSITGEGNFNWRFVYPFDYLMAEEKIVISKKESMFAWDETEYKIPPRLNLQVWDADHFSADDFLA-IELDLNRFPRGAKTAKQC---TIEMVTNEAEMPMVSIFKQKRIKGWWPFVARNEEDEFELTGKVEAELHLLTGEEAEKSPAGEGRN 1621          

HSP 2 Score: 353.984 bits (907), Expect = 1.710e-98
Identity = 248/731 (33.93%), Postives = 386/731 (52.80%), Query Frame = 3
Query:  549 EEDETDNAEIGNSGSGPQ-IKIKKVGKRTTRKSYSTKPQ-----------DFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKL-RSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGV--QLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDET--PE-------QGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMI--TAVDSPVEFEVSIGNYGNKL---------------DEXXXXXXXXXXXXNAIFDGTF----------------YHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCS-KELPGWEAGESPLTELDLNLNTLRTNELGNI--RKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLG---QEKD 2552
            E +  DN  +   G  P  I +  V   TT  S  +KP+           D+Q+ + V+EARQL G N+ P+  V+     K T +K STN P +N  F F+FH+    +FD+ +   + +S+ L RS  L+G+FK D+  IY +P H + +KW LLSDP+D  +G KGY+K   A++  GD   +   + + + D+IE+NLL P GV  + + A + L++Y+AE LPRM++ I+  +KK F  +   K+LVDPY+  QFAG++ KTSV+ +   P WNE++     FP +C R+K+QL D D++  D  IGT  +DL +I+  GD  FLPT GP ++N +GS R FS L D ++ LN G GEGV++R RL++ L   + +T  PE       Q + +  I++ +  K ++F       L  +FL A+MI     D P+ FEV+I  YGN++               DE  +     +       DG                  Y  LP+   KPC  +   W++   RLY  N    I DK+   ++ +   IK      E+   +    ++L   C    L   +  +S  T+LD     L  +E+  I  + +A+R + + ++V   L   ++F ++LR L+ EPQ+S+PDV IWMI+  KR  Y RIP+ D+LYS+  +  G+ CG V+TI L+ P  K      +++ +++ + LWLG   Q KD
Sbjct:    6 EAENLDNNGMFRGGPDPDTISLASVTAVTTNVSNKSKPEIKMEPSSGRPVDYQVSVTVIEARQLVGLNMDPMVCVEIGEDKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKILKVSVIHSKNLLRSGTLVGTFKLDVGTIYSQP-HQFYHKWALLSDPDDITAGGKGYVKCDIAVVAKGDTIKTPHKANESDEDDIESNLLLPEGVPAERQWARYYLKIYKAEGLPRMNTSIMANVKKAFIGE--NKDLVDPYVQVQFAGQKGKTSVQKSCYEPIWNEQIAFTEMFPPLCRRMKIQLRDSDKVN-DVAIGTHFLDLRNISNDGDK-FLPTLGPAWVNMYGSTRTFS-LLDEYQELNDGLGEGVSFRARLLISLGVEILDTSSPEISCSTEVQVEGVPNISESATGKVEEFF------LFGSFLEATMIDRKIGDKPINFEVTI-YYGNEIDGALQPKPKGEKGKGDEEETELIHNSSEEEMEDDGDLTSVATTPPMKPVITDNYFHLPYFERKPCIYIKSLWQDQKRRLYNSNIIDNIADKLEDGLNDVNEIIKTEKAYPERR--LRGVLEELSQGCQFLALANKDQNQSGRTKLDKERLKLCLSEVEAIGLQAKAMRSQVKKSTVRDKLKLSQNFLSKLRFLADEPQHSVPDVFIWMISNGKRIAYARIPSKDILYSSIDEEKGKDCGKVKTIFLRIPGKKGFGPAGWTVQSKIEIYLWLGLTRQRKD 721          

HSP 3 Score: 191.43 bits (485), Expect = 4.068e-48
Identity = 120/292 (41.10%), Postives = 177/292 (60.62%), Query Frame = 3
Query: 3444 GLMAVPRLFLVFKKAHK-WQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKT---HPDDPR-KPVLQWYNLTKGNRDAGELLAAFELYL-----QTDKPLPFTPPK---RGNIFCVADGIRPMMQRTGIE-ILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRF 4277
            GL + P + L +    + +QLR ++YQAR+L A D TG SDP+ARV F  QSQ TE + +TLCPTWDQ L+F  +E+ G+   + + PP ++IE++D D +G+ +F+GR    P+VK    H   PR  P L++Y + +GN  AGE+LAAFEL       + D P P   P    RG I  V  GIRP++ +  IE +L WG+R++ +  LA V  P ++ E  G  +Q+ +I N   NPNF+  + + +V LP+ EL  PP NI+V D R FGR  LVG + ++S+  + +
Sbjct:  740 GLPSTPPISLTYMSVKQIFQLRVHMYQARSLFAADSTGLSDPFARVFFSTQSQVTEVLAETLCPTWDQLLVFENVELFGEAVELRDDPPIIVIEIYDQDTVGKADFMGRTFAKPVVKMADEHYGPPRFPPQLEYYQIYRGNCAAGEMLAAFELLQIGPNGKADLP-PIDGPTDMDRGPILPVPLGIRPVLSKYRIEQVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSALIPNFKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSNAVSSLRKFIY 1030          
BLAST of Fer-1-related vs. Planmine SMEST
Match: SMESG000075933.1 (SMESG000075933.1)

HSP 1 Score: 3579.26 bits (9280), Expect = 0.000e+0
Identity = 1861/1920 (96.93%), Postives = 1883/1920 (98.07%), Query Frame = 3
Query:  636 RKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMVGV 6395
            R +YS K QD+Q+RIKV+EARQLQG NISPV KV+C NQ KQT+VKNSTNSP W  +FFFNFH S A+LFDE I+F ++NSR+LR+DALIGSFKFDL MIYEE +H ++NKWLLL D ED  +GAKGYLKF AAILG GDEAPSF+ +  E+ D   +NLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDETLSPSSSTTQPTNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCRRRRYVRPRKVVNEKLANQDS+SSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPV VKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIIKNTTINPNFNNPLLFLDVLLPKEELYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPKKKKGFKFFTLSAKSPKRKKDE      LDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIEMELELLTEEEAAAKPAGLGRDEPNENPKLEPPNRPDTSFLWFTSPWKTFKFIIWKNFKWYFIGGIIITLVALIVVLFVYSIPGLTARKMVGV
Sbjct:   78 RHTYSNKVQDYQVRIKVIEARQLQGANISPVTKVQCWNQTKQTRVKNSTNSPFWGDTFFFNFHASPADLFDEIITFSVYNSRRLRTDALIGSFKFDLGMIYEEDQHCFLNKWLLLYDHEDPMAGAKGYLKFSAAILGHGDEAPSFAVTTSEDDDME-SNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDETLSPSSSTTQPTNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCRRRRYVRPRKVVNEKLANQDSTSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVPVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIIKNTTINPNFNNPLLFLDVLLPKEELYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPKKKKGFKFFTLSAKSPKRKKDE------LDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIEMELELLTEEEAAAKPAGLGRDEPNENPKLEPPNRPDTSFLWFTSPWKTFKFIIWKNFKWYFIGGIIITLVALIVVLFVYSIPGLTARKMVGV 1990          
BLAST of Fer-1-related vs. Planmine SMEST
Match: SMESG000075933.1 (SMESG000075933.1)

HSP 1 Score: 3578.49 bits (9278), Expect = 0.000e+0
Identity = 1888/2105 (89.69%), Postives = 1943/2105 (92.30%), Query Frame = 3
Query:   81 MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMVGV 6395
            MS + V + +ATNL N+E   KSDPYV++EFQG+K +T      LNP W+EN +F+L G  L  +D L + VMDKE IG ++L+GS  + L+DLA G+TE+Q+   L+D + RP A ++ +K+ Y  PK      +  S +QT     ++ D      D  D  E G      + +  K GKR  R +YS K QD+Q+RIKV+EARQLQG NISPV KV+C NQ KQT+VKNSTNSP W  +FFFNFH S A+LFDE I+F ++NSR+LR+DALIGSFKFDL MIYEE +H ++NKWLLL D ED  +GAKGYLKF AAILG GDEAPSF+ +  E+ D   +NLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDETLSPSSSTTQPTNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCRRRRYVRPRKVVNEKLANQDS+SSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEK                                              GLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIIKNTTINPNFNNPLLFLDVLLPKEELYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPKKKKGFKFFTLSAKSPKRKKDE      LDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIEMELELLTEEEAAAKPAGLGRDEPNENPKLEPPNRPDTSFLWFTSPWKTFKFIIWKNFKWYFIGGIIITLVALIVVLFVYSIPGLTARKMVGV
Sbjct:    1 MSSLEVFISHATNLPNLEFFDKSDPYVIVEFQGRKFETTIKKSELNPIWEENFTFNLDGNPLLSSDTLSLIVMDKEMIGNNRLLGSTSISLKDLARGETEIQIEAPLVDASNRPNAAIITIKLSYNQPKAEKDLMRTKSIKQTFEDEDEEDDDDEGGTDANDGTETGGKKKRKKKRKGKSGKRRLRHTYSNKVQDYQVRIKVIEARQLQGANISPVTKVQCWNQTKQTRVKNSTNSPFWGDTFFFNFHASPADLFDEIITFSVYNSRRLRTDALIGSFKFDLGMIYEEDQHCFLNKWLLLYDHEDPMAGAKGYLKFSAAILGHGDEAPSFAVTTSEDDDME-SNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDETLSPSSSTTQPTNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCRRRRYVRPRKVVNEKLANQDSTSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEK----------------------------------------------GLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIIKNTTINPNFNNPLLFLDVLLPKEELYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPKKKKGFKFFTLSAKSPKRKKDE------LDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIEMELELLTEEEAAAKPAGLGRDEPNENPKLEPPNRPDTSFLWFTSPWKTFKFIIWKNFKWYFIGGIIITLVALIVVLFVYSIPGLTARKMVGV 2052          
BLAST of Fer-1-related vs. Planmine SMEST
Match: SMESG000075933.1 (SMESG000075933.1)

HSP 1 Score: 3486.43 bits (9039), Expect = 0.000e+0
Identity = 1822/1920 (94.90%), Postives = 1844/1920 (96.04%), Query Frame = 3
Query:  636 RKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMVGV 6395
            R +YS K QD+Q+RIKV+EARQLQG NISPV KV+C NQ KQT+VKNSTNSP W  +FFFNFH S A+LFDE I+F ++NSR+LR+DALIGSFKFDL MIYEE +H ++NKWLLL D ED  +GAKGYLKF AAILG GDEAPSF+ +  E+ D   +NLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDETLSPSSSTTQPTNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCRRRRYVRPRKVVNEKLANQDS+SSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEK                                              GLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIIKNTTINPNFNNPLLFLDVLLPKEELYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPKKKKGFKFFTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIEMELELLTEEEAAAKPAGLGRDEPNENPKLEPPNRPDTSFLWFTSPWKTFKFIIWKNFKWYFIGGIIITLVALIVVLFVYSIPGLTARKMVGV
Sbjct:   78 RHTYSNKVQDYQVRIKVIEARQLQGANISPVTKVQCWNQTKQTRVKNSTNSPFWGDTFFFNFHASPADLFDEIITFSVYNSRRLRTDALIGSFKFDLGMIYEEDQHCFLNKWLLLYDHEDPMAGAKGYLKFSAAILGHGDEAPSFAVTTSEDDDME-SNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDETLSPSSSTTQPTNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCRRRRYVRPRKVVNEKLANQDSTSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEK----------------------------------------------GLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIIKNTTINPNFNNPLLFLDVLLPKEELYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPKKKKGFKFFTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIEMELELLTEEEAAAKPAGLGRDEPNENPKLEPPNRPDTSFLWFTSPWKTFKFIIWKNFKWYFIGGIIITLVALIVVLFVYSIPGLTARKMVGV 1950          
BLAST of Fer-1-related vs. Planmine SMEST
Match: SMESG000075933.1 (SMESG000075933.1)

HSP 1 Score: 3469.48 bits (8995), Expect = 0.000e+0
Identity = 1816/1920 (94.58%), Postives = 1838/1920 (95.73%), Query Frame = 3
Query:  636 RKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMVGV 6395
            R +YS K QD+Q+RIKV+EARQLQG NISPV KV+C NQ KQT+VKNSTNSP W  +FFFNFH S A+LFDE I+F ++NSR+LR+DALIGSFKFDL MIYEE +H ++NKWLLL D ED  +GAKGYLKF AAILG GDEAPSF+ +  E+ D   +NLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDETLSPSSSTTQPTNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCRRRRYVRPRKVVNEKLANQDS+SSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEK                                              GLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIIKNTTINPNFNNPLLFLDVLLPKEELYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPKKKKGFKFFTLSAKSPKRKKDE      LDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIEMELELLTEEEAAAKPAGLGRDEPNENPKLEPPNRPDTSFLWFTSPWKTFKFIIWKNFKWYFIGGIIITLVALIVVLFVYSIPGLTARKMVGV
Sbjct:   78 RHTYSNKVQDYQVRIKVIEARQLQGANISPVTKVQCWNQTKQTRVKNSTNSPFWGDTFFFNFHASPADLFDEIITFSVYNSRRLRTDALIGSFKFDLGMIYEEDQHCFLNKWLLLYDHEDPMAGAKGYLKFSAAILGHGDEAPSFAVTTSEDDDME-SNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDETLSPSSSTTQPTNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLKDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCRRRRYVRPRKVVNEKLANQDSTSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEK----------------------------------------------GLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIIKNTTINPNFNNPLLFLDVLLPKEELYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPKKKKGFKFFTLSAKSPKRKKDE------LDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIEMELELLTEEEAAAKPAGLGRDEPNENPKLEPPNRPDTSFLWFTSPWKTFKFIIWKNFKWYFIGGIIITLVALIVVLFVYSIPGLTARKMVGV 1944          
BLAST of Fer-1-related vs. Planmine SMEST
Match: SMESG000070967.1 (SMESG000070967.1)

HSP 1 Score: 2569.27 bits (6658), Expect = 0.000e+0
Identity = 1376/2111 (65.18%), Postives = 1660/2111 (78.64%), Query Frame = 3
Query:   81 MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQFAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDDIIGTAIIDLSHIAA-QGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNWGKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKYRLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDEXXXXXXXXXXXXNAIFDGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKIKVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLNTLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMPDVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSL-KDSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASLVGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSLFYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVLPSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCXXXXXXXXXXXXNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRRWHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKETEDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARNLLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGDPAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQWYNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRGNIFCVADGIRPMMQRTGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIXXXXXXXXXXXXXXXXXXXXXXXXXXYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFPPLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSMISEDNQLQTPXXXXXXXXXTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDWWSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLLYRGK---NLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKG-LPSSQPIECIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEFGRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRATCGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIGQRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPLQPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVILEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPFQYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTLELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYNDETGTAELTGKIXXXXXXXXXXXXXXKPAGLGRDXXXXXXXXXXXXXXDTSFLWFTSPWKTFKFIIWKNFKWYFXXXXXXXXXXXXXXXFVYSIPGLTARKMVGV 6395
            MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYQPPKPAPGAAQGGSQQQTAGTAIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPVCKVKCKNQVKQTKVKNSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDEAPSFSSSKKEESDEIETNLLRPAGVQLRPATF LRVY+AEDLP MDS   +GIK+ FT +++ KELVDPYM+  FAGKE+KTS KY +DHP+WNEELKI LQFPSMC+R+KLQLFDWDR++ +D IGT  ID+S + + + +NGFLPTFGPCF+NF+GSPRE+S+LPD+FEALN GKG+G AYRGR+++EL+T L+ET +    + PIN++ L +  KFLRRRKYRLH AF+SA+M+   D+ +EFEVS+GNYGNKLD+T+  SSS TQPTNA+FDG+ Y+FLPWG++KPC+VV+CHWE +S RL+++NFFL+I D++  N++KIKVA+ AN+PEEEQAQFVISAFDDLI+  SK +P W+  +SP TELD  L  +R  EL  +  EA+++R EATSV QA+ DL++F  QL++LS EPQNSMPDV+IWM+TG KR  Y RIPA+DV++S+N DY GR CG +Q I +  P L +D +  +  IPAQLRLK+WLGQEK+E  WH MQ EG+L +LAETYENQASL+G+WTT++P+M+RP WSD+SG+++L KE + PP GW WDGDW+ISPE+SL++DK+A L+++LED+FV E R PGGNW P+ +Q+++ +GDPCP P +IVLP GWEW   W VD NRPCDEEGWEY V+ S+GG+ P EKMYHM RRRRYVR RK+   K   +  S    +D+EHWEYAP+F+++FHA ERK DMVRRRRWHRKMK  KPG    FNL  ++ E    ++  +                                     K  MA PR+++ + K HK+QLRAYI+QARNLLA DQ GFSDPY+RV F NQSQ TE  +K++CPTWDQTL+F ++EIHGDP  + E+PP + +E+FD+DQ+GEDEFLGRC+  PMVK   +D R+ VLQW+ + KG+R+AGE+LAAFE+YL  DK LPF PPK GNI+ + DGIRPMMQRT +E+L+WGVRNM K+QL +V SPS EFEIGG+V++T++IKN   NPNF+ P LF DVLLPKEELYMPP NIK+RD+R FGRKP+VG + L + D YR   L +E   L DFPA +            N++ E+                    N  + PK+    K  +L      +KK            +++EDIDWWSKYYASLG++ KC+KY ++ +DTL  YK ELE  E Y+ F DFC+ FLL RG      DDEE  SVGEFKGTFRIYPLPE+ NE +P  YL+   LP++  +ECI+R+YIIKA DLQP+DPSGLADPY+++QLGK+  ++KD Y+PN L PEFGR+FE+K  LP+ KDL +++ DYD +  DD+IGET+IDLENR+L++FRATCGLPQTY  SG N+WRDC  P+ IL++FC KN I  P Y  N  + + I  + F LS FE     N + GP  ERLALHVLN LPL KEH+E RPLFS LQPGIEQGK++ W+DI P ++   G PF I  RK K YQLR++V NT DV L++ NLLGE+MSDIYVK W+ GI+E+QETDVHYRSLDGEGNFNWRFVFPF Y+P+EN M+V KKEHFWSLD+TE+R  CS   Q+WDNDKFS DDFLGT+E++LA +P+PAKK   C L  L  F  N  ++ +NLF+C+R  GYWP +++ TG  ELTGK+E+E++LLTEEEA  KPAG  RD+PNENP L+PPNRP TSF WFTSPWKTFKFIIWKN K+Y +  +II L+AL+VVLF+Y+IPGLTARKM  +
Sbjct:    1 MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYQPPKPAPGAAQGGSQQQTAGTAIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPVCKVKCKNQVKQTKVKNSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDEAPSFSSSKKEESDEIETNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFT-NSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLSKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEDKDDKDLLIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRKLAATKPKKEKQSKLLTEDNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAEEEEGDVSSKSAK-------------------------------------KTAMAAPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDP-----------NVDLEI--------------------NTFKKPKEPAAHKLPSLPDIFKGKKKPTK--------VIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSNDECEDDEENDSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLEN--DCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKN--IEFVNLFDCKRIMGYWPVFDNSTGVPELTGKLELEIDLLTEEEATLKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKYYLLTVLIIVLLALLVVLFIYAIPGLTARKMFAI 2030          
The following BLAST results are available for this feature:
BLAST of Fer-1-related vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYSF0.000e+044.16dysferlin [Source:HGNC Symbol;Acc:HGNC:3097][more]
DYSF0.000e+043.97dysferlin [Source:HGNC Symbol;Acc:HGNC:3097][more]
DYSF0.000e+043.74dysferlin [Source:HGNC Symbol;Acc:HGNC:3097][more]
DYSF0.000e+044.04dysferlin [Source:HGNC Symbol;Acc:HGNC:3097][more]
DYSF0.000e+043.91dysferlin [Source:HGNC Symbol;Acc:HGNC:3097][more]
back to top
BLAST of Fer-1-related vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fer-17.208e-3833.00Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
fer-19.100e-3833.00Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
fer-19.100e-3833.00Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
ferl-19.252e-2422.83FER-1 Like [Source:UniProtKB/TrEMBL;Acc:O01596][more]
snt-53.800e-1037.29SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:O16700... [more]
back to top
BLAST of Fer-1-related vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfr2.004e-8333.71gene:FBgn0266757 transcript:FBtr0273291[more]
mfr4.555e-7933.55gene:FBgn0266757 transcript:FBtr0273287[more]
mfr9.741e-7933.55gene:FBgn0266757 transcript:FBtr0273290[more]
mfr1.537e-7833.72gene:FBgn0266757 transcript:FBtr0273289[more]
mfr1.553e-7733.04gene:FBgn0266757 transcript:FBtr0273285[more]
back to top
BLAST of Fer-1-related vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myof0.000e+043.50myoferlin [Source:ZFIN;Acc:ZDB-GENE-040426-1138][more]
dysf0.000e+043.71dysferlin, limb girdle muscular dystrophy 2B (auto... [more]
dysf0.000e+043.15dysferlin, limb girdle muscular dystrophy 2B (auto... [more]
myofl0.000e+041.84myoferlin like [Source:ZFIN;Acc:ZDB-GENE-111116-2][more]
otofb5.879e-10637.98otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5][more]
back to top
BLAST of Fer-1-related vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctnnal10.000e+045.47catenin alpha-like 1 [Source:Xenbase;Acc:XB-GENE-5... [more]
ctnnal10.000e+044.11catenin alpha-like 1 [Source:Xenbase;Acc:XB-GENE-5... [more]
DYSF0.000e+043.08dysferlin [Source:NCBI gene;Acc:100488564][more]
DYSF0.000e+042.70dysferlin [Source:NCBI gene;Acc:100488564][more]
DYSF0.000e+042.72dysferlin [Source:NCBI gene;Acc:100488564][more]
back to top
BLAST of Fer-1-related vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dysf0.000e+043.92dysferlin [Source:MGI Symbol;Acc:MGI:1349385][more]
Dysf0.000e+043.64dysferlin [Source:MGI Symbol;Acc:MGI:1349385][more]
Dysf0.000e+043.75dysferlin [Source:MGI Symbol;Acc:MGI:1349385][more]
Dysf0.000e+043.76dysferlin [Source:MGI Symbol;Acc:MGI:1349385][more]
Dysf0.000e+043.47dysferlin [Source:MGI Symbol;Acc:MGI:1349385][more]
back to top
BLAST of Fer-1-related vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75923|DYSF_HUMAN0.000e+043.91Dysferlin OS=Homo sapiens OX=9606 GN=DYSF PE=1 SV=... [more]
sp|A6QQP7|DYSF_BOVIN0.000e+044.10Dysferlin OS=Bos taurus OX=9913 GN=DYSF PE=2 SV=1[more]
sp|Q9ESD7|DYSF_MOUSE0.000e+043.43Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV... [more]
sp|Q69ZN7|MYOF_MOUSE0.000e+043.91Myoferlin OS=Mus musculus OX=10090 GN=Myof PE=1 SV... [more]
sp|Q9NZM1|MYOF_HUMAN0.000e+043.12Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=... [more]
back to top
BLAST of Fer-1-related vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FV950.000e+058.69Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GWS60.000e+057.75Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HHA50.000e+057.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GE740.000e+056.22Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I3Z60.000e+058.86Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Fer-1-related vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myofl0.000e+043.25myoferlin like [Source:ZFIN;Acc:ZDB-GENE-111116-2][more]
dysf9.758e-744.76dysferlin, limb girdle muscular dystrophy 2B (auto... [more]
myof6.902e-1340.73myoferlin [Source:ZFIN;Acc:ZDB-GENE-040426-1138][more]
fer1l65.175e-8038.60fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GE... [more]
otofb2.243e-13041.85otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5][more]
back to top
BLAST of Fer-1-related vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001770.10.000e+043.28pep scaffold:Pmarinus_7.0:GL479034:2422:33544:1 ge... [more]
ENSPMAT00000001654.10.000e+039.27pep scaffold:Pmarinus_7.0:GL479999:3392:42224:1 ge... [more]
ENSPMAT00000008905.15.774e-13844.95pep scaffold:Pmarinus_7.0:GL477019:1719:83156:1 ge... [more]
ENSPMAT00000002265.13.986e-11653.98pep scaffold:Pmarinus_7.0:GL483084:292:10410:1 gen... [more]
ENSPMAT00000004363.16.424e-9330.38pep scaffold:Pmarinus_7.0:GL477737:887:58689:-1 ge... [more]
back to top
BLAST of Fer-1-related vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TCB27.386e-636.84ER protein involved in ER-plasma membrane tetherin... [more]
TCB19.209e-630.00Lipid-binding ER protein involved in ER-plasma mem... [more]
back to top
BLAST of Fer-1-related vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO430880.000e+042.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368630.000e+050.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368660.000e+047.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474152.446e-9839.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341417.068e-13444.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fer-1-related vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myof0.000e+041.50myoferlin [Source:NCBI gene;Acc:101172285][more]
dysf1.287e-3541.02dysferlin, limb girdle muscular dystrophy 2B (auto... [more]
myofl1.418e-12636.90myoferlin [Source:NCBI gene;Acc:101156429][more]
otofa3.123e-10538.54otoferlin [Source:NCBI gene;Acc:101155482][more]
otofb1.206e-10740.39otoferlin-like [Source:NCBI gene;Acc:101160130][more]
back to top
BLAST of Fer-1-related vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075933.10.000e+096.93SMESG000075933.1[more]
SMESG000075933.10.000e+089.69SMESG000075933.1[more]
SMESG000075933.10.000e+094.90SMESG000075933.1[more]
SMESG000075933.10.000e+094.58SMESG000075933.1[more]
SMESG000070967.10.000e+065.18SMESG000070967.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030659 ID=SMED30030659|Name=Fer-1-related|organism=Schmidtea mediterranea sexual|type=transcript|length=6660bp
GAAAAATTACTGTTTAATTCAATTCAGTTTTTTTGTATTTCATTTTTTGT
AAACTATAGAAAAAAAGATCCACGAACGAAATGAGTGGCATGAATGTTAC
TGTTATCAATGCGACAAATCTCATCAACATGGAACTCGTCGGGAAAAGTG
ATCCATACGTTCTAATCGAGTTTCAAGGTCAAAAGAAAAAAACTAAAGAA
ATAGGAGAAAACCTGAATCCTCAATGGGACGAAAATTTATCATTTGATCT
GGCTGGAGCAGCTTTGACCGTAACAGATGTATTAGGAGTCAAAGTTATGG
ACAAAGAAAAAATCGGACCTGACAAATTAATGGGATCTATTGATGTTCCT
CTTCGAGACCTAGCCGGTGGAAAAACTGAAGTTCAGTTAACTCTCAATTT
ATTGGATAAAAACAAAAGACCTACCGCAGGTGTTTTAAATTTAAAAGTTC
AATATCAACCTCCTAAACCAGCCCCGGGAGCAGCACAAGGTGGGTCTCAA
CAACAGACTGCTGGAACAGCTATTGATCAAACGGATAGTGCAGGAGCAGA
AGAAGACGAGACAGATAATGCTGAAATCGGTAATTCTGGATCAGGTCCGC
AAATTAAAATCAAAAAAGTAGGAAAGAGAACTACGAGAAAATCATATTCA
ACAAAACCGCAAGATTTCCAAATACGAATTAAAGTCGTTGAAGCTCGACA
ACTGCAAGGTGGAAACATTTCGCCGGTTTGCAAAGTCAAATGTAAAAATC
AAGTAAAACAAACCAAAGTGAAAAATTCGACTAACTCACCAGAATGGAAT
GCGAGTTTCTTTTTCAATTTCCATATTTCAGCGGCCGAATTGTTTGACGA
AACAATATCGTTTGAAATTTTCAACTCGAGAAAATTACGATCTGATGCAT
TAATCGGCTCGTTTAAATTTGATTTGAGCATGATATATGAAGAACCGAAA
CATAATTACATGAATAAATGGCTGTTGTTATCGGACCCAGAAGACGGGAA
TTCTGGAGCAAAAGGTTATCTGAAATTTTGTGCTGCTATTCTCGGACCAG
GAGATGAAGCACCGAGTTTTTCAAGTTCAAAAAAAGAAGAAAGCGATGAA
ATCGAAACTAATTTACTTCGTCCAGCTGGAGTTCAGTTGCGACCGGCGAC
TTTCACTTTAAGAGTGTACAGAGCTGAAGACTTGCCAAGAATGGATTCAG
ACATTCTTGAAGGAATAAAAAAAGTATTTACTAGTGATGCAGCTAAAAAA
GAACTTGTAGATCCGTACATGATCTTTCAATTTGCTGGAAAAGAGATTAA
AACGTCAGTTAAATATAACAGTGACCATCCAGAATGGAATGAAGAATTGA
AAATCGGACTTCAATTTCCATCAATGTGTGAAAGGATAAAATTACAATTA
TTTGATTGGGACCGAATGACTGAAGATGATATCATAGGAACAGCCATAAT
TGATCTATCCCACATAGCAGCGCAAGGAGACAATGGATTTCTTCCGACGT
TTGGTCCATGCTTTATTAATTTTTTCGGAAGTCCAAGGGAATTCTCAAAC
TTACCAGATAGATTTGAGGCTTTAAATTGGGGTAAAGGTGAAGGTGTTGC
TTATCGTGGACGTTTAATGGTTGAATTATCAACGGCTCTCGATGAAACTC
CAGAACAAGGTCAGGAAATTTTACCAATAAATCAAGATAGTCTTTTAAAA
TCACAAAAATTCCTCAGACGGCGTAAATATCGTCTCCATGCTGCATTTCT
AAGTGCTTCTATGATAACTGCGGTGGATAGTCCTGTGGAATTTGAAGTTA
GCATCGGAAATTATGGAAACAAACTTGATGAAACGTTATCTCCAAGCAGT
TCTACTACTCAACCAACTAATGCAATATTCGATGGAACATTTTATCATTT
TCTCCCATGGGGTAATAGCAAACCATGTACAGTTGTTGACTGTCATTGGG
AAGAAGTGTCATCAAGATTGTATACAGTCAATTTTTTCTTGAAAATCATT
GACAAAATGGTATCAAATATGGATAAAATAAAAGTGGCAATAAAAGCAAA
TTTACCAGAAGAAGAGCAAGCACAATTTGTCATTTCTGCTTTTGATGATC
TAATTATGCACTGCAGCAAGGAACTGCCGGGATGGGAGGCAGGTGAAAGC
CCATTAACAGAATTAGATTTAAATTTAAATACTTTGCGCACTAATGAATT
AGGAAATATTCGGAAGGAAGCATTACGAGTTAGAGAAGAAGCAACAAGCG
TTGAGCAGGCTTTAAATGATCTTGAGTCTTTTTGTAATCAATTACGAAAT
TTATCTGGAGAACCCCAAAATAGTATGCCAGATGTTGTGATTTGGATGAT
TACAGGGCAAAAACGAACAGTTTATTATAGAATACCCGCATATGACGTTT
TGTACAGTAATAATTCTGATTATATTGGTAGATTTTGTGGAAATGTTCAA
ACAATAAATTTAAAAACTCCCTCACTTAAAGACAGTGAAATAACTAATTT
TTCAATACCTGCACAATTAAGATTAAAACTTTGGCTAGGTCAAGAAAAAG
ACGAAATGGAATGGCATAAAATGCAAACTGAAGGCGAATTGTCTATTTTA
GCTGAAACTTATGAAAATCAAGCAAGTCTTGTTGGTAGATGGACTACTAG
AGCACCAATGATGACACGCCCGTGTTGGTCTGATTCTTCAGGACGGGTAG
AGTTAGTTAAAGAAGCTATGAAACCCCCTCAAGGATGGATTTGGGATGGA
GACTGGTATATAAGTCCAGAGTTGTCATTATTCTACGATAAAGATGCTGG
CTTGAGTCAATATCTTGAAGATGTTTTTGTAAATGAAAATCGAATACCCG
GAGGGAATTGGGCTCCATCTGTAGTCCAATTTACTGACATCAAAGGTGAT
CCATGTCCTGCTCCTAAAGATATAGTACTACCGTCTGGCTGGGAATGGGA
AGATGAATGGCAAGTGGATTTAAATAGACCATGTGACGAAGAAGGATGGG
AATATACTGTCGAAGCTTCTATGGGAGGTTTTGTTCCCGTTGAAAAAATG
TATCATATGTGCCGTCGAAGACGATATGTTAGACCACGAAAAGTCGTAAA
TGAAAAATTAGCTAATCAAGATTCAAGTTCATCTAAAGCTGATGATGATG
AACATTGGGAGTATGCGCCATTATTTGAAATGAGATTTCACGCGAAAGAA
AGAAAAACTGATATGGTTCGTCGAAGACGTTGGCATAGAAAAATGAAACC
CATGAAGCCGGGAACGCCAGCCATTTTTAATTTATCAGAAAAAGACACAG
AGAAAGTCAGTGTTGCACAACCGGTGCAAACTGTAGTAGAGATTGAACCT
GAAAGTAAAATGAATGTTGATAAAGAAACTGAAGACGAAATTGAACCGGA
ACCGGTACAAGTTAAAGTAAAAAAAACTAATGAAAATTTGAAAGGATTAA
TGGCAGTTCCGAGATTGTTTTTGGTGTTTAAAAAAGCACATAAATGGCAA
TTGAGAGCTTATATTTACCAAGCTCGAAATTTATTAGCTGGAGATCAAAC
AGGATTTTCTGATCCATATGCTCGTGTAGCATTTTTGAATCAATCTCAAT
GCACAGAAAGAATTGATAAAACTCTGTGTCCAACGTGGGATCAAACTTTA
ATTTTCCATAAAATAGAAATTCACGGAGATCCCGCTGCAATAGTCGAAAC
GCCTCCATATGTGATAATAGAAGTATTTGATTATGATCAAATTGGAGAAG
ATGAATTTCTTGGACGCTGTCAGATTACCCCGATGGTTAAAACTCATCCT
GATGATCCTAGAAAGCCGGTACTACAATGGTATAATCTTACAAAAGGAAA
TAGGGATGCCGGAGAATTGCTTGCTGCATTTGAATTATATTTGCAAACAG
ACAAACCTCTTCCTTTTACTCCTCCTAAACGAGGAAACATATTCTGTGTC
GCTGATGGAATTAGGCCAATGATGCAAAGGACTGGAATCGAAATATTATC
ATGGGGAGTCAGAAATATGAGCAAATATCAGTTGGCAAATGTTACGTCTC
CAAGCATTGAATTCGAGATCGGTGGTCACGTTATTCAGACAGATATCATA
AAAAATACAACTATTAATCCAAATTTTAACAATCCTCTTTTATTTTTGGA
TGTTCTACTGCCCAAGGAAGAACTTTATATGCCACCTTTCAATATAAAAG
TCAGAGATAATCGACACTTTGGAAGAAAGCCTTTGGTGGGAATGCATGTT
TTAAATTCAGTGGATACATACAGATTTCCCCCTTTAATTGATGAGGCTAG
TTTACTCACTGATTTCCCAGCTTTAAATGAATCCAGTGGAGGAGTAGAAG
GAGCACAATTTGATAACATAGAAGAAGAACTGATGAGTATTCATTCAGAT
GAACAATCCCGCCGGAATACCGATTCCATGATATCGGAAGATAATCAACT
TCAAACACCAAAAAAGAAAAAAGGATTCAAATTTTTCACGTTGTCTGCAA
AATCACCGAAGCGCAAAAAAGATGAAGACGAGGTATTGAATGTGCTGGAT
CTTACGTTGATGGACGAGGACATAGATTGGTGGTCAAAATATTATGCTTC
CCTTGGAGAATGGGGAAAATGTAATAAATACCAAGATATGAACTATGATA
CCTTACAGGTATATAAAACTGAACTAGAAAGAGTTGAAACGTATAATGAA
TTTACTGATTTCTGTACAAAGTTTTTGCTATATCGTGGTAAAAATTTAGA
TGACGAGGAGGAGGCAAGTGTAGGAGAGTTTAAAGGAACGTTTAGAATTT
ATCCTTTACCGGAAAATATTAATGAAAAATTGCCAGCTAAATATCTGGAA
AAAGGCCTCCCATCTTCTCAACCTATTGAATGCATTGTACGTGTATATAT
TATCAAGGCAATAGATTTACAACCGAATGATCCAAGTGGTTTGGCCGATC
CATATGTAGAAGTGCAGCTGGGAAAGAAAATGTTAACAAATAAAGATTCC
TATATTCCAAATTGTCTTTGCCCGGAATTCGGAAGAATGTTTGAATTGAA
ATGCATTTTACCGATTCAAAAAGATTTGGAAATCAGAGTCAAAGATTACG
ATTTTATGAGTTCTGATGATGTTATTGGAGAAACATTTATTGACTTGGAA
AATCGGTTTTTGACAAAATTCAGAGCCACATGTGGTCTACCTCAAACTTA
TTGCATTAGTGGTCCAAATAAATGGAGAGATTGTTTTAAGCCAACTGAAA
TTTTAAAGCAATTCTGTGAAAAAAACTTTATTCCTCCTCCAACTTACAAA
ACCAATCATGATGAAGTAGTGTATATCGGTCAGCGTCAGTTTAAGCTTTC
TCATTTTGAGCGAAATACGAAACCAAATGCTCACTTTGGACCGTCTAATG
AAAGACTAGCGTTGCATGTCTTGAACATGTTGCCACTAACAAAAGAACAT
GTTGAAACACGACCTCTATTCAGTCCTTTACAACCTGGAATTGAACAGGG
TAAATTGCAATGTTGGATCGACATTTTTCCAGCATCCGTTGAAACAATTG
GGGAACCTTTTGAAATCACGCCAAGAAAACCTAAAAGTTATCAGCTGAGA
ATAATTGTTTGGAACACAAAAGATGTTATTCTTGAAGATGAAAACTTACT
TGGAGAAAAAATGTCCGATATTTATGTCAAGGGTTGGCTTGCGGGAATTG
ACGAAAGACAGGAAACAGACGTTCATTATCGCTCGCTGGACGGGGAAGGC
AACTTTAATTGGAGATTTGTGTTTCCATTTCAATATTTACCGGCCGAAAA
TATGATGATTGTTAAAAAGAAAGAACATTTTTGGTCGCTTGATGAAACTG
AACAACGGTTACCGTGTAGTTGTGTCCTTCAAATTTGGGACAATGATAAA
TTTTCGGCTGATGATTTTCTTGGAACTCTTGAATTAAATCTTGCCAAAAT
GCCAGCTCCGGCAAAAAAATCCAAACAATGTGATCTAAATCAACTTCAAG
CTTTTAATCCAAATAGTCAAGTTAAAAATATAAATTTATTTGAATGTCGT
CGGGCTTATGGATACTGGCCATGTTACAACGATGAAACAGGAACTGCAGA
ACTAACAGGGAAAATAGAAATGGAGCTTGAATTGCTAACAGAAGAAGAAG
CTGCAGCAAAACCAGCAGGTCTTGGCAGAGATGAACCAAATGAAAACCCA
AAACTAGAACCTCCAAATCGACCAGATACATCATTTCTGTGGTTCACATC
ACCGTGGAAAACATTTAAGTTCATCATATGGAAAAACTTCAAATGGTATT
TTATTGGGGGCATAATAATAACTCTCGTCGCTCTGATTGTCGTTCTTTTT
GTCTATTCTATACCTGGTTTAACAGCACGAAAAATGGTTGGCGTATAAAT
TTCAGGAATCGACAAGTTCATAAAATGATTAACTACTGATTTACTTATTT
TTTTTAGATGAGATTTATATTTAATGGTTATTTAACACTATTTTTGCTTC
TGTATCTCAATAATAATTATGTAACATATTCGACTATTTACTGTAATGTA
TCAGCAAAAAGAGTTTTATATTCTTTTTCGACTGCAATCGGTGTTTGTGG
AATTTGTAGTTTTGGTTGAAGAATGTGTTATATTAAATACTTTTCAATAA
TAAATTGCTC
back to top

protein sequence of SMED30030659-orf-1

>SMED30030659-orf-1 ID=SMED30030659-orf-1|Name=SMED30030659-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2106bp
MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWD
ENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTE
VQLTLNLLDKNKRPTAGVLNLKVQYQPPKPAPGAAQGGSQQQTAGTAIDQ
TDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRI
KVVEARQLQGGNISPVCKVKCKNQVKQTKVKNSTNSPEWNASFFFNFHIS
AAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLL
SDPEDGNSGAKGYLKFCAAILGPGDEAPSFSSSKKEESDEIETNLLRPAG
VQLRPATFTLRVYRAEDLPRMDSDILEGIKKVFTSDAAKKELVDPYMIFQ
FAGKEIKTSVKYNSDHPEWNEELKIGLQFPSMCERIKLQLFDWDRMTEDD
IIGTAIIDLSHIAAQGDNGFLPTFGPCFINFFGSPREFSNLPDRFEALNW
GKGEGVAYRGRLMVELSTALDETPEQGQEILPINQDSLLKSQKFLRRRKY
RLHAAFLSASMITAVDSPVEFEVSIGNYGNKLDETLSPSSSTTQPTNAIF
DGTFYHFLPWGNSKPCTVVDCHWEEVSSRLYTVNFFLKIIDKMVSNMDKI
KVAIKANLPEEEQAQFVISAFDDLIMHCSKELPGWEAGESPLTELDLNLN
TLRTNELGNIRKEALRVREEATSVEQALNDLESFCNQLRNLSGEPQNSMP
DVVIWMITGQKRTVYYRIPAYDVLYSNNSDYIGRFCGNVQTINLKTPSLK
DSEITNFSIPAQLRLKLWLGQEKDEMEWHKMQTEGELSILAETYENQASL
VGRWTTRAPMMTRPCWSDSSGRVELVKEAMKPPQGWIWDGDWYISPELSL
FYDKDAGLSQYLEDVFVNENRIPGGNWAPSVVQFTDIKGDPCPAPKDIVL
PSGWEWEDEWQVDLNRPCDEEGWEYTVEASMGGFVPVEKMYHMCRRRRYV
RPRKVVNEKLANQDSSSSKADDDEHWEYAPLFEMRFHAKERKTDMVRRRR
WHRKMKPMKPGTPAIFNLSEKDTEKVSVAQPVQTVVEIEPESKMNVDKET
EDEIEPEPVQVKVKKTNENLKGLMAVPRLFLVFKKAHKWQLRAYIYQARN
LLAGDQTGFSDPYARVAFLNQSQCTERIDKTLCPTWDQTLIFHKIEIHGD
PAAIVETPPYVIIEVFDYDQIGEDEFLGRCQITPMVKTHPDDPRKPVLQW
YNLTKGNRDAGELLAAFELYLQTDKPLPFTPPKRGNIFCVADGIRPMMQR
TGIEILSWGVRNMSKYQLANVTSPSIEFEIGGHVIQTDIIKNTTINPNFN
NPLLFLDVLLPKEELYMPPFNIKVRDNRHFGRKPLVGMHVLNSVDTYRFP
PLIDEASLLTDFPALNESSGGVEGAQFDNIEEELMSIHSDEQSRRNTDSM
ISEDNQLQTPKKKKGFKFFTLSAKSPKRKKDEDEVLNVLDLTLMDEDIDW
WSKYYASLGEWGKCNKYQDMNYDTLQVYKTELERVETYNEFTDFCTKFLL
YRGKNLDDEEEASVGEFKGTFRIYPLPENINEKLPAKYLEKGLPSSQPIE
CIVRVYIIKAIDLQPNDPSGLADPYVEVQLGKKMLTNKDSYIPNCLCPEF
GRMFELKCILPIQKDLEIRVKDYDFMSSDDVIGETFIDLENRFLTKFRAT
CGLPQTYCISGPNKWRDCFKPTEILKQFCEKNFIPPPTYKTNHDEVVYIG
QRQFKLSHFERNTKPNAHFGPSNERLALHVLNMLPLTKEHVETRPLFSPL
QPGIEQGKLQCWIDIFPASVETIGEPFEITPRKPKSYQLRIIVWNTKDVI
LEDENLLGEKMSDIYVKGWLAGIDERQETDVHYRSLDGEGNFNWRFVFPF
QYLPAENMMIVKKKEHFWSLDETEQRLPCSCVLQIWDNDKFSADDFLGTL
ELNLAKMPAPAKKSKQCDLNQLQAFNPNSQVKNINLFECRRAYGYWPCYN
DETGTAELTGKIEMELELLTEEEAAAKPAGLGRDEPNENPKLEPPNRPDT
SFLWFTSPWKTFKFIIWKNFKWYFIGGIIITLVALIVVLFVYSIPGLTAR
KMVGV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007520myoblast fusion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003117parapharyngeal cell
PLANA:0003503ventral epidermis progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR012561Ferlin_B-domain
IPR000008C2_dom
IPR012968FerIin_dom
IPR012560Ferlin_A-domain
IPR006614Peroxin/Ferlin
IPR032362Ferlin_C
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding