SMED30030653

Overview
NameSMED30030653
Smed IDSMED30030653
Length (bp)673
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30030653 (SMED30030653) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30030653 (SMED30030653) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30030653 (SMED30030653) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30030653 (SMED30030653) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030653

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30030653SMESG000043368.1 dd_Smed_v4_5293_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30030653SMESG000043368.1 dd_Smed_v4_5293_0_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30030653 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.006930:9339..10150 -2078
v31.002671:21696..23230 +1763
v31.005207:12266..16634 +1731
Homology
BLAST of SMED30030653 vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 77.411 bits (189), Expect = 9.229e-16
Identity = 42/104 (40.38%), Postives = 60/104 (57.69%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA R G   +VRLLLD    IE + K  L P+H  + NGH  I ++LLD    I+ + K G+  IH A++  HL+ ++LLLQ    ID    D ++P
Sbjct:  238 NGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTP 341          

HSP 2 Score: 69.707 bits (169), Expect = 3.717e-13
Identity = 38/104 (36.54%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     V+ LLL    +I+   + GL P+H  S  GH  I+K LL R  +    +      +H A+R GH E  K LLQ K +++ K KD  +P
Sbjct:  370 NGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTP 473          

HSP 3 Score: 62.3882 bits (150), Expect = 1.219e-10
Identity = 32/100 (32.00%), Postives = 51/100 (51.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A R G   V + LL     +  + K    P+H  +  GH+ ++KLLL+ N         G   +H A+REGH+ET+  LL+++    C  K   +P
Sbjct:  440 PLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTP 539          

HSP 4 Score: 62.3882 bits (150), Expect = 1.231e-10
Identity = 35/109 (32.11%), Postives = 58/109 (53.21%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D +   G  P+HIA      +V +LLL+   ++    + G+ P+H  S  G+  +++LLLDR   IE + K  +  +H A+R GH+   ++LL     I  K K+ +SP
Sbjct:  200 DVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSP 308          

HSP 5 Score: 62.003 bits (149), Expect = 1.677e-10
Identity = 31/103 (30.10%), Postives = 54/103 (52.43%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+A + G   +V LLL    N    +K GL P+H ++  GH  +  +L+     ++   ++G   +H AS  G+++ +K LLQ +  ++ K K   SP
Sbjct:  635 GVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSP 737          

HSP 6 Score: 58.151 bits (139), Expect = 3.069e-9
Identity = 31/104 (29.81%), Postives = 53/104 (50.96%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D   P+H A R G  ++V+LLL+ + N       G  P+H  +  GH E +  LL++  +  C  K G   +H A++ G +   +LLL+R    +   K+ ++P
Sbjct:  469 DDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTP 572          

HSP 7 Score: 56.9954 bits (136), Expect = 7.371e-9
Identity = 28/104 (26.92%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     V R LL    +   E   G+ P+H  +  GH+E++ LLL +       +K G+  +H  ++EGH+    +L++    +D   +   +P
Sbjct:  601 NGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTP 704          

HSP 8 Score: 55.4546 bits (132), Expect = 2.169e-8
Identity = 31/99 (31.31%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA RN       +LL    N +   K G  P+H  +   +  + +LLL+R  ++    + G+  +H ASR G++  ++LLL R  +I+ K KD ++P
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTP 275          

HSP 9 Score: 55.4546 bits (132), Expect = 2.493e-8
Identity = 30/89 (33.71%), Postives = 45/89 (50.56%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            G+ P+HIA R G    V  LL+   +  C  K G  P+H  +  G   + +LLL+R+       K G+  +H A    +L+ +KLLL R
Sbjct:  503 GHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR 591          

HSP 10 Score: 54.6842 bits (130), Expect = 3.823e-8
Identity = 32/104 (30.77%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D I  D   P+H+A   G   V ++LLD           G  P+H      H  +++LLL    +I+   + G+  +H AS  GHL  +K LLQR    +  N
Sbjct:  331 IDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSN 434          

HSP 11 Score: 51.9878 bits (123), Expect = 3.633e-7
Identity = 29/100 (29.00%), Postives = 50/100 (50.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H A RNG   +  +LLD    I+ + K GL PIH  +   H + ++LLL  +  I+      +  +H A+  GH    K+LL +  + + +  +  +P
Sbjct:  275 PLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTP 374          

HSP 12 Score: 51.6026 bits (122), Expect = 5.209e-7
Identity = 26/103 (25.24%), Postives = 51/103 (49.51%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+  + G   V  +L+     ++   + G  P+H  S  G+ +++K LL     +  + KLG   +H A+++GH + + LLL+     +  + D  +P
Sbjct:  668 GLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTP 770          

HSP 13 Score: 51.6026 bits (122), Expect = 5.257e-7
Identity = 30/104 (28.85%), Postives = 49/104 (47.12%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  PIH+A +      VRLLL     I+      L P+H  +  GH  + K+LLD+          G   +H A ++ H+  ++LLL+    ID   +  ++P
Sbjct:  304 NGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTP 407          

HSP 14 Score: 49.2914 bits (116), Expect = 2.568e-6
Identity = 28/104 (26.92%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+H+A  +    +V+LLL    +       G  P+H  +     E+ + LL    +   E   G+  +H A++EGH E + LLL ++   +  NK  ++P
Sbjct:  568 NGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTP 671          
BLAST of SMED30030653 vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 77.411 bits (189), Expect = 9.229e-16
Identity = 42/104 (40.38%), Postives = 60/104 (57.69%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA R G   +VRLLLD    IE + K  L P+H  + NGH  I ++LLD    I+ + K G+  IH A++  HL+ ++LLLQ    ID    D ++P
Sbjct:  238 NGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTP 341          

HSP 2 Score: 69.707 bits (169), Expect = 3.717e-13
Identity = 38/104 (36.54%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     V+ LLL    +I+   + GL P+H  S  GH  I+K LL R  +    +      +H A+R GH E  K LLQ K +++ K KD  +P
Sbjct:  370 NGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTP 473          

HSP 3 Score: 62.3882 bits (150), Expect = 1.220e-10
Identity = 32/100 (32.00%), Postives = 51/100 (51.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A R G   V + LL     +  + K    P+H  +  GH+ ++KLLL+ N         G   +H A+REGH+ET+  LL+++    C  K   +P
Sbjct:  440 PLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTP 539          

HSP 4 Score: 62.3882 bits (150), Expect = 1.231e-10
Identity = 35/109 (32.11%), Postives = 58/109 (53.21%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D +   G  P+HIA      +V +LLL+   ++    + G+ P+H  S  G+  +++LLLDR   IE + K  +  +H A+R GH+   ++LL     I  K K+ +SP
Sbjct:  200 DVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSP 308          

HSP 5 Score: 62.003 bits (149), Expect = 1.677e-10
Identity = 31/103 (30.10%), Postives = 54/103 (52.43%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+A + G   +V LLL    N    +K GL P+H ++  GH  +  +L+     ++   ++G   +H AS  G+++ +K LLQ +  ++ K K   SP
Sbjct:  635 GVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSP 737          

HSP 6 Score: 58.151 bits (139), Expect = 3.069e-9
Identity = 31/104 (29.81%), Postives = 53/104 (50.96%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D   P+H A R G  ++V+LLL+ + N       G  P+H  +  GH E +  LL++  +  C  K G   +H A++ G +   +LLL+R    +   K+ ++P
Sbjct:  469 DDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTP 572          

HSP 7 Score: 56.9954 bits (136), Expect = 7.371e-9
Identity = 28/104 (26.92%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     V R LL    +   E   G+ P+H  +  GH+E++ LLL +       +K G+  +H  ++EGH+    +L++    +D   +   +P
Sbjct:  601 NGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTP 704          

HSP 8 Score: 55.4546 bits (132), Expect = 2.169e-8
Identity = 31/99 (31.31%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA RN       +LL    N +   K G  P+H  +   +  + +LLL+R  ++    + G+  +H ASR G++  ++LLL R  +I+ K KD ++P
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTP 275          

HSP 9 Score: 55.4546 bits (132), Expect = 2.493e-8
Identity = 30/89 (33.71%), Postives = 45/89 (50.56%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            G+ P+HIA R G    V  LL+   +  C  K G  P+H  +  G   + +LLL+R+       K G+  +H A    +L+ +KLLL R
Sbjct:  503 GHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR 591          

HSP 10 Score: 54.6842 bits (130), Expect = 3.823e-8
Identity = 32/104 (30.77%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D I  D   P+H+A   G   V ++LLD           G  P+H      H  +++LLL    +I+   + G+  +H AS  GHL  +K LLQR    +  N
Sbjct:  331 IDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSN 434          

HSP 11 Score: 51.9878 bits (123), Expect = 3.633e-7
Identity = 29/100 (29.00%), Postives = 50/100 (50.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H A RNG   +  +LLD    I+ + K GL PIH  +   H + ++LLL  +  I+      +  +H A+  GH    K+LL +  + + +  +  +P
Sbjct:  275 PLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTP 374          

HSP 12 Score: 51.6026 bits (122), Expect = 5.209e-7
Identity = 26/103 (25.24%), Postives = 51/103 (49.51%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+  + G   V  +L+     ++   + G  P+H  S  G+ +++K LL     +  + KLG   +H A+++GH + + LLL+     +  + D  +P
Sbjct:  668 GLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTP 770          

HSP 13 Score: 51.6026 bits (122), Expect = 5.257e-7
Identity = 30/104 (28.85%), Postives = 49/104 (47.12%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  PIH+A +      VRLLL     I+      L P+H  +  GH  + K+LLD+          G   +H A ++ H+  ++LLL+    ID   +  ++P
Sbjct:  304 NGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTP 407          

HSP 14 Score: 49.2914 bits (116), Expect = 2.568e-6
Identity = 28/104 (26.92%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+H+A  +    +V+LLL    +       G  P+H  +     E+ + LL    +   E   G+  +H A++EGH E + LLL ++   +  NK  ++P
Sbjct:  568 NGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTP 671          
BLAST of SMED30030653 vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 77.411 bits (189), Expect = 9.236e-16
Identity = 42/104 (40.38%), Postives = 60/104 (57.69%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA R G   +VRLLLD    IE + K  L P+H  + NGH  I ++LLD    I+ + K G+  IH A++  HL+ ++LLLQ    ID    D ++P
Sbjct:  271 NGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTP 374          

HSP 2 Score: 69.707 bits (169), Expect = 3.719e-13
Identity = 38/104 (36.54%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     V+ LLL    +I+   + GL P+H  S  GH  I+K LL R  +    +      +H A+R GH E  K LLQ K +++ K KD  +P
Sbjct:  403 NGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTP 506          

HSP 3 Score: 62.3882 bits (150), Expect = 1.220e-10
Identity = 32/100 (32.00%), Postives = 51/100 (51.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A R G   V + LL     +  + K    P+H  +  GH+ ++KLLL+ N         G   +H A+REGH+ET+  LL+++    C  K   +P
Sbjct:  473 PLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTP 572          

HSP 4 Score: 62.3882 bits (150), Expect = 1.232e-10
Identity = 35/109 (32.11%), Postives = 58/109 (53.21%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D +   G  P+HIA      +V +LLL+   ++    + G+ P+H  S  G+  +++LLLDR   IE + K  +  +H A+R GH+   ++LL     I  K K+ +SP
Sbjct:  233 DVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSP 341          

HSP 5 Score: 62.003 bits (149), Expect = 1.678e-10
Identity = 31/103 (30.10%), Postives = 54/103 (52.43%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+A + G   +V LLL    N    +K GL P+H ++  GH  +  +L+     ++   ++G   +H AS  G+++ +K LLQ +  ++ K K   SP
Sbjct:  668 GVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSP 770          

HSP 6 Score: 58.151 bits (139), Expect = 3.071e-9
Identity = 31/104 (29.81%), Postives = 53/104 (50.96%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D   P+H A R G  ++V+LLL+ + N       G  P+H  +  GH E +  LL++  +  C  K G   +H A++ G +   +LLL+R    +   K+ ++P
Sbjct:  502 DDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTP 605          

HSP 7 Score: 56.9954 bits (136), Expect = 7.376e-9
Identity = 28/104 (26.92%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     V R LL    +   E   G+ P+H  +  GH+E++ LLL +       +K G+  +H  ++EGH+    +L++    +D   +   +P
Sbjct:  634 NGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTP 737          

HSP 8 Score: 55.4546 bits (132), Expect = 2.170e-8
Identity = 31/99 (31.31%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA RN       +LL    N +   K G  P+H  +   +  + +LLL+R  ++    + G+  +H ASR G++  ++LLL R  +I+ K KD ++P
Sbjct:  210 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTP 308          

HSP 9 Score: 55.4546 bits (132), Expect = 2.495e-8
Identity = 30/89 (33.71%), Postives = 45/89 (50.56%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            G+ P+HIA R G    V  LL+   +  C  K G  P+H  +  G   + +LLL+R+       K G+  +H A    +L+ +KLLL R
Sbjct:  536 GHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR 624          

HSP 10 Score: 54.6842 bits (130), Expect = 3.825e-8
Identity = 32/104 (30.77%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D I  D   P+H+A   G   V ++LLD           G  P+H      H  +++LLL    +I+   + G+  +H AS  GHL  +K LLQR    +  N
Sbjct:  364 IDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSN 467          

HSP 11 Score: 51.9878 bits (123), Expect = 3.635e-7
Identity = 29/100 (29.00%), Postives = 50/100 (50.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H A RNG   +  +LLD    I+ + K GL PIH  +   H + ++LLL  +  I+      +  +H A+  GH    K+LL +  + + +  +  +P
Sbjct:  308 PLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTP 407          

HSP 12 Score: 51.6026 bits (122), Expect = 5.212e-7
Identity = 26/103 (25.24%), Postives = 51/103 (49.51%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+  + G   V  +L+     ++   + G  P+H  S  G+ +++K LL     +  + KLG   +H A+++GH + + LLL+     +  + D  +P
Sbjct:  701 GLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTP 803          

HSP 13 Score: 51.6026 bits (122), Expect = 5.261e-7
Identity = 30/104 (28.85%), Postives = 49/104 (47.12%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  PIH+A +      VRLLL     I+      L P+H  +  GH  + K+LLD+          G   +H A ++ H+  ++LLL+    ID   +  ++P
Sbjct:  337 NGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTP 440          

HSP 14 Score: 49.2914 bits (116), Expect = 2.570e-6
Identity = 28/104 (26.92%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+H+A  +    +V+LLL    +       G  P+H  +     E+ + LL    +   E   G+  +H A++EGH E + LLL ++   +  NK  ++P
Sbjct:  601 NGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTP 704          
BLAST of SMED30030653 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 73.1738 bits (178), Expect = 1.530e-14
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            RA  +D    +   P+H+A + G  ++V+LLLD    I+ + + GL P+H  + +GH +++++LLDR   I  + K G+  +H A++  HL  ++LLLQ    +D
Sbjct:  240 RAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVD 344          

HSP 2 Score: 70.0922 bits (170), Expect = 1.693e-13
Identity = 34/104 (32.69%), Postives = 59/104 (56.73%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
             G  P+HIA   G  +V  LLL+ +  ++   +  + P+H  S  G++ ++KLLLDR   I+ + + G+  +H  +R GH + +++LL R   I  K K+ +SP
Sbjct:  217 SGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSP 320          

HSP 3 Score: 62.3882 bits (150), Expect = 7.909e-11
Identity = 32/99 (32.32%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA R        LLL    N + E K G  P+H  +  G+  +  LLL+R   ++   +  +  +H AS+ G+   +KLLL R  +ID K +D ++P
Sbjct:  189 LHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTP 287          

HSP 4 Score: 59.6918 bits (143), Expect = 7.454e-10
Identity = 34/114 (29.82%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H   R+G   VV +LLD +  I  + K GL P+H  +   H   ++LLL  N  ++      +  +H A+  GH +  K+LL +K   + K  +  +P
Sbjct:  273 RGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTP 386          

HSP 5 Score: 55.8398 bits (133), Expect = 1.418e-8
Identity = 27/103 (26.21%), Postives = 49/103 (47.57%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCR 498
            R   +D     GN  +HIA   G   VV++L+    N+  + + G  P++  +   H E++K LLD   +     + G   +  A ++GH + + LLL+   +
Sbjct:   79 REANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 181          

HSP 6 Score: 50.447 bits (119), Expect = 8.880e-7
Identity = 25/104 (24.04%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D + +D    +H+A   G + V ++LLD   N   +   G  P+H        ++++LLL    +I+   + G+  IH A+  GH+  +  L+      +  N
Sbjct:  343 VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTN 446          
BLAST of SMED30030653 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 72.0182 bits (175), Expect = 6.092e-14
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            R   +D    +G  P+H+A + G  ++V+LLLD    I+ + + GL P+H  + +GH ++++LLL+R   +    K G+  +H A++  H+E +K LLQ K  +D
Sbjct:  210 RGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVD 314          

HSP 2 Score: 69.707 bits (169), Expect = 3.212e-13
Identity = 38/119 (31.93%), Postives = 68/119 (57.14%), Query Frame = 1
Query:  175 VRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            ++N+  A+   K    G  P+HIA   G  +V  LLL+    ++   + G+ P+H  S  G++ ++KLLLDR   I+ + + G+  +H A+R GH + ++LLL+R   +  + K+ +SP
Sbjct:  175 LQNDHNADVQSK---SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSP 290          

HSP 3 Score: 59.6918 bits (143), Expect = 8.686e-10
Identity = 32/99 (32.32%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA R        LLL    N + + K G  P+H  +  G+  +  LLL+R   ++   + G+  +H AS+ G+   +KLLL R  +ID K +D ++P
Sbjct:  159 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTP 257          

HSP 4 Score: 56.225 bits (134), Expect = 1.120e-8
Identity = 32/110 (29.09%), Postives = 54/110 (49.09%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +D +  D    +H+A   G + V +LLLD   N       GL PIH  +  GH  I+ LLL    + +  +  G   +H A+R G +E ++ LL+    +D + ++  +P
Sbjct:  313 VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTP 422          

HSP 5 Score: 56.225 bits (134), Expect = 1.218e-8
Identity = 37/125 (29.60%), Postives = 57/125 (45.60%), Query Frame = 1
Query:  160 GNAEGVRNNFR-AEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  E VR   R    +D    +   P+HIA R G   +V+LLL    + +     G  P+H  +  G  ++  +LL+         K G   +H A++ G L+  KLLLQR+   D   K+  +P
Sbjct:  397 GQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTP 521          

HSP 6 Score: 54.6842 bits (130), Expect = 3.967e-8
Identity = 29/109 (26.61%), Postives = 48/109 (44.04%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            R    D    +G  P+HIA +     +   LL+         K G+ P+H  S  GH++++ LLLD+   I    K G+  +H A++E  +    +L +     D   K
Sbjct:  507 RRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTK 615          

HSP 7 Score: 52.373 bits (124), Expect = 2.465e-7
Identity = 33/114 (28.95%), Postives = 52/114 (45.61%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H A R+G   VV LLL+    +    K GL P+H  +   H E +K LL     ++      +  +H A+  GH    KLLL ++   + +    ++P
Sbjct:  243 RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTP 356          

HSP 8 Score: 51.2174 bits (121), Expect = 5.881e-7
Identity = 29/98 (29.59%), Postives = 44/98 (44.90%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            G  P+H+A + G   V +LLL      +   K G  P+H  +     +I   LL+         K G+  +H AS+EGH + + LLL +   I    K
Sbjct:  485 GFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTK 582          

HSP 9 Score: 49.6766 bits (117), Expect = 1.934e-6
Identity = 29/109 (26.61%), Postives = 47/109 (43.12%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D    +G  P+HI+ R G   V  +LL+         K G  P+H  +  G  ++ KLLL R    +   K G   +H A+++  ++    LL      +   K  V+P
Sbjct:  446 DAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTP 554          

HSP 10 Score: 48.1358 bits (113), Expect = 6.827e-6
Identity = 30/116 (25.86%), Postives = 53/116 (45.69%), Query Frame = 1
Query:  184 NFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            N+ AE  + +   G  P+H+A + G   +V LLLD   NI    K GL  +H  +      +  +L       +   KLG   +  A   G+++ +  LL++   ++ K K+  +P
Sbjct:  539 NYGAE-TNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTP 653          
BLAST of SMED30030653 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 64.3142 bits (155), Expect = 8.561e-12
Identity = 35/100 (35.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+HIA R G   +V LLL    N     +    P+H  +  G  E+  +LLD N       K G   +H AS+ G+LE ++LLL+R   +D + K+ V+P
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTP 593          

HSP 2 Score: 55.8398 bits (133), Expect = 6.593e-9
Identity = 32/109 (29.36%), Postives = 55/109 (50.46%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D     G  P+HIA   G  +V +LLL+   N+  + +  + P+H  +  G + +  LLL R   I+   K  +  +H A+R GH + + LL+ +   I  K K+ ++P
Sbjct:  221 DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAP 329          

HSP 3 Score: 54.6842 bits (130), Expect = 1.639e-8
Identity = 29/104 (27.88%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     VV LLL     IE   + GL P+H  +  G   I+  LL +    + E   G   +H A+R    + +++L++   ++D + ++  +P
Sbjct:  391 NGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTP 494          

HSP 4 Score: 51.9878 bits (123), Expect = 1.318e-7
Identity = 28/99 (28.28%), Postives = 48/99 (48.48%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA +    +   LLL    N +   K G  P+H  +  GH  + +LLL++   +  + +  +  +H A++ G      LLL R   ID + KD ++P
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTP 296          

HSP 5 Score: 51.6026 bits (122), Expect = 1.661e-7
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 1
Query:  211 IVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +   G  P+H+A + G   VVRLLL+    ++ E K  + P+H  +   + ++  LLL+   + +   K G   +H A+++  +E    LLQ K   + K++   +P
Sbjct:  553 LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTP 659          

HSP 6 Score: 51.2174 bits (121), Expect = 2.611e-7
Identity = 27/100 (27.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A + G  ++  LLL     I+   K  L P+H  + +GH +++ LL+ +   I  + K G+  +H A++  H++  + LL  +  +D    D ++P
Sbjct:  263 PLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTP 362          

HSP 7 Score: 49.6766 bits (117), Expect = 8.819e-7
Identity = 30/104 (28.85%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D   P+HIA + G   V  +LLD + +     K G  P+H  S  G+ E+++LLL+R   ++ E K  +  +H A+   + +   LLL+         K+  +P
Sbjct:  523 DNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTP 626          

HSP 8 Score: 49.2914 bits (116), Expect = 1.022e-6
Identity = 24/104 (23.08%), Postives = 46/104 (44.23%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     +   LL    +   + + G  P+H  +  GH EI  LL++    +  +   G+  +H  ++E H+   ++L      I+ K     +P
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTP 725          

HSP 9 Score: 46.9802 bits (110), Expect = 5.539e-6
Identity = 28/115 (24.35%), Postives = 56/115 (48.70%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +RA  ++   + G  P+H+A   G  ++V  LL    N + E   G  P+H  +    ++++++L+     ++ + +     +H ASR G+ + + LLLQ     +   +D  SP
Sbjct:  414 YRAA-IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSP 527          
BLAST of SMED30030653 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 64.3142 bits (155), Expect = 8.561e-12
Identity = 35/100 (35.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+HIA R G   +V LLL    N     +    P+H  +  G  E+  +LLD N       K G   +H AS+ G+LE ++LLL+R   +D + K+ V+P
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTP 593          

HSP 2 Score: 55.8398 bits (133), Expect = 6.593e-9
Identity = 32/109 (29.36%), Postives = 55/109 (50.46%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D     G  P+HIA   G  +V +LLL+   N+  + +  + P+H  +  G + +  LLL R   I+   K  +  +H A+R GH + + LL+ +   I  K K+ ++P
Sbjct:  221 DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAP 329          

HSP 3 Score: 54.6842 bits (130), Expect = 1.639e-8
Identity = 29/104 (27.88%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     VV LLL     IE   + GL P+H  +  G   I+  LL +    + E   G   +H A+R    + +++L++   ++D + ++  +P
Sbjct:  391 NGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTP 494          

HSP 4 Score: 51.9878 bits (123), Expect = 1.318e-7
Identity = 28/99 (28.28%), Postives = 48/99 (48.48%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA +    +   LLL    N +   K G  P+H  +  GH  + +LLL++   +  + +  +  +H A++ G      LLL R   ID + KD ++P
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTP 296          

HSP 5 Score: 51.6026 bits (122), Expect = 1.661e-7
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 1
Query:  211 IVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +   G  P+H+A + G   VVRLLL+    ++ E K  + P+H  +   + ++  LLL+   + +   K G   +H A+++  +E    LLQ K   + K++   +P
Sbjct:  553 LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTP 659          

HSP 6 Score: 51.2174 bits (121), Expect = 2.611e-7
Identity = 27/100 (27.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A + G  ++  LLL     I+   K  L P+H  + +GH +++ LL+ +   I  + K G+  +H A++  H++  + LL  +  +D    D ++P
Sbjct:  263 PLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTP 362          

HSP 7 Score: 49.6766 bits (117), Expect = 8.819e-7
Identity = 30/104 (28.85%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D   P+HIA + G   V  +LLD + +     K G  P+H  S  G+ E+++LLL+R   ++ E K  +  +H A+   + +   LLL+         K+  +P
Sbjct:  523 DNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTP 626          

HSP 8 Score: 49.2914 bits (116), Expect = 1.022e-6
Identity = 24/104 (23.08%), Postives = 46/104 (44.23%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     +   LL    +   + + G  P+H  +  GH EI  LL++    +  +   G+  +H  ++E H+   ++L      I+ K     +P
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTP 725          

HSP 9 Score: 46.9802 bits (110), Expect = 5.539e-6
Identity = 28/115 (24.35%), Postives = 56/115 (48.70%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +RA  ++   + G  P+H+A   G  ++V  LL    N + E   G  P+H  +    ++++++L+     ++ + +     +H ASR G+ + + LLLQ     +   +D  SP
Sbjct:  414 YRAA-IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSP 527          
BLAST of SMED30030653 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 64.3142 bits (155), Expect = 8.571e-12
Identity = 35/100 (35.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+HIA R G   +V LLL    N     +    P+H  +  G  E+  +LLD N       K G   +H AS+ G+LE ++LLL+R   +D + K+ V+P
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTP 593          

HSP 2 Score: 55.8398 bits (133), Expect = 6.601e-9
Identity = 32/109 (29.36%), Postives = 55/109 (50.46%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D     G  P+HIA   G  +V +LLL+   N+  + +  + P+H  +  G + +  LLL R   I+   K  +  +H A+R GH + + LL+ +   I  K K+ ++P
Sbjct:  221 DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAP 329          

HSP 3 Score: 54.6842 bits (130), Expect = 1.641e-8
Identity = 29/104 (27.88%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     VV LLL     IE   + GL P+H  +  G   I+  LL +    + E   G   +H A+R    + +++L++   ++D + ++  +P
Sbjct:  391 NGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTP 494          

HSP 4 Score: 51.9878 bits (123), Expect = 1.319e-7
Identity = 28/99 (28.28%), Postives = 48/99 (48.48%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA +    +   LLL    N +   K G  P+H  +  GH  + +LLL++   +  + +  +  +H A++ G      LLL R   ID + KD ++P
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTP 296          

HSP 5 Score: 51.6026 bits (122), Expect = 1.663e-7
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 1
Query:  211 IVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +   G  P+H+A + G   VVRLLL+    ++ E K  + P+H  +   + ++  LLL+   + +   K G   +H A+++  +E    LLQ K   + K++   +P
Sbjct:  553 LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTP 659          

HSP 6 Score: 51.2174 bits (121), Expect = 2.614e-7
Identity = 27/100 (27.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A + G  ++  LLL     I+   K  L P+H  + +GH +++ LL+ +   I  + K G+  +H A++  H++  + LL  +  +D    D ++P
Sbjct:  263 PLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTP 362          

HSP 7 Score: 49.6766 bits (117), Expect = 8.829e-7
Identity = 30/104 (28.85%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D   P+HIA + G   V  +LLD + +     K G  P+H  S  G+ E+++LLL+R   ++ E K  +  +H A+   + +   LLL+         K+  +P
Sbjct:  523 DNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTP 626          

HSP 8 Score: 49.2914 bits (116), Expect = 1.023e-6
Identity = 24/104 (23.08%), Postives = 46/104 (44.23%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     +   LL    +   + + G  P+H  +  GH EI  LL++    +  +   G+  +H  ++E H+   ++L      I+ K     +P
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTP 725          

HSP 9 Score: 46.9802 bits (110), Expect = 5.545e-6
Identity = 28/115 (24.35%), Postives = 56/115 (48.70%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +RA  ++   + G  P+H+A   G  ++V  LL    N + E   G  P+H  +    ++++++L+     ++ + +     +H ASR G+ + + LLLQ     +   +D  SP
Sbjct:  414 YRAA-IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSP 527          
BLAST of SMED30030653 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 64.3142 bits (155), Expect = 8.571e-12
Identity = 35/100 (35.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+HIA R G   +V LLL    N     +    P+H  +  G  E+  +LLD N       K G   +H AS+ G+LE ++LLL+R   +D + K+ V+P
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTP 593          

HSP 2 Score: 55.8398 bits (133), Expect = 6.601e-9
Identity = 32/109 (29.36%), Postives = 55/109 (50.46%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D     G  P+HIA   G  +V +LLL+   N+  + +  + P+H  +  G + +  LLL R   I+   K  +  +H A+R GH + + LL+ +   I  K K+ ++P
Sbjct:  221 DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAP 329          

HSP 3 Score: 54.6842 bits (130), Expect = 1.641e-8
Identity = 29/104 (27.88%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     VV LLL     IE   + GL P+H  +  G   I+  LL +    + E   G   +H A+R    + +++L++   ++D + ++  +P
Sbjct:  391 NGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTP 494          

HSP 4 Score: 51.9878 bits (123), Expect = 1.319e-7
Identity = 28/99 (28.28%), Postives = 48/99 (48.48%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA +    +   LLL    N +   K G  P+H  +  GH  + +LLL++   +  + +  +  +H A++ G      LLL R   ID + KD ++P
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTP 296          

HSP 5 Score: 51.6026 bits (122), Expect = 1.663e-7
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 1
Query:  211 IVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +   G  P+H+A + G   VVRLLL+    ++ E K  + P+H  +   + ++  LLL+   + +   K G   +H A+++  +E    LLQ K   + K++   +P
Sbjct:  553 LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTP 659          

HSP 6 Score: 51.2174 bits (121), Expect = 2.614e-7
Identity = 27/100 (27.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A + G  ++  LLL     I+   K  L P+H  + +GH +++ LL+ +   I  + K G+  +H A++  H++  + LL  +  +D    D ++P
Sbjct:  263 PLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTP 362          

HSP 7 Score: 49.6766 bits (117), Expect = 8.829e-7
Identity = 30/104 (28.85%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D   P+HIA + G   V  +LLD + +     K G  P+H  S  G+ E+++LLL+R   ++ E K  +  +H A+   + +   LLL+         K+  +P
Sbjct:  523 DNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTP 626          

HSP 8 Score: 49.2914 bits (116), Expect = 1.023e-6
Identity = 24/104 (23.08%), Postives = 46/104 (44.23%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     +   LL    +   + + G  P+H  +  GH EI  LL++    +  +   G+  +H  ++E H+   ++L      I+ K     +P
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTP 725          

HSP 9 Score: 46.9802 bits (110), Expect = 5.545e-6
Identity = 28/115 (24.35%), Postives = 56/115 (48.70%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +RA  ++   + G  P+H+A   G  ++V  LL    N + E   G  P+H  +    ++++++L+     ++ + +     +H ASR G+ + + LLLQ     +   +D  SP
Sbjct:  414 YRAA-IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSP 527          
BLAST of SMED30030653 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 64.3142 bits (155), Expect = 8.581e-12
Identity = 35/100 (35.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+HIA R G   +V LLL    N     +    P+H  +  G  E+  +LLD N       K G   +H AS+ G+LE ++LLL+R   +D + K+ V+P
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTP 593          

HSP 2 Score: 55.8398 bits (133), Expect = 6.608e-9
Identity = 32/109 (29.36%), Postives = 55/109 (50.46%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D     G  P+HIA   G  +V +LLL+   N+  + +  + P+H  +  G + +  LLL R   I+   K  +  +H A+R GH + + LL+ +   I  K K+ ++P
Sbjct:  221 DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAP 329          

HSP 3 Score: 54.6842 bits (130), Expect = 1.643e-8
Identity = 29/104 (27.88%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     VV LLL     IE   + GL P+H  +  G   I+  LL +    + E   G   +H A+R    + +++L++   ++D + ++  +P
Sbjct:  391 NGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTP 494          

HSP 4 Score: 51.9878 bits (123), Expect = 1.321e-7
Identity = 28/99 (28.28%), Postives = 48/99 (48.48%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA +    +   LLL    N +   K G  P+H  +  GH  + +LLL++   +  + +  +  +H A++ G      LLL R   ID + KD ++P
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTP 296          

HSP 5 Score: 51.6026 bits (122), Expect = 1.664e-7
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 1
Query:  211 IVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +   G  P+H+A + G   VVRLLL+    ++ E K  + P+H  +   + ++  LLL+   + +   K G   +H A+++  +E    LLQ K   + K++   +P
Sbjct:  553 LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTP 659          

HSP 6 Score: 51.2174 bits (121), Expect = 2.617e-7
Identity = 27/100 (27.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A + G  ++  LLL     I+   K  L P+H  + +GH +++ LL+ +   I  + K G+  +H A++  H++  + LL  +  +D    D ++P
Sbjct:  263 PLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTP 362          

HSP 7 Score: 49.6766 bits (117), Expect = 8.838e-7
Identity = 30/104 (28.85%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D   P+HIA + G   V  +LLD + +     K G  P+H  S  G+ E+++LLL+R   ++ E K  +  +H A+   + +   LLL+         K+  +P
Sbjct:  523 DNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTP 626          

HSP 8 Score: 49.2914 bits (116), Expect = 1.024e-6
Identity = 24/104 (23.08%), Postives = 46/104 (44.23%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     +   LL    +   + + G  P+H  +  GH EI  LL++    +  +   G+  +H  ++E H+   ++L      I+ K     +P
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTP 725          

HSP 9 Score: 46.9802 bits (110), Expect = 5.551e-6
Identity = 28/115 (24.35%), Postives = 56/115 (48.70%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +RA  ++   + G  P+H+A   G  ++V  LL    N + E   G  P+H  +    ++++++L+     ++ + +     +H ASR G+ + + LLLQ     +   +D  SP
Sbjct:  414 YRAA-IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSP 527          
BLAST of SMED30030653 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 68.1662 bits (165), Expect = 4.872e-13
Identity = 29/91 (31.87%), Postives = 56/91 (61.54%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            P+H+A + G  ++V LLL+   NIE + + GL P+H  + +GH +++ +LL+R   I  + K G+  +H A++  H++  ++LL  +  +D
Sbjct:  241 PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVD 331          

HSP 2 Score: 64.6994 bits (156), Expect = 7.631e-12
Identity = 31/109 (28.44%), Postives = 57/109 (52.29%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D     G  P+HIA   G  ++  LL+    ++    K  + P+H  +  G + ++ LLL++   IE + + G+  +H A+R GH + + +LL+R   I  K K+ ++P
Sbjct:  199 DVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAP 307          

HSP 3 Score: 55.0694 bits (131), Expect = 1.366e-8
Identity = 28/104 (26.92%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     VV LLL    +I    + GL P+H  +  G   I+  LL  + + +     G   +H A+R    + +++LL+   ++D + ++  +P
Sbjct:  369 NGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTP 472          

HSP 4 Score: 53.9138 bits (128), Expect = 3.069e-8
Identity = 26/103 (25.24%), Postives = 49/103 (47.57%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCR 498
            R   +D     GN  +HIA   G   VV+LLL+ + ++  + + G  P++  +   H  +++LLL          + G   +  A ++GH + + +LL+   R
Sbjct:   66 RGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR 168          

HSP 5 Score: 53.9138 bits (128), Expect = 3.097e-8
Identity = 28/104 (26.92%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G   +H+A ++G   VV  LL     ++   K G   +H  S  G  E++KLLL+ N ++  + + G   ++ A++E H   ++LLL          +D  +P
Sbjct:   43 NGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTP 146          

HSP 6 Score: 53.9138 bits (128), Expect = 3.306e-8
Identity = 28/99 (28.28%), Postives = 47/99 (47.47%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA +        LLLD   N +   K G  P+H  S  G+  I  LL+ +   +    K  +  +H A++ G    + LLL++   I+ K +D ++P
Sbjct:  176 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTP 274          

HSP 7 Score: 53.5286 bits (127), Expect = 4.662e-8
Identity = 30/104 (28.85%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            DG  P+H A R+G   VV +LL+    I  + K GL P+H  +   H +  ++LL     ++      +  +H A+  GH+   KLLL R    + +  +  +P
Sbjct:  270 DGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTP 373          

HSP 8 Score: 52.373 bits (124), Expect = 8.766e-8
Identity = 26/106 (24.53%), Postives = 51/106 (48.11%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD 519
            +    + G  P+H+A   G  ++V  LL    + +     G  P+H  +    ++I+++LL     ++   +     +H ASR G+++ + LLLQ   ++D   KD
Sbjct:  396 ISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKD 501          
BLAST of SMED30030653 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303120)

HSP 1 Score: 64.6994 bits (156), Expect = 6.743e-12
Identity = 29/91 (31.87%), Postives = 56/91 (61.54%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            P+H+A + G  ++V LLL+   NIE + + GL P+H  + +GH +++ +LL+R   I  + K G+  +H A++  H++  ++LL  +  +D
Sbjct:  391 PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVD 481          

HSP 2 Score: 60.4622 bits (145), Expect = 2.341e-10
Identity = 31/109 (28.44%), Postives = 57/109 (52.29%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D     G  P+HIA   G  ++  LL+    ++    K  + P+H  +  G + ++ LLL++   IE + + G+  +H A+R GH + + +LL+R   I  K K+ ++P
Sbjct:  349 DVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAP 457          

HSP 3 Score: 51.9878 bits (123), Expect = 1.383e-7
Identity = 28/104 (26.92%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     VV LLL    +I    + GL P+H  +  G   I+  LL  + + +     G   +H A+R    + +++LL+   ++D + ++  +P
Sbjct:  519 NGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTP 622          

HSP 4 Score: 50.447 bits (119), Expect = 4.778e-7
Identity = 30/104 (28.85%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            DG  P+H A R+G   VV +LL+    I  + K GL P+H  +   H +  ++LL     ++      +  +H A+  GH+   KLLL R    + +  +  +P
Sbjct:  420 DGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTP 523          

HSP 5 Score: 50.0618 bits (118), Expect = 5.695e-7
Identity = 28/99 (28.28%), Postives = 47/99 (47.47%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA +        LLLD   N +   K G  P+H  S  G+  I  LL+ +   +    K  +  +H A++ G    + LLL++   I+ K +D ++P
Sbjct:  326 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTP 424          

HSP 6 Score: 50.0618 bits (118), Expect = 7.109e-7
Identity = 27/99 (27.27%), Postives = 49/99 (49.49%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +H+A ++G   VV  LL     ++   K G   +H  S  G  E++KLLL+ N ++  + + G   ++ A++E H   ++LLL          +D  +P
Sbjct:  198 LHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTP 296          

HSP 7 Score: 48.9062 bits (115), Expect = 1.433e-6
Identity = 29/105 (27.62%), Postives = 53/105 (50.48%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDR--NCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCR 498
            R   +D     GN  +HIA   G   VV+LLL+ + ++  + + G  P++  +   H  +++LLL    N ++  ED  G   +  A ++GH + + +LL+   R
Sbjct:  216 RGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATED--GFTPLAVAMQQGHDKVVAVLLESDTR 318          

HSP 8 Score: 48.521 bits (114), Expect = 2.053e-6
Identity = 26/101 (25.74%), Postives = 50/101 (49.50%), Query Frame = 1
Query:  217 DDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD 519
            + G  P+H+A   G  ++V  LL    + +     G  P+H  +    ++I+++LL     ++   +     +H ASR G+++ + LLLQ   ++D   KD
Sbjct:  551 ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKD 651          
BLAST of SMED30030653 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 65.0846 bits (157), Expect = 6.754e-12
Identity = 34/91 (37.36%), Postives = 51/91 (56.04%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            P+H+AC+ G  S+  LLL     I+   + GL P+H  S +GH E++K LL +N  I  + K G+  +H A++  H E   LLL  K  +D
Sbjct:  270 PLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVD 360          

HSP 2 Score: 62.3882 bits (150), Expect = 6.072e-11
Identity = 32/120 (26.67%), Postives = 60/120 (50.00%), Query Frame = 1
Query:  160 GNAEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD 519
            GN + V+       +     +G  P+H+A + G   V ++LL+   NI    + G  P+H  +  GH +++K  ++ +  IE    +G   +H A+++GH+  + LLL+ K   +   KD
Sbjct:  673 GNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKD 792          

HSP 3 Score: 57.3806 bits (137), Expect = 2.506e-9
Identity = 35/108 (32.41%), Postives = 53/108 (49.07%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VS 528
            D +   G  P+HIA   G   +  LLL+   ++    K  + P+H     G   +  LLL R   I+   + G+  +H ASR GH+E +K LLQ+   I  K K+ +S
Sbjct:  228 DIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLS 335          

HSP 4 Score: 56.9954 bits (136), Expect = 3.376e-9
Identity = 33/122 (27.05%), Postives = 58/122 (47.54%), Query Frame = 1
Query:  166 AEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            A+ +R   R+  +D I  +G  P+H+A R G  +++ LLL     I  +       +H  +  G   I+++LL+         K G   +H A + G    +++LLQ    ID + K+ V+P
Sbjct:  478 ADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTP 599          

HSP 5 Score: 54.6842 bits (130), Expect = 2.013e-8
Identity = 28/104 (26.92%), Postives = 54/104 (51.92%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G   IHIAC+  +  +   LL    ++    K G  P+H  +  G+ ++++LLL+    I    K G+  +H A++EGH+   ++LL+    I  + ++  +P
Sbjct:  628 NGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYG-VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTP 730          

HSP 6 Score: 51.6026 bits (122), Expect = 1.913e-7
Identity = 33/114 (28.95%), Postives = 53/114 (46.49%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H A R+G   V++ LL  +  I  + K GL  +H  +   H E   LLLD    ++      +  +H A+  GH++  KLLL  K   + +  +  +P
Sbjct:  289 RGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTP 402          

HSP 7 Score: 51.2174 bits (121), Expect = 2.926e-7
Identity = 29/98 (29.59%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  211 IVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            I   G  P+H+A + G   +V+LLL+    I    K GL P+H  +  GH  + ++LL+    I    + G   +H A+  GHL+ +K  ++    I+
Sbjct:  658 ISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIE 754          

HSP 8 Score: 48.9062 bits (115), Expect = 2.009e-6
Identity = 29/99 (29.29%), Postives = 47/99 (47.47%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA +    +  +LLL    N +   K G  P+H  +  G+ +I  LLL+    +    K  +  +H A + G L    LLL R  +ID   +D ++P
Sbjct:  205 LHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTP 303          

HSP 9 Score: 48.521 bits (114), Expect = 2.551e-6
Identity = 30/109 (27.52%), Postives = 55/109 (50.46%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            + +   G  P+H+AC+ G  +VV++LL    +I+ + K  + P+H  +   +  I++LLL    +     + G   IH A ++ +LE    LLQ    ++  +K   SP
Sbjct:  557 NAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSP 665          

HSP 10 Score: 47.3654 bits (111), Expect = 4.897e-6
Identity = 29/104 (27.88%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     +V LL+    NI    + GL P+H  S  G   I+  LL    + +     G   +H A+R    + +++LL R  ++D   ++  +P
Sbjct:  398 NGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTP 500          
BLAST of SMED30030653 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0300497)

HSP 1 Score: 65.0846 bits (157), Expect = 6.754e-12
Identity = 34/91 (37.36%), Postives = 51/91 (56.04%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            P+H+AC+ G  S+  LLL     I+   + GL P+H  S +GH E++K LL +N  I  + K G+  +H A++  H E   LLL  K  +D
Sbjct:  270 PLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVD 360          

HSP 2 Score: 62.3882 bits (150), Expect = 6.072e-11
Identity = 32/120 (26.67%), Postives = 60/120 (50.00%), Query Frame = 1
Query:  160 GNAEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD 519
            GN + V+       +     +G  P+H+A + G   V ++LL+   NI    + G  P+H  +  GH +++K  ++ +  IE    +G   +H A+++GH+  + LLL+ K   +   KD
Sbjct:  673 GNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKD 792          

HSP 3 Score: 57.3806 bits (137), Expect = 2.506e-9
Identity = 35/108 (32.41%), Postives = 53/108 (49.07%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VS 528
            D +   G  P+HIA   G   +  LLL+   ++    K  + P+H     G   +  LLL R   I+   + G+  +H ASR GH+E +K LLQ+   I  K K+ +S
Sbjct:  228 DIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLS 335          

HSP 4 Score: 56.9954 bits (136), Expect = 3.376e-9
Identity = 33/122 (27.05%), Postives = 58/122 (47.54%), Query Frame = 1
Query:  166 AEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            A+ +R   R+  +D I  +G  P+H+A R G  +++ LLL     I  +       +H  +  G   I+++LL+         K G   +H A + G    +++LLQ    ID + K+ V+P
Sbjct:  478 ADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTP 599          

HSP 5 Score: 54.6842 bits (130), Expect = 2.013e-8
Identity = 28/104 (26.92%), Postives = 54/104 (51.92%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G   IHIAC+  +  +   LL    ++    K G  P+H  +  G+ ++++LLL+    I    K G+  +H A++EGH+   ++LL+    I  + ++  +P
Sbjct:  628 NGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYG-VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTP 730          

HSP 6 Score: 51.6026 bits (122), Expect = 1.913e-7
Identity = 33/114 (28.95%), Postives = 53/114 (46.49%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H A R+G   V++ LL  +  I  + K GL  +H  +   H E   LLLD    ++      +  +H A+  GH++  KLLL  K   + +  +  +P
Sbjct:  289 RGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTP 402          

HSP 7 Score: 51.2174 bits (121), Expect = 2.926e-7
Identity = 29/98 (29.59%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  211 IVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            I   G  P+H+A + G   +V+LLL+    I    K GL P+H  +  GH  + ++LL+    I    + G   +H A+  GHL+ +K  ++    I+
Sbjct:  658 ISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIE 754          

HSP 8 Score: 48.9062 bits (115), Expect = 2.009e-6
Identity = 29/99 (29.29%), Postives = 47/99 (47.47%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA +    +  +LLL    N +   K G  P+H  +  G+ +I  LLL+    +    K  +  +H A + G L    LLL R  +ID   +D ++P
Sbjct:  205 LHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTP 303          

HSP 9 Score: 48.521 bits (114), Expect = 2.551e-6
Identity = 30/109 (27.52%), Postives = 55/109 (50.46%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            + +   G  P+H+AC+ G  +VV++LL    +I+ + K  + P+H  +   +  I++LLL    +     + G   IH A ++ +LE    LLQ    ++  +K   SP
Sbjct:  557 NAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSP 665          

HSP 10 Score: 47.3654 bits (111), Expect = 4.897e-6
Identity = 29/104 (27.88%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     +V LL+    NI    + GL P+H  S  G   I+  LL    + +     G   +H A+R    + +++LL R  ++D   ++  +P
Sbjct:  398 NGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTP 500          
BLAST of SMED30030653 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089171)

HSP 1 Score: 65.0846 bits (157), Expect = 6.754e-12
Identity = 34/91 (37.36%), Postives = 51/91 (56.04%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            P+H+AC+ G  S+  LLL     I+   + GL P+H  S +GH E++K LL +N  I  + K G+  +H A++  H E   LLL  K  +D
Sbjct:  270 PLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVD 360          

HSP 2 Score: 62.3882 bits (150), Expect = 6.072e-11
Identity = 32/120 (26.67%), Postives = 60/120 (50.00%), Query Frame = 1
Query:  160 GNAEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD 519
            GN + V+       +     +G  P+H+A + G   V ++LL+   NI    + G  P+H  +  GH +++K  ++ +  IE    +G   +H A+++GH+  + LLL+ K   +   KD
Sbjct:  673 GNVDMVQLLLEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKD 792          

HSP 3 Score: 57.3806 bits (137), Expect = 2.506e-9
Identity = 35/108 (32.41%), Postives = 53/108 (49.07%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VS 528
            D +   G  P+HIA   G   +  LLL+   ++    K  + P+H     G   +  LLL R   I+   + G+  +H ASR GH+E +K LLQ+   I  K K+ +S
Sbjct:  228 DIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLS 335          

HSP 4 Score: 56.9954 bits (136), Expect = 3.376e-9
Identity = 33/122 (27.05%), Postives = 58/122 (47.54%), Query Frame = 1
Query:  166 AEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            A+ +R   R+  +D I  +G  P+H+A R G  +++ LLL     I  +       +H  +  G   I+++LL+         K G   +H A + G    +++LLQ    ID + K+ V+P
Sbjct:  478 ADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTP 599          

HSP 5 Score: 54.6842 bits (130), Expect = 2.013e-8
Identity = 28/104 (26.92%), Postives = 54/104 (51.92%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G   IHIAC+  +  +   LL    ++    K G  P+H  +  G+ ++++LLL+    I    K G+  +H A++EGH+   ++LL+    I  + ++  +P
Sbjct:  628 NGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYG-VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTP 730          

HSP 6 Score: 51.6026 bits (122), Expect = 1.913e-7
Identity = 33/114 (28.95%), Postives = 53/114 (46.49%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H A R+G   V++ LL  +  I  + K GL  +H  +   H E   LLLD    ++      +  +H A+  GH++  KLLL  K   + +  +  +P
Sbjct:  289 RGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTP 402          

HSP 7 Score: 51.2174 bits (121), Expect = 2.926e-7
Identity = 29/98 (29.59%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  211 IVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            I   G  P+H+A + G   +V+LLL+    I    K GL P+H  +  GH  + ++LL+    I    + G   +H A+  GHL+ +K  ++    I+
Sbjct:  658 ISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIE 754          

HSP 8 Score: 48.9062 bits (115), Expect = 2.009e-6
Identity = 29/99 (29.29%), Postives = 47/99 (47.47%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA +    +  +LLL    N +   K G  P+H  +  G+ +I  LLL+    +    K  +  +H A + G L    LLL R  +ID   +D ++P
Sbjct:  205 LHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTP 303          

HSP 9 Score: 48.521 bits (114), Expect = 2.551e-6
Identity = 30/109 (27.52%), Postives = 55/109 (50.46%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            + +   G  P+H+AC+ G  +VV++LL    +I+ + K  + P+H  +   +  I++LLL    +     + G   IH A ++ +LE    LLQ    ++  +K   SP
Sbjct:  557 NAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSP 665          

HSP 10 Score: 47.3654 bits (111), Expect = 4.897e-6
Identity = 29/104 (27.88%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     +V LL+    NI    + GL P+H  S  G   I+  LL    + +     G   +H A+R    + +++LL R  ++D   ++  +P
Sbjct:  398 NGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTP 500          
BLAST of SMED30030653 vs. Ensembl Zebrafish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 76.2554 bits (186), Expect = 1.410e-15
Identity = 40/104 (38.46%), Postives = 61/104 (58.65%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA R G   +VRLLLD    I+ + K  L P+H  + NGH  I+++LLD+   I+ + K G+  IH A++  HL+ ++ LLQ    ID    D ++P
Sbjct:  238 NGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTP 341          

HSP 2 Score: 68.9366 bits (167), Expect = 4.102e-13
Identity = 37/104 (35.58%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     V+ LLL  S ++E   + GL P+H  S  GH  I+K+L+ +  +    +      +H ASR GH E  + LLQ    +D K KD  +P
Sbjct:  370 NGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTP 473          

HSP 3 Score: 64.6994 bits (156), Expect = 1.036e-11
Identity = 35/109 (32.11%), Postives = 60/109 (55.05%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D +   G  P+HIA      +V +LLL+   ++    K G+ P+H  S  G+  +++LLLDR   I+ + K  +  +H A+R GH+  +++LL +   I  K K+ +SP
Sbjct:  200 DVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSP 308          

HSP 4 Score: 62.3882 bits (150), Expect = 6.702e-11
Identity = 29/103 (28.16%), Postives = 56/103 (54.37%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+A + G   +V LL+    N+   +K GL P+H ++  GH  I  +L+    ++    ++G   +H A   G+++ +K LLQ++  ++CK +   +P
Sbjct:  635 GVTPLHLASQEGQPDMVLLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKHGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNCKTRMSYTP 737          

HSP 5 Score: 58.5362 bits (140), Expect = 1.581e-9
Identity = 33/99 (33.33%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA RN       +LL    N +   K G  P+H  +   +  + +LLL+R   +    K G+  +H ASR G++  ++LLL R  +ID K KD ++P
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTP 275          

HSP 6 Score: 57.7658 bits (138), Expect = 2.383e-9
Identity = 31/100 (31.00%), Postives = 49/100 (49.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A R G   V   LL  +  ++ + K    P+H  S  GH+E++KLLL+           G   +H A+REGH +T  +LL    ++    K   +P
Sbjct:  440 PLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTP 539          

HSP 7 Score: 56.225 bits (134), Expect = 9.635e-9
Identity = 32/110 (29.09%), Postives = 52/110 (47.27%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +D    D   P+H A R G   +V+LLL+   N       G  P+H  +  GH++   +LLD N  +    K G   +H A++ G ++   LLL+R    +   K  ++P
Sbjct:  463 VDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTP 572          

HSP 8 Score: 54.6842 bits (130), Expect = 2.463e-8
Identity = 31/109 (28.44%), Postives = 52/109 (47.71%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            + AE +D I  D   P+H+A   G   V ++LLD           G  P+H      H  ++ LLL  + ++E   + G+  +H +S  GHL  +K+L+Q+    +  N
Sbjct:  327 YNAE-IDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASN 434          

HSP 9 Score: 54.6842 bits (130), Expect = 2.805e-8
Identity = 32/114 (28.07%), Postives = 54/114 (47.37%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    D   P+H A RNG   ++ +LLD    I+ + K GL PIH  +   H + ++ LL  N  I+      +  +H A+  GH    K+LL +  + + +  +  +P
Sbjct:  261 RGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTP 374          

HSP 10 Score: 54.299 bits (129), Expect = 3.954e-8
Identity = 27/89 (30.34%), Postives = 45/89 (50.56%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            G+ P+HIA R G      +LLD++  +    K G  P+H  +  G  ++  LLL+R        K+G+  +H A    +L+ + LLL +
Sbjct:  503 GHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSK 591          

HSP 11 Score: 53.5286 bits (127), Expect = 6.770e-8
Identity = 27/97 (27.84%), Postives = 50/97 (51.55%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRK 492
            ++ + + G  P+H++   G  ++V++L+    +    +     P+H  S  GH E+ + LL     ++ + K     +H ASR GH E +KLLL+ K
Sbjct:  397 LEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHK 493          

HSP 12 Score: 50.8322 bits (120), Expect = 5.374e-7
Identity = 28/103 (27.18%), Postives = 49/103 (47.57%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+A  +    VV LLL    +     + G  P+H  S    +E+   LL    +   E   G+  +H AS+EG  + + LL+ ++  ++  NK  ++P
Sbjct:  569 GLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLLISKQANVNLGNKSGLTP 671          

HSP 13 Score: 50.8322 bits (120), Expect = 5.785e-7
Identity = 24/86 (27.91%), Postives = 41/86 (47.67%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLL 480
            G  P+H+AC  G   +V+ LL    N+ C+ +    P+H  +  GH++I+ LLL            G   +  A R G++  + +L
Sbjct:  701 GYTPLHVACHYGNIKMVKFLLQQQANVNCKTRMSYTPLHQAAQQGHTDIVTLLLKHGAQPNEVTSNGTSALAIAKRLGYISVIDVL 786          

HSP 14 Score: 48.9062 bits (115), Expect = 2.180e-6
Identity = 20/88 (22.73%), Postives = 46/88 (52.27%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            G  P+H+  + G   +  +L+    ++    + G  P+H     G+ +++K LL +   + C+ ++    +H A+++GH + + LLL+
Sbjct:  668 GLTPLHLVAQEGHVGIADILVKHGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNCKTRMSYTPLHQAAQQGHTDIVTLLLK 755          

HSP 15 Score: 48.521 bits (114), Expect = 3.359e-6
Identity = 29/110 (26.36%), Postives = 51/110 (46.36%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            + K+   G  P+H+A + G   V  LLL+   N     K GL P+H    + + +++ LLL +  +     + G   +H AS++   E    LLQ     + ++   V+P
Sbjct:  529 LTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTP 638          

HSP 16 Score: 47.3654 bits (111), Expect = 7.131e-6
Identity = 23/89 (25.84%), Postives = 44/89 (49.44%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            +G  P+HIA +     V   LL    +   E   G+ P+H  S  G  +++ LL+ +   +   +K G+  +H  ++EGH+    +L++
Sbjct:  601 NGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVK 689          

HSP 17 Score: 46.9802 bits (110), Expect = 9.475e-6
Identity = 29/96 (30.21%), Postives = 47/96 (48.96%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDR--NCTIECEDKLGMRQIHYASREGHLETLKLLL 483
            ++     GN  +HIA   G   VV  L++   N+  + + G  P++  +   H E++K LLD   N TI  ED  G   +  A ++GH   + LL+
Sbjct:   71 LETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLDNGANQTIPTED--GFTPLAVALQQGHENVVALLI 164          
BLAST of SMED30030653 vs. Ensembl Zebrafish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 75.0998 bits (183), Expect = 3.511e-15
Identity = 36/97 (37.11%), Postives = 57/97 (58.76%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            G  P+H A ++G+  +V+LLL+   N+   DK   +PIHW +  GH E++KLL+ +     C+DK G   +H A+  GH++ +K LL+    ID  N
Sbjct:  140 GRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPN 236          

HSP 2 Score: 64.3142 bits (155), Expect = 1.354e-11
Identity = 34/100 (34.00%), Postives = 55/100 (55.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+HIA  N     V  LL    ++   D+ G  P+H  + +G+ E++KLLL++   +   DK   + IH+A+  GHLE +KLL+ +     CK+K   +P
Sbjct:  110 PLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTP 209          

HSP 3 Score: 52.7582 bits (125), Expect = 1.086e-7
Identity = 30/100 (30.00%), Postives = 47/100 (47.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            PIH A   G   VV+LL+    +  C+DK G  P+H  +A+GH +++K LL     I+  +  G   +H A   G       L+ R   ++  N    +P
Sbjct:  176 PIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVNQPNHRGYTP 275          
BLAST of SMED30030653 vs. Ensembl Zebrafish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 74.7146 bits (182), Expect = 3.760e-15
Identity = 36/97 (37.11%), Postives = 57/97 (58.76%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            G  P+H A ++G+  +V+LLL+   N+   DK   +PIHW +  GH E++KLL+ +     C+DK G   +H A+  GH++ +K LL+    ID  N
Sbjct:  140 GRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPN 236          

HSP 2 Score: 64.3142 bits (155), Expect = 1.382e-11
Identity = 34/100 (34.00%), Postives = 55/100 (55.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+HIA  N     V  LL    ++   D+ G  P+H  + +G+ E++KLLL++   +   DK   + IH+A+  GHLE +KLL+ +     CK+K   +P
Sbjct:  110 PLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTP 209          

HSP 3 Score: 52.7582 bits (125), Expect = 1.058e-7
Identity = 30/100 (30.00%), Postives = 47/100 (47.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            PIH A   G   VV+LL+    +  C+DK G  P+H  +A+GH +++K LL     I+  +  G   +H A   G       L+ R   ++  N    +P
Sbjct:  176 PIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVNQPNHRGYTP 275          
BLAST of SMED30030653 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 73.1738 bits (178), Expect = 1.367e-14
Identity = 37/104 (35.58%), Postives = 61/104 (58.65%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA R G   +VRLLLD    I+ + K  L P+H  + NGH  ++++LLD+   ++ + K G+  IH A++  H++ ++ LLQ    ID    D ++P
Sbjct:  179 NGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTP 282          

HSP 2 Score: 67.0106 bits (162), Expect = 1.639e-12
Identity = 40/121 (33.06%), Postives = 60/121 (49.59%), Query Frame = 1
Query:  169 EGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G + N RA        +G  P+HIAC+      + LLL  S ++E   + GL P+H  +  GH  I+K LL R  +    +      +H A+R GH E  + LLQ   ++D K KD  +P
Sbjct:  301 KGAKANARAL-------NGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTP 414          

HSP 3 Score: 67.0106 bits (162), Expect = 1.835e-12
Identity = 36/109 (33.03%), Postives = 60/109 (55.05%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D +   G  P+HIA      SV +LLL+   N+    K G+ P+H  S  G+  +++LLLDR   I+ + K  +  +H A+R GH+  +++LL +   +  K K+ +SP
Sbjct:  141 DVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSP 249          

HSP 4 Score: 57.7658 bits (138), Expect = 3.904e-10
Identity = 27/84 (32.14%), Postives = 46/84 (54.76%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLL 483
            P+H+A R G   V + LL  +  ++ + K    P+H  +  GH E++KLL++     +     G   +H A+REGH +T ++LL
Sbjct:  381 PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILL 464          

HSP 5 Score: 25.0238 bits (53), Expect = 3.904e-10
Identity = 14/32 (43.75%), Postives = 19/32 (59.38%), Query Frame = 2
Query:  485 NENAESIARIKIE-CPLDLAKQYSRVDCVELL 577
            +ENA+     K    PL +A +Y +VD VELL
Sbjct:  465 DENAQQTKMTKKGFTPLHVACKYGKVDVVELL 496          

HSP 6 Score: 59.3066 bits (142), Expect = 8.092e-10
Identity = 27/98 (27.55%), Postives = 54/98 (55.10%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            G  P+H+A + G   +V LL+    N+   +K GL P+H ++  GH  I  +L+ +  ++    ++G   +H A   G+++ +K LLQ++  ++ K +
Sbjct:  576 GITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTR 673          

HSP 7 Score: 58.9214 bits (141), Expect = 9.223e-10
Identity = 31/110 (28.18%), Postives = 55/110 (50.00%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +D    D   P+H A R G   +V+LL++   N +     G  P+H  +  GH++  ++LLD N       K G   +H A + G ++ ++LLL+R    +   K+ ++P
Sbjct:  404 VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTP 513          

HSP 8 Score: 58.5362 bits (140), Expect = 1.513e-9
Identity = 33/99 (33.33%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA RN       +LL    N +   K G  P+H  +   +  + +LLL+R   +    K G+  +H ASR G++  ++LLL R  +ID K KD ++P
Sbjct:  118 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTP 216          

HSP 9 Score: 56.225 bits (134), Expect = 8.025e-9
Identity = 33/114 (28.95%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    D   P+H A RNG   VV +LLD    ++ + K GL PIH  +   H + ++ LL  N  I+      +  +H A+  GH   +K+LL +  + + +  +  +P
Sbjct:  202 RGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTP 315          

HSP 10 Score: 55.4546 bits (132), Expect = 1.389e-8
Identity = 28/101 (27.72%), Postives = 51/101 (50.50%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            ++ + + G  P+H+A   G  ++V+ LL    +    +     P+H  +  GH E+ + LL  N  ++ + K     +H A+R GH E +KLL++ K   D
Sbjct:  338 LEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPD 438          

HSP 11 Score: 55.0694 bits (131), Expect = 2.232e-8
Identity = 30/108 (27.78%), Postives = 54/108 (50.00%), Query Frame = 1
Query:  208 KIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            K+   G  P+H+AC+ G   VV LLL+   N     K GL P+H    + + +++KLL+ +  +     + G   +H A+++  LE    LLQ     + ++   ++P
Sbjct:  472 KMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITP 579          

HSP 12 Score: 54.299 bits (129), Expect = 3.090e-8
Identity = 33/109 (30.28%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            + AE +D I  D   P+H+A   G   +V++LLD           G  P+H      H   + LLL  + ++E   + G+  +H A+  GHL  +K LLQR    +  N
Sbjct:  268 YNAE-IDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASN 375          

HSP 13 Score: 53.9138 bits (128), Expect = 4.691e-8
Identity = 29/95 (30.53%), Postives = 46/95 (48.42%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            D     G+ P+HIA R G     R+LLD +       K G  P+H     G  ++++LLL+R        K G+  +H A    +L+ +KLL+ +
Sbjct:  438 DSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSK 532          

HSP 14 Score: 49.2914 bits (116), Expect = 1.808e-6
Identity = 23/90 (25.56%), Postives = 44/90 (48.89%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            +G   +HIA +     V   LL    N   E   G+ P+H  S  G  +++ LL+ +   +   +K G+  +H  ++EGH+    +L+++
Sbjct:  542 NGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQ 631          

HSP 15 Score: 48.9062 bits (115), Expect = 2.255e-6
Identity = 21/89 (23.60%), Postives = 47/89 (52.81%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            +G  P+H+  + G   +  +L+    ++    + G  P+H     G+ +++K LL +   +  + +LG   +H A+++GH + + LLL+
Sbjct:  608 NGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLK 696          
BLAST of SMED30030653 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 73.1738 bits (178), Expect = 1.387e-14
Identity = 37/104 (35.58%), Postives = 61/104 (58.65%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA R G   +VRLLLD    I+ + K  L P+H  + NGH  ++++LLD+   ++ + K G+  IH A++  H++ ++ LLQ    ID    D ++P
Sbjct:  271 NGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTP 374          

HSP 2 Score: 67.0106 bits (162), Expect = 1.662e-12
Identity = 40/121 (33.06%), Postives = 60/121 (49.59%), Query Frame = 1
Query:  169 EGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G + N RA        +G  P+HIAC+      + LLL  S ++E   + GL P+H  +  GH  I+K LL R  +    +      +H A+R GH E  + LLQ   ++D K KD  +P
Sbjct:  393 KGAKANARAL-------NGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTP 506          

HSP 3 Score: 67.0106 bits (162), Expect = 1.861e-12
Identity = 36/109 (33.03%), Postives = 60/109 (55.05%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D +   G  P+HIA      SV +LLL+   N+    K G+ P+H  S  G+  +++LLLDR   I+ + K  +  +H A+R GH+  +++LL +   +  K K+ +SP
Sbjct:  233 DVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSP 341          

HSP 4 Score: 57.7658 bits (138), Expect = 3.892e-10
Identity = 27/84 (32.14%), Postives = 46/84 (54.76%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLL 483
            P+H+A R G   V + LL  +  ++ + K    P+H  +  GH E++KLL++     +     G   +H A+REGH +T ++LL
Sbjct:  473 PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILL 556          

HSP 5 Score: 25.0238 bits (53), Expect = 3.892e-10
Identity = 14/32 (43.75%), Postives = 19/32 (59.38%), Query Frame = 2
Query:  485 NENAESIARIKIE-CPLDLAKQYSRVDCVELL 577
            +ENA+     K    PL +A +Y +VD VELL
Sbjct:  557 DENAQQTKMTKKGFTPLHVACKYGKVDVVELL 588          

HSP 6 Score: 59.3066 bits (142), Expect = 8.200e-10
Identity = 27/98 (27.55%), Postives = 54/98 (55.10%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            G  P+H+A + G   +V LL+    N+   +K GL P+H ++  GH  I  +L+ +  ++    ++G   +H A   G+++ +K LLQ++  ++ K +
Sbjct:  668 GITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTR 765          

HSP 7 Score: 58.9214 bits (141), Expect = 9.346e-10
Identity = 31/110 (28.18%), Postives = 55/110 (50.00%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +D    D   P+H A R G   +V+LL++   N +     G  P+H  +  GH++  ++LLD N       K G   +H A + G ++ ++LLL+R    +   K+ ++P
Sbjct:  496 VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTP 605          

HSP 8 Score: 58.5362 bits (140), Expect = 1.533e-9
Identity = 33/99 (33.33%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA RN       +LL    N +   K G  P+H  +   +  + +LLL+R   +    K G+  +H ASR G++  ++LLL R  +ID K KD ++P
Sbjct:  210 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTP 308          

HSP 9 Score: 56.225 bits (134), Expect = 8.129e-9
Identity = 33/114 (28.95%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    D   P+H A RNG   VV +LLD    ++ + K GL PIH  +   H + ++ LL  N  I+      +  +H A+  GH   +K+LL +  + + +  +  +P
Sbjct:  294 RGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTP 407          

HSP 10 Score: 55.4546 bits (132), Expect = 1.407e-8
Identity = 28/101 (27.72%), Postives = 51/101 (50.50%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            ++ + + G  P+H+A   G  ++V+ LL    +    +     P+H  +  GH E+ + LL  N  ++ + K     +H A+R GH E +KLL++ K   D
Sbjct:  430 LEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPD 530          

HSP 11 Score: 55.0694 bits (131), Expect = 2.261e-8
Identity = 30/108 (27.78%), Postives = 54/108 (50.00%), Query Frame = 1
Query:  208 KIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            K+   G  P+H+AC+ G   VV LLL+   N     K GL P+H    + + +++KLL+ +  +     + G   +H A+++  LE    LLQ     + ++   ++P
Sbjct:  564 KMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITP 671          

HSP 12 Score: 54.299 bits (129), Expect = 3.129e-8
Identity = 33/109 (30.28%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            + AE +D I  D   P+H+A   G   +V++LLD           G  P+H      H   + LLL  + ++E   + G+  +H A+  GHL  +K LLQR    +  N
Sbjct:  360 YNAE-IDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASN 467          

HSP 13 Score: 53.9138 bits (128), Expect = 4.751e-8
Identity = 29/95 (30.53%), Postives = 46/95 (48.42%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            D     G+ P+HIA R G     R+LLD +       K G  P+H     G  ++++LLL+R        K G+  +H A    +L+ +KLL+ +
Sbjct:  530 DSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSK 624          

HSP 14 Score: 49.2914 bits (116), Expect = 1.830e-6
Identity = 23/90 (25.56%), Postives = 44/90 (48.89%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            +G   +HIA +     V   LL    N   E   G+ P+H  S  G  +++ LL+ +   +   +K G+  +H  ++EGH+    +L+++
Sbjct:  634 NGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQ 723          
BLAST of SMED30030653 vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 72.0182 bits (175), Expect = 6.116e-14
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            R   +D    +G  P+H+A + G  ++V+LLLD    I+ + + GL P+H  + +GH ++++LLL+R   +    K G+  +H A++  H+E +K LLQ K  +D
Sbjct:  234 RGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVD 338          

HSP 2 Score: 70.8626 bits (172), Expect = 1.543e-13
Identity = 35/110 (31.82%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +++  + G  P+HIA   G  +V  LLL+    ++   + G+ P+H  S  G++ ++KLLLDR   I+ + + G+  +H A+R GH + ++LLL+R   +  + K+ +SP
Sbjct:  205 VNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSP 314          

HSP 3 Score: 60.077 bits (144), Expect = 6.613e-10
Identity = 31/104 (29.81%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     V+ LL+    +I+   + GL PIH  +  GH  I+ LLL    + +  +  G   +H A+R G +E ++ LL+    +D + ++  +P
Sbjct:  376 NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTP 479          

HSP 4 Score: 56.225 bits (134), Expect = 1.085e-8
Identity = 37/125 (29.60%), Postives = 58/125 (46.40%), Query Frame = 1
Query:  160 GNAEGVRNNFR-AEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  E VR   R    +D    +   P+HIA R G   +V+LLL    + +     G  P+H  +  G  ++  +LL+         K G   +H A++ G L+  KLLLQR+   D   K+ ++P
Sbjct:  454 GQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTP 578          

HSP 5 Score: 52.7582 bits (125), Expect = 2.053e-7
Identity = 33/114 (28.95%), Postives = 52/114 (45.61%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H A R+G   VV LLL+    +    K GL P+H  +   H E +K LL     ++      +  +H A+  GH    KLLL ++   + +  +  +P
Sbjct:  267 RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 380          

HSP 6 Score: 50.8322 bits (120), Expect = 8.918e-7
Identity = 34/117 (29.06%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  184 NFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRN-CTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            N+ AE  + + + G  P+H+A + G   +V LLL+   NI    K GL P+H L+A     I+  +L +N   ++ + KLG   +  A   G+++ +  LL     ++ K K+  +P
Sbjct:  629 NYGAE-TNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLH-LAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTP 743          

HSP 7 Score: 50.447 bits (119), Expect = 1.062e-6
Identity = 30/104 (28.85%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D +  D    +H+A   G + V +LLLD   N       G  P+H        ++++LL+    +I+   + G+  IH A+  GHL  + LLLQ     D  N
Sbjct:  337 VDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTN 440          

HSP 8 Score: 49.6766 bits (117), Expect = 1.700e-6
Identity = 26/104 (25.00%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     +   LL+           G+ P+H  +  GH++++ LLL++   I    K G+  +H A++E  +   ++L +    +D + K   SP
Sbjct:  607 NGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSP 710          

HSP 9 Score: 48.521 bits (114), Expect = 4.506e-6
Identity = 29/104 (27.88%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+H+A       V  LLLD   + +   K G  P+H  S     +I   LL+           G+  +H A++EGH + + LLL ++  I    K+ ++P
Sbjct:  574 NGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTP 677          

HSP 10 Score: 47.7506 bits (112), Expect = 8.807e-6
Identity = 29/110 (26.36%), Postives = 50/110 (45.45%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +  I + G  PIH+A   G  ++V LLL    + +  +  G   +H  +  G  E+++ LL     ++   +     +H ASR G  E ++LLLQ     D    +  +P
Sbjct:  403 IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTP 512          
BLAST of SMED30030653 vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 72.0182 bits (175), Expect = 6.118e-14
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            R   +D    +G  P+H+A + G  ++V+LLLD    I+ + + GL P+H  + +GH ++++LLL+R   +    K G+  +H A++  H+E +K LLQ K  +D
Sbjct:  255 RGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVD 359          

HSP 2 Score: 70.8626 bits (172), Expect = 1.544e-13
Identity = 35/110 (31.82%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +++  + G  P+HIA   G  +V  LLL+    ++   + G+ P+H  S  G++ ++KLLLDR   I+ + + G+  +H A+R GH + ++LLL+R   +  + K+ +SP
Sbjct:  226 VNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSP 335          

HSP 3 Score: 60.077 bits (144), Expect = 6.615e-10
Identity = 31/104 (29.81%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     V+ LL+    +I+   + GL PIH  +  GH  I+ LLL    + +  +  G   +H A+R G +E ++ LL+    +D + ++  +P
Sbjct:  397 NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTP 500          

HSP 4 Score: 56.225 bits (134), Expect = 1.085e-8
Identity = 37/125 (29.60%), Postives = 58/125 (46.40%), Query Frame = 1
Query:  160 GNAEGVRNNFR-AEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  E VR   R    +D    +   P+HIA R G   +V+LLL    + +     G  P+H  +  G  ++  +LL+         K G   +H A++ G L+  KLLLQR+   D   K+ ++P
Sbjct:  475 GQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTP 599          

HSP 5 Score: 52.7582 bits (125), Expect = 2.054e-7
Identity = 33/114 (28.95%), Postives = 52/114 (45.61%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H A R+G   VV LLL+    +    K GL P+H  +   H E +K LL     ++      +  +H A+  GH    KLLL ++   + +  +  +P
Sbjct:  288 RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 401          

HSP 6 Score: 50.8322 bits (120), Expect = 8.920e-7
Identity = 34/117 (29.06%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  184 NFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRN-CTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            N+ AE  + + + G  P+H+A + G   +V LLL+   NI    K GL P+H L+A     I+  +L +N   ++ + KLG   +  A   G+++ +  LL     ++ K K+  +P
Sbjct:  650 NYGAE-TNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLH-LAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTP 764          

HSP 7 Score: 50.447 bits (119), Expect = 1.063e-6
Identity = 30/104 (28.85%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D +  D    +H+A   G + V +LLLD   N       G  P+H        ++++LL+    +I+   + G+  IH A+  GHL  + LLLQ     D  N
Sbjct:  358 VDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTN 461          

HSP 8 Score: 49.6766 bits (117), Expect = 1.700e-6
Identity = 26/104 (25.00%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     +   LL+           G+ P+H  +  GH++++ LLL++   I    K G+  +H A++E  +   ++L +    +D + K   SP
Sbjct:  628 NGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSP 731          

HSP 9 Score: 48.521 bits (114), Expect = 4.507e-6
Identity = 29/104 (27.88%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+H+A       V  LLLD   + +   K G  P+H  S     +I   LL+           G+  +H A++EGH + + LLL ++  I    K+ ++P
Sbjct:  595 NGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTP 698          

HSP 10 Score: 47.7506 bits (112), Expect = 8.809e-6
Identity = 29/110 (26.36%), Postives = 50/110 (45.45%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +  I + G  PIH+A   G  ++V LLL    + +  +  G   +H  +  G  E+++ LL     ++   +     +H ASR G  E ++LLLQ     D    +  +P
Sbjct:  424 IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTP 533          
BLAST of SMED30030653 vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 72.0182 bits (175), Expect = 6.119e-14
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            R   +D    +G  P+H+A + G  ++V+LLLD    I+ + + GL P+H  + +GH ++++LLL+R   +    K G+  +H A++  H+E +K LLQ K  +D
Sbjct:  234 RGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVD 338          

HSP 2 Score: 70.8626 bits (172), Expect = 1.544e-13
Identity = 35/110 (31.82%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +++  + G  P+HIA   G  +V  LLL+    ++   + G+ P+H  S  G++ ++KLLLDR   I+ + + G+  +H A+R GH + ++LLL+R   +  + K+ +SP
Sbjct:  205 VNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSP 314          

HSP 3 Score: 60.077 bits (144), Expect = 6.617e-10
Identity = 31/104 (29.81%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     V+ LL+    +I+   + GL PIH  +  GH  I+ LLL    + +  +  G   +H A+R G +E ++ LL+    +D + ++  +P
Sbjct:  376 NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTP 479          

HSP 4 Score: 56.225 bits (134), Expect = 1.085e-8
Identity = 37/125 (29.60%), Postives = 58/125 (46.40%), Query Frame = 1
Query:  160 GNAEGVRNNFR-AEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  E VR   R    +D    +   P+HIA R G   +V+LLL    + +     G  P+H  +  G  ++  +LL+         K G   +H A++ G L+  KLLLQR+   D   K+ ++P
Sbjct:  454 GQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTP 578          

HSP 5 Score: 52.7582 bits (125), Expect = 2.054e-7
Identity = 33/114 (28.95%), Postives = 52/114 (45.61%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H A R+G   VV LLL+    +    K GL P+H  +   H E +K LL     ++      +  +H A+  GH    KLLL ++   + +  +  +P
Sbjct:  267 RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 380          

HSP 6 Score: 50.8322 bits (120), Expect = 8.922e-7
Identity = 34/117 (29.06%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  184 NFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRN-CTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            N+ AE  + + + G  P+H+A + G   +V LLL+   NI    K GL P+H L+A     I+  +L +N   ++ + KLG   +  A   G+++ +  LL     ++ K K+  +P
Sbjct:  629 NYGAE-TNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLH-LAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTP 743          

HSP 7 Score: 50.447 bits (119), Expect = 1.063e-6
Identity = 30/104 (28.85%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D +  D    +H+A   G + V +LLLD   N       G  P+H        ++++LL+    +I+   + G+  IH A+  GHL  + LLLQ     D  N
Sbjct:  337 VDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTN 440          

HSP 8 Score: 49.6766 bits (117), Expect = 1.701e-6
Identity = 26/104 (25.00%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     +   LL+           G+ P+H  +  GH++++ LLL++   I    K G+  +H A++E  +   ++L +    +D + K   SP
Sbjct:  607 NGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSP 710          

HSP 9 Score: 48.521 bits (114), Expect = 4.508e-6
Identity = 29/104 (27.88%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+H+A       V  LLLD   + +   K G  P+H  S     +I   LL+           G+  +H A++EGH + + LLL ++  I    K+ ++P
Sbjct:  574 NGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTP 677          

HSP 10 Score: 47.7506 bits (112), Expect = 8.811e-6
Identity = 29/110 (26.36%), Postives = 50/110 (45.45%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +  I + G  PIH+A   G  ++V LLL    + +  +  G   +H  +  G  E+++ LL     ++   +     +H ASR G  E ++LLLQ     D    +  +P
Sbjct:  403 IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTP 512          
BLAST of SMED30030653 vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 72.0182 bits (175), Expect = 6.161e-14
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            R   +D    +G  P+H+A + G  ++V+LLLD    I+ + + GL P+H  + +GH ++++LLL+R   +    K G+  +H A++  H+E +K LLQ K  +D
Sbjct:  234 RGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVD 338          

HSP 2 Score: 70.8626 bits (172), Expect = 1.555e-13
Identity = 35/110 (31.82%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +++  + G  P+HIA   G  +V  LLL+    ++   + G+ P+H  S  G++ ++KLLLDR   I+ + + G+  +H A+R GH + ++LLL+R   +  + K+ +SP
Sbjct:  205 VNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSP 314          

HSP 3 Score: 60.077 bits (144), Expect = 6.660e-10
Identity = 31/104 (29.81%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     V+ LL+    +I+   + GL PIH  +  GH  I+ LLL    + +  +  G   +H A+R G +E ++ LL+    +D + ++  +P
Sbjct:  376 NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTP 479          

HSP 4 Score: 56.225 bits (134), Expect = 1.092e-8
Identity = 37/125 (29.60%), Postives = 58/125 (46.40%), Query Frame = 1
Query:  160 GNAEGVRNNFR-AEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  E VR   R    +D    +   P+HIA R G   +V+LLL    + +     G  P+H  +  G  ++  +LL+         K G   +H A++ G L+  KLLLQR+   D   K+ ++P
Sbjct:  454 GQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTP 578          

HSP 5 Score: 52.7582 bits (125), Expect = 2.067e-7
Identity = 33/114 (28.95%), Postives = 52/114 (45.61%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H A R+G   VV LLL+    +    K GL P+H  +   H E +K LL     ++      +  +H A+  GH    KLLL ++   + +  +  +P
Sbjct:  267 RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 380          

HSP 6 Score: 50.8322 bits (120), Expect = 8.975e-7
Identity = 34/117 (29.06%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  184 NFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRN-CTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            N+ AE  + + + G  P+H+A + G   +V LLL+   NI    K GL P+H L+A     I+  +L +N   ++ + KLG   +  A   G+++ +  LL     ++ K K+  +P
Sbjct:  629 NYGAE-TNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLH-LAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTP 743          

HSP 7 Score: 50.447 bits (119), Expect = 1.069e-6
Identity = 30/104 (28.85%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D +  D    +H+A   G + V +LLLD   N       G  P+H        ++++LL+    +I+   + G+  IH A+  GHL  + LLLQ     D  N
Sbjct:  337 VDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTN 440          

HSP 8 Score: 49.6766 bits (117), Expect = 1.711e-6
Identity = 26/104 (25.00%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     +   LL+           G+ P+H  +  GH++++ LLL++   I    K G+  +H A++E  +   ++L +    +D + K   SP
Sbjct:  607 NGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSP 710          

HSP 9 Score: 48.521 bits (114), Expect = 4.535e-6
Identity = 29/104 (27.88%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+H+A       V  LLLD   + +   K G  P+H  S     +I   LL+           G+  +H A++EGH + + LLL ++  I    K+ ++P
Sbjct:  574 NGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTP 677          

HSP 10 Score: 47.7506 bits (112), Expect = 8.862e-6
Identity = 29/110 (26.36%), Postives = 50/110 (45.45%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +  I + G  PIH+A   G  ++V LLL    + +  +  G   +H  +  G  E+++ LL     ++   +     +H ASR G  E ++LLLQ     D    +  +P
Sbjct:  403 IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTP 512          
BLAST of SMED30030653 vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 72.0182 bits (175), Expect = 6.162e-14
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            R   +D    +G  P+H+A + G  ++V+LLLD    I+ + + GL P+H  + +GH ++++LLL+R   +    K G+  +H A++  H+E +K LLQ K  +D
Sbjct:  251 RGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVD 355          

HSP 2 Score: 70.8626 bits (172), Expect = 1.555e-13
Identity = 35/110 (31.82%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +++  + G  P+HIA   G  +V  LLL+    ++   + G+ P+H  S  G++ ++KLLLDR   I+ + + G+  +H A+R GH + ++LLL+R   +  + K+ +SP
Sbjct:  222 VNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSP 331          

HSP 3 Score: 60.077 bits (144), Expect = 6.660e-10
Identity = 31/104 (29.81%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     V+ LL+    +I+   + GL PIH  +  GH  I+ LLL    + +  +  G   +H A+R G +E ++ LL+    +D + ++  +P
Sbjct:  393 NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTP 496          

HSP 4 Score: 56.225 bits (134), Expect = 1.092e-8
Identity = 37/125 (29.60%), Postives = 58/125 (46.40%), Query Frame = 1
Query:  160 GNAEGVRNNFR-AEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  E VR   R    +D    +   P+HIA R G   +V+LLL    + +     G  P+H  +  G  ++  +LL+         K G   +H A++ G L+  KLLLQR+   D   K+ ++P
Sbjct:  471 GQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTP 595          

HSP 5 Score: 52.7582 bits (125), Expect = 2.067e-7
Identity = 33/114 (28.95%), Postives = 52/114 (45.61%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H A R+G   VV LLL+    +    K GL P+H  +   H E +K LL     ++      +  +H A+  GH    KLLL ++   + +  +  +P
Sbjct:  284 RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 397          

HSP 6 Score: 50.8322 bits (120), Expect = 8.976e-7
Identity = 34/117 (29.06%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  184 NFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRN-CTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            N+ AE  + + + G  P+H+A + G   +V LLL+   NI    K GL P+H L+A     I+  +L +N   ++ + KLG   +  A   G+++ +  LL     ++ K K+  +P
Sbjct:  646 NYGAE-TNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLH-LAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTP 760          

HSP 7 Score: 50.447 bits (119), Expect = 1.069e-6
Identity = 30/104 (28.85%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D +  D    +H+A   G + V +LLLD   N       G  P+H        ++++LL+    +I+   + G+  IH A+  GHL  + LLLQ     D  N
Sbjct:  354 VDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTN 457          

HSP 8 Score: 49.6766 bits (117), Expect = 1.711e-6
Identity = 26/104 (25.00%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     +   LL+           G+ P+H  +  GH++++ LLL++   I    K G+  +H A++E  +   ++L +    +D + K   SP
Sbjct:  624 NGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSP 727          

HSP 9 Score: 48.521 bits (114), Expect = 4.535e-6
Identity = 29/104 (27.88%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+H+A       V  LLLD   + +   K G  P+H  S     +I   LL+           G+  +H A++EGH + + LLL ++  I    K+ ++P
Sbjct:  591 NGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTP 694          

HSP 10 Score: 47.7506 bits (112), Expect = 8.863e-6
Identity = 29/110 (26.36%), Postives = 50/110 (45.45%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +  I + G  PIH+A   G  ++V LLL    + +  +  G   +H  +  G  E+++ LL     ++   +     +H ASR G  E ++LLLQ     D    +  +P
Sbjct:  420 IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTP 529          
BLAST of SMED30030653 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 77.7962 bits (190), Expect = 3.377e-16
Identity = 43/114 (37.72%), Postives = 62/114 (54.39%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   ++    +G  P+HIA R G   +VRLLLD    IE   K  L P+H  + NGH  I ++LLD    I+ + K G+  IH A++  HL+ ++LLLQ    ID    D ++P
Sbjct:  232 RGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTP 345          

HSP 2 Score: 64.6994 bits (156), Expect = 1.121e-11
Identity = 35/109 (32.11%), Postives = 57/109 (52.29%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D +   G  P+HIA      +V +LLL+   ++    + G+ P+H  S  G+  +++LLLDR   IE   K  +  +H A+R GH+   ++LL     I  K K+ +SP
Sbjct:  204 DVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSP 312          

HSP 3 Score: 62.3882 bits (150), Expect = 6.200e-11
Identity = 42/121 (34.71%), Postives = 60/121 (49.59%), Query Frame = 1
Query:  169 EGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G + N RA        +G  P+HIAC+     V+ LLL    +I+   + GL P+H  S  GH  I+K LL R  +    +      +H A+R GH E  K LLQ K + + K KD  +P
Sbjct:  364 KGAKPNSRAL-------NGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTP 477          

HSP 4 Score: 57.3806 bits (137), Expect = 2.936e-9
Identity = 38/133 (28.57%), Postives = 59/133 (44.36%), Query Frame = 1
Query:  121 MGDFQCFKEHLMNGNAEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD 519
            MG     K  L  G +  V +N + E           P+H+A R G   V + LL        + K    P+H  +  GH+ ++KLLL+   +       G   +H A+REGH++T   LL+++    C  KD
Sbjct:  418 MGHLPIVKNLLQRGASPNV-SNVKVET----------PLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKD 539          

HSP 5 Score: 57.3806 bits (137), Expect = 3.020e-9
Identity = 34/109 (31.19%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            + AE +D I  D   P+H+A   G   V ++LLD           G  P+H      H  +++LLL    +I+   + G+  +H AS  GHL  +K LLQR    +  N
Sbjct:  331 YNAE-IDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSN 438          

HSP 6 Score: 57.3806 bits (137), Expect = 3.105e-9
Identity = 30/99 (30.30%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA RN       +LL    N +   K G  P+H  +   +  + +LLL+R  ++    + G+  +H ASR G++  ++LLL R  +I+ + KD ++P
Sbjct:  181 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTP 279          

HSP 7 Score: 53.9138 bits (128), Expect = 4.064e-8
Identity = 32/114 (28.07%), Postives = 54/114 (47.37%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   ++    D   P+H A RNG   +  +LLD    I+ + K GL PIH  +   H + ++LLL  N  I+      +  +H A+  GH    K+LL +  + + +  +  +P
Sbjct:  265 RGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTP 378          

HSP 8 Score: 52.373 bits (124), Expect = 1.437e-7
Identity = 30/104 (28.85%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  PIH+A +      VRLLL  +  I+      L P+H  +  GH  + K+LLD+          G   +H A ++ H+  ++LLL+    ID   +  ++P
Sbjct:  308 NGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTP 411          
BLAST of SMED30030653 vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 77.0258 bits (188), Expect = 4.793e-16
Identity = 36/111 (32.43%), Postives = 66/111 (59.46%), Query Frame = 1
Query:  199 FMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
             +++  + G  P+HIA   G  +V  LLL+    ++   + G+ P+H  S  G++ ++KLLLDR   I+ + + G+  +H A+R GH + ++LLL+RK  +  + K+ +SP
Sbjct:  204 MVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSP 314          

HSP 2 Score: 73.559 bits (179), Expect = 7.603e-15
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            R   +D    +G  P+H+A + G  ++V+LLLD    I+ + + GL P+H  + +GH ++++LLL+R   +    K G+  +H A++  H+E +K LLQ K  +D
Sbjct:  234 RGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVD 338          

HSP 3 Score: 52.373 bits (124), Expect = 1.313e-7
Identity = 32/107 (29.91%), Postives = 49/107 (45.79%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCK 510
            R   +D    DG  P+H A R+G   VV LLL+    +    K GL P+H  +   H E +K LL     ++      +  +H A+  GH    KLLL ++   + +
Sbjct:  267 RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNAR 373          
BLAST of SMED30030653 vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 77.0258 bits (188), Expect = 5.183e-16
Identity = 36/111 (32.43%), Postives = 66/111 (59.46%), Query Frame = 1
Query:  199 FMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
             +++  + G  P+HIA   G  +V  LLL+    ++   + G+ P+H  S  G++ ++KLLLDR   I+ + + G+  +H A+R GH + ++LLL+RK  +  + K+ +SP
Sbjct:  237 MVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSP 347          

HSP 2 Score: 73.9442 bits (180), Expect = 6.382e-15
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            R   +D    +G  P+H+A + G  ++V+LLLD    I+ + + GL P+H  + +GH ++++LLL+R   +    K G+  +H A++  H+E +K LLQ K  +D
Sbjct:  267 RGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVD 371          

HSP 3 Score: 53.1434 bits (126), Expect = 8.491e-8
Identity = 33/114 (28.95%), Postives = 52/114 (45.61%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H A R+G   VV LLL+    +    K GL P+H  +   H E +K LL     ++      +  +H A+  GH    KLLL ++   + +  +  +P
Sbjct:  300 RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 413          

HSP 4 Score: 52.7582 bits (125), Expect = 1.051e-7
Identity = 30/104 (28.85%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D +  D    +H+A   G + V +LLLD   N       G  P+H        ++++LL+    +I+   + G+  IH A+  GHL  + LLLQ     D  N
Sbjct:  370 VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTN 473          
BLAST of SMED30030653 vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 77.0258 bits (188), Expect = 5.240e-16
Identity = 36/111 (32.43%), Postives = 66/111 (59.46%), Query Frame = 1
Query:  199 FMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
             +++  + G  P+HIA   G  +V  LLL+    ++   + G+ P+H  S  G++ ++KLLLDR   I+ + + G+  +H A+R GH + ++LLL+RK  +  + K+ +SP
Sbjct:  240 MVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSP 350          

HSP 2 Score: 73.9442 bits (180), Expect = 7.156e-15
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            R   +D    +G  P+H+A + G  ++V+LLLD    I+ + + GL P+H  + +GH ++++LLL+R   +    K G+  +H A++  H+E +K LLQ K  +D
Sbjct:  270 RGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVD 374          

HSP 3 Score: 52.373 bits (124), Expect = 1.207e-7
Identity = 32/107 (29.91%), Postives = 49/107 (45.79%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCK 510
            R   +D    DG  P+H A R+G   VV LLL+    +    K GL P+H  +   H E +K LL     ++      +  +H A+  GH    KLLL ++   + +
Sbjct:  303 RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNAR 409          
BLAST of SMED30030653 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 77.0258 bits (188), Expect = 6.622e-16
Identity = 42/104 (40.38%), Postives = 59/104 (56.73%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA R G   +VRLLLD    IE   K  L P+H  + NGH  I ++LLD    I+ + K G+  IH A++  HL+ ++LLLQ    ID    D ++P
Sbjct:  242 NGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTP 345          

HSP 2 Score: 65.0846 bits (157), Expect = 7.639e-12
Identity = 33/103 (32.04%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+A + G   +V LLL    N    +K GL P+H +S  GH  +  +L+    T++   ++G   +H AS  G+++ +K LLQ +  ++ K K   SP
Sbjct:  639 GVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSP 741          

HSP 3 Score: 62.003 bits (149), Expect = 1.058e-10
Identity = 35/109 (32.11%), Postives = 57/109 (52.29%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D +   G  P+HIA      +V +LLL+   ++    + G+ P+H  S  G+  +++LLLDR   IE   K  +  +H A+R GH+   ++LL     I  K K+ +SP
Sbjct:  204 DVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSP 312          

HSP 4 Score: 59.3066 bits (142), Expect = 6.880e-10
Identity = 33/89 (37.08%), Postives = 46/89 (51.69%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            +G  P+HIAC+     V+ LLL    +I+   + GL P+H  S  GH  I+K LL R  +    +      +H A+R GH E  K LLQ
Sbjct:  374 NGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQ 462          

HSP 5 Score: 58.5362 bits (140), Expect = 1.299e-9
Identity = 29/104 (27.88%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     V R LL    +   E   G+ P+H  +  GH+E++ LLL +       +K G+  +H  S+EGH+    +L++    +D   +   +P
Sbjct:  605 NGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTP 708          

HSP 6 Score: 54.6842 bits (130), Expect = 2.783e-8
Identity = 34/109 (31.19%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            + AE +D I  D   P+H+A   G   V ++LLD           G  P+H      H  +++LLL    +I+   + G+  +H AS  GHL  +K LLQR    +  N
Sbjct:  331 YNAE-IDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSN 438          

HSP 7 Score: 54.6842 bits (130), Expect = 3.025e-8
Identity = 30/99 (30.30%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA RN       +LL    N +   K G  P+H  +   +  + +LLL+R  ++    + G+  +H ASR G++  ++LLL R  +I+ + KD ++P
Sbjct:  181 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTP 279          

HSP 8 Score: 53.9138 bits (128), Expect = 5.687e-8
Identity = 30/100 (30.00%), Postives = 50/100 (50.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H A RNG   +  +LLD    I+ + K GL PIH  +   H + ++LLL  N  I+      +  +H A+  GH    K+LL +  + + +  +  +P
Sbjct:  279 PLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTP 378          

HSP 9 Score: 51.9878 bits (123), Expect = 2.043e-7
Identity = 30/104 (28.85%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  PIH+A +      VRLLL  +  I+      L P+H  +  GH  + K+LLD+          G   +H A ++ H+  ++LLL+    ID   +  ++P
Sbjct:  308 NGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTP 411          

HSP 10 Score: 51.9878 bits (123), Expect = 2.262e-7
Identity = 30/100 (30.00%), Postives = 49/100 (49.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A R G   V + LL        + K    P+H  +  GH+ ++KLLL+   +       G   +H A+REGH++T   LL+++    C  K   +P
Sbjct:  444 PLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTP 543          

HSP 11 Score: 51.9878 bits (123), Expect = 2.262e-7
Identity = 24/88 (27.27%), Postives = 46/88 (52.27%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            G  P+H+  + G   V  +L+     ++   + G  P+H  S  G+ +++K LL     +  + KLG   +H A+++GH + + LLL+
Sbjct:  672 GLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK 759          

HSP 12 Score: 50.0618 bits (118), Expect = 9.919e-7
Identity = 28/104 (26.92%), Postives = 49/104 (47.12%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D   P+H A R G   +V+LLL+   +       G  P+H  +  GH +    LL++  +  C  K G   +H A++ G +   +LLL+     +   K+ ++P
Sbjct:  473 DDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTP 576          

HSP 13 Score: 49.2914 bits (116), Expect = 1.926e-6
Identity = 28/104 (26.92%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+H+A  +    +V+LLL    +       G  P+H  +     E+ + LL    +   E   G+  +H A++EGH E + LLL ++   +  NK  ++P
Sbjct:  572 NGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTP 675          

HSP 14 Score: 48.9062 bits (115), Expect = 2.470e-6
Identity = 27/89 (30.34%), Postives = 42/89 (47.19%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            G+ P+H A R G       LL+   +  C  K G  P+H  +  G   + +LLL+ +       K G+  +H A    +L+ +KLLL R
Sbjct:  507 GHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR 595          
BLAST of SMED30030653 vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 77.411 bits (189), Expect = 4.432e-15
Identity = 42/104 (40.38%), Postives = 60/104 (57.69%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA R G   +VRLLLD    IE + K  L P+H  + NGH  I ++LLD    I+ + K G+  IH A++  HL+ ++LLLQ    ID    D ++P
Sbjct:  238 NGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTP 341          

HSP 2 Score: 69.707 bits (169), Expect = 1.785e-12
Identity = 38/104 (36.54%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     V+ LLL    +I+   + GL P+H  S  GH  I+K LL R  +    +      +H A+R GH E  K LLQ K +++ K KD  +P
Sbjct:  370 NGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTP 473          

HSP 3 Score: 62.3882 bits (150), Expect = 5.857e-10
Identity = 32/100 (32.00%), Postives = 51/100 (51.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A R G   V + LL     +  + K    P+H  +  GH+ ++KLLL+ N         G   +H A+REGH+ET+  LL+++    C  K   +P
Sbjct:  440 PLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTP 539          

HSP 4 Score: 62.3882 bits (150), Expect = 5.912e-10
Identity = 35/109 (32.11%), Postives = 58/109 (53.21%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D +   G  P+HIA      +V +LLL+   ++    + G+ P+H  S  G+  +++LLLDR   IE + K  +  +H A+R GH+   ++LL     I  K K+ +SP
Sbjct:  200 DVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSP 308          

HSP 5 Score: 62.003 bits (149), Expect = 8.054e-10
Identity = 31/103 (30.10%), Postives = 54/103 (52.43%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+A + G   +V LLL    N    +K GL P+H ++  GH  +  +L+     ++   ++G   +H AS  G+++ +K LLQ +  ++ K K   SP
Sbjct:  635 GVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSP 737          

HSP 6 Score: 58.151 bits (139), Expect = 1.474e-8
Identity = 31/104 (29.81%), Postives = 53/104 (50.96%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D   P+H A R G  ++V+LLL+ + N       G  P+H  +  GH E +  LL++  +  C  K G   +H A++ G +   +LLL+R    +   K+ ++P
Sbjct:  469 DDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTP 572          

HSP 7 Score: 56.9954 bits (136), Expect = 3.540e-8
Identity = 28/104 (26.92%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     V R LL    +   E   G+ P+H  +  GH+E++ LLL +       +K G+  +H  ++EGH+    +L++    +D   +   +P
Sbjct:  601 NGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTP 704          

HSP 8 Score: 55.4546 bits (132), Expect = 1.042e-7
Identity = 31/99 (31.31%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA RN       +LL    N +   K G  P+H  +   +  + +LLL+R  ++    + G+  +H ASR G++  ++LLL R  +I+ K KD ++P
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTP 275          

HSP 9 Score: 55.4546 bits (132), Expect = 1.197e-7
Identity = 30/89 (33.71%), Postives = 45/89 (50.56%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            G+ P+HIA R G    V  LL+   +  C  K G  P+H  +  G   + +LLL+R+       K G+  +H A    +L+ +KLLL R
Sbjct:  503 GHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR 591          

HSP 10 Score: 54.6842 bits (130), Expect = 1.836e-7
Identity = 32/104 (30.77%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D I  D   P+H+A   G   V ++LLD           G  P+H      H  +++LLL    +I+   + G+  +H AS  GHL  +K LLQR    +  N
Sbjct:  331 IDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSN 434          

HSP 11 Score: 51.9878 bits (123), Expect = 1.745e-6
Identity = 29/100 (29.00%), Postives = 50/100 (50.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H A RNG   +  +LLD    I+ + K GL PIH  +   H + ++LLL  +  I+      +  +H A+  GH    K+LL +  + + +  +  +P
Sbjct:  275 PLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTP 374          

HSP 12 Score: 51.6026 bits (122), Expect = 2.502e-6
Identity = 26/103 (25.24%), Postives = 51/103 (49.51%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+  + G   V  +L+     ++   + G  P+H  S  G+ +++K LL     +  + KLG   +H A+++GH + + LLL+     +  + D  +P
Sbjct:  668 GLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTP 770          

HSP 13 Score: 51.6026 bits (122), Expect = 2.525e-6
Identity = 30/104 (28.85%), Postives = 49/104 (47.12%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  PIH+A +      VRLLL     I+      L P+H  +  GH  + K+LLD+          G   +H A ++ H+  ++LLL+    ID   +  ++P
Sbjct:  304 NGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTP 407          
BLAST of SMED30030653 vs. UniProt/SwissProt
Match: sp|Q02357|ANK1_MOUSE (Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 4.962e-15
Identity = 42/104 (40.38%), Postives = 59/104 (56.73%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA R G   +VRLLLD    IE   K  L P+H  + NGH  I ++LLD    I+ + K G+  IH A++  HL+ ++LLLQ    ID    D ++P
Sbjct:  234 NGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTP 337          

HSP 2 Score: 65.0846 bits (157), Expect = 5.707e-11
Identity = 33/103 (32.04%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+A + G   +V LLL    N    +K GL P+H +S  GH  +  +L+    T++   ++G   +H AS  G+++ +K LLQ +  ++ K K   SP
Sbjct:  631 GVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSP 733          

HSP 3 Score: 62.003 bits (149), Expect = 7.897e-10
Identity = 35/109 (32.11%), Postives = 57/109 (52.29%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D +   G  P+HIA      +V +LLL+   ++    + G+ P+H  S  G+  +++LLLDR   IE   K  +  +H A+R GH+   ++LL     I  K K+ +SP
Sbjct:  196 DVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSP 304          

HSP 4 Score: 59.3066 bits (142), Expect = 5.129e-9
Identity = 33/89 (37.08%), Postives = 46/89 (51.69%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            +G  P+HIAC+     V+ LLL    +I+   + GL P+H  S  GH  I+K LL R  +    +      +H A+R GH E  K LLQ
Sbjct:  366 NGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQ 454          

HSP 5 Score: 58.5362 bits (140), Expect = 9.679e-9
Identity = 29/104 (27.88%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     V R LL    +   E   G+ P+H  +  GH+E++ LLL +       +K G+  +H  S+EGH+    +L++    +D   +   +P
Sbjct:  597 NGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTP 700          

HSP 6 Score: 54.6842 bits (130), Expect = 2.070e-7
Identity = 34/109 (31.19%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            + AE +D I  D   P+H+A   G   V ++LLD           G  P+H      H  +++LLL    +I+   + G+  +H AS  GHL  +K LLQR    +  N
Sbjct:  323 YNAE-IDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSN 430          

HSP 7 Score: 54.6842 bits (130), Expect = 2.250e-7
Identity = 30/99 (30.30%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA RN       +LL    N +   K G  P+H  +   +  + +LLL+R  ++    + G+  +H ASR G++  ++LLL R  +I+ + KD ++P
Sbjct:  173 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTP 271          

HSP 8 Score: 53.9138 bits (128), Expect = 4.228e-7
Identity = 30/100 (30.00%), Postives = 50/100 (50.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H A RNG   +  +LLD    I+ + K GL PIH  +   H + ++LLL  N  I+      +  +H A+  GH    K+LL +  + + +  +  +P
Sbjct:  271 PLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTP 370          

HSP 9 Score: 51.9878 bits (123), Expect = 1.517e-6
Identity = 30/104 (28.85%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  PIH+A +      VRLLL  +  I+      L P+H  +  GH  + K+LLD+          G   +H A ++ H+  ++LLL+    ID   +  ++P
Sbjct:  300 NGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTP 403          

HSP 10 Score: 51.9878 bits (123), Expect = 1.532e-6
Identity = 30/100 (30.00%), Postives = 49/100 (49.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A R G   V + LL        + K    P+H  +  GH+ ++KLLL+   +       G   +H A+REGH++T   LL+++    C  K   +P
Sbjct:  436 PLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTP 535          

HSP 11 Score: 51.9878 bits (123), Expect = 1.680e-6
Identity = 24/88 (27.27%), Postives = 46/88 (52.27%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            G  P+H+  + G   V  +L+     ++   + G  P+H  S  G+ +++K LL     +  + KLG   +H A+++GH + + LLL+
Sbjct:  664 GLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK 751          

HSP 12 Score: 50.0618 bits (118), Expect = 7.357e-6
Identity = 28/104 (26.92%), Postives = 49/104 (47.12%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D   P+H A R G   +V+LLL+   +       G  P+H  +  GH +    LL++  +  C  K G   +H A++ G +   +LLL+     +   K+ ++P
Sbjct:  465 DDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTP 568          
BLAST of SMED30030653 vs. UniProt/SwissProt
Match: sp|Q502K3|ANR52_DANRE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio OX=7955 GN=ankrd52 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.811e-14
Identity = 36/97 (37.11%), Postives = 57/97 (58.76%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            G  P+H A ++G+  +V+LLL+   N+   DK   +PIHW +  GH E++KLL+ +     C+DK G   +H A+  GH++ +K LL+    ID  N
Sbjct:  140 GRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPN 236          

HSP 2 Score: 64.3142 bits (155), Expect = 1.034e-10
Identity = 34/100 (34.00%), Postives = 55/100 (55.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+HIA  N     V  LL    ++   D+ G  P+H  + +G+ E++KLLL++   +   DK   + IH+A+  GHLE +KLL+ +     CK+K   +P
Sbjct:  110 PLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTP 209          

HSP 3 Score: 52.7582 bits (125), Expect = 7.916e-7
Identity = 30/100 (30.00%), Postives = 47/100 (47.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            PIH A   G   VV+LL+    +  C+DK G  P+H  +A+GH +++K LL     I+  +  G   +H A   G       L+ R   ++  N    +P
Sbjct:  176 PIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVNQPNHRGYTP 275          
BLAST of SMED30030653 vs. UniProt/SwissProt
Match: sp|Q8C8R3|ANK2_MOUSE (Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 1.127e-13
Identity = 36/110 (32.73%), Postives = 66/110 (60.00%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +++  + G  P+HIA   G  +V  LLL+    ++   + G+ P+H  S  G++ ++KLLLDR   I+ + + G+  +H A+R GH + ++LLL+RK  +  + K+ +SP
Sbjct:  226 VNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSP 335          

HSP 2 Score: 71.2478 bits (173), Expect = 4.784e-13
Identity = 35/105 (33.33%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            R   +D    +G  P+H+A + G  ++V+LLLD    I+ + + GL P+H  + +GH ++++LLL+R   +    K G+  +H A++  H+E +K LLQ K  +D
Sbjct:  255 RGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVD 359          

HSP 3 Score: 60.077 bits (144), Expect = 3.512e-9
Identity = 31/104 (29.81%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     V+ LL+    +I+   + GL PIH  +  GH  I+ LLL    + +  +  G   +H A+R G +E ++ LL+    +D + ++  +P
Sbjct:  397 NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTP 500          

HSP 4 Score: 56.9954 bits (136), Expect = 3.357e-8
Identity = 37/125 (29.60%), Postives = 58/125 (46.40%), Query Frame = 1
Query:  160 GNAEGVRNNFR-AEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  E VR   R    +D    +   P+HIA R G   +V+LLL    + +     G  P+H  +  G  ++  +LL+         K G   +H A++ G L+  KLLLQR+   D   K+ ++P
Sbjct:  475 GQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTP 599          

HSP 5 Score: 54.299 bits (129), Expect = 3.301e-7
Identity = 27/99 (27.27%), Postives = 46/99 (46.46%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            +G  P+HIA +     +   LL+         K G+ P+H  S  GH++++ LLLD+   I    K G+  +H A++E  +    +L +     D   K
Sbjct:  628 NGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTK 726          

HSP 6 Score: 51.6026 bits (122), Expect = 2.101e-6
Identity = 33/114 (28.95%), Postives = 52/114 (45.61%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H A R+G   VV LLL+    +    K GL P+H  +   H E +K LL     ++      +  +H A+  GH    KLLL ++   + +  +  +P
Sbjct:  288 RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 401          

HSP 7 Score: 50.447 bits (119), Expect = 5.641e-6
Identity = 30/104 (28.85%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D +  D    +H+A   G + V +LLLD   N       G  P+H        ++++LL+    +I+   + G+  IH A+  GHL  + LLLQ     D  N
Sbjct:  358 VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTN 461          
BLAST of SMED30030653 vs. UniProt/SwissProt
Match: sp|O15084|ANR28_HUMAN (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5)

HSP 1 Score: 72.0182 bits (175), Expect = 2.959e-13
Identity = 36/100 (36.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+HIA  N        L+ L  N+   D+ G   +H  + +GH E++KLLL R   I   DK   R IH+A+  GH+E +KLL+     + CK+K   +P
Sbjct:  110 PLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTP 209          

HSP 2 Score: 58.9214 bits (141), Expect = 6.547e-9
Identity = 31/87 (35.63%), Postives = 45/87 (51.72%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLL 483
            G   +H A  +G   +V+LLL    NI   DK   R IHW +  GH E++KLL+     + C+DK     +H A+  G +  +K LL
Sbjct:  140 GRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLL 226          

HSP 3 Score: 57.3806 bits (137), Expect = 2.834e-8
Identity = 30/104 (28.85%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEI-LKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            GN P+H+AC NG   VV  L+D    +  +++ G  P+H+ +A+ H  + L+LL+     +  + K G   +H  +  G     + ++Q    IDC++K+  +P
Sbjct:  239 GNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTP 342          

HSP 4 Score: 54.299 bits (129), Expect = 2.321e-7
Identity = 36/120 (30.00%), Postives = 55/120 (45.83%), Query Frame = 1
Query:  157 NGNAEGVR---NNFRAEFMDKIVD-DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            NG++E +R    N   +    I D +G  P+ ++  NG    V  LL+   N++ +DKWG   +H  +  GH E +  LL         D  G   IH ++  GH+  L  LLQ    +D
Sbjct:  627 NGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMD 746          

HSP 5 Score: 51.9878 bits (123), Expect = 1.496e-6
Identity = 29/101 (28.71%), Postives = 53/101 (52.48%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGH-LETLKLLLQRKCRIDCKNKD*VSP 531
            P+H A  +G  SVV+ LLDL  ++   + +G  P+H    NG   ++  L+D    +  +++ G   +H+A+   H    L+LL+     ++ K+KD  +P
Sbjct:  209 PLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTP 309          
BLAST of SMED30030653 vs. TrEMBL
Match: A0A150G2U2 (ANK_REP_REGION domain-containing protein OS=Gonium pectorale OX=33097 GN=GPECTOR_72g614 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.442e-18
Identity = 47/127 (37.01%), Postives = 69/127 (54.33%), Query Frame = 1
Query:  154 MNGNAEGVRNNFRAEFMDKIVD-DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +NG  E V+   +A    +  D DG  P++ A RNG  + V++LL     IE EDK G  P++W + NG  E +  LL      E  DK G+  +H+A+R GH E +K LLQ    I+  +KD ++P
Sbjct:   49 LNGQVEAVQALLQAGGNKEAADKDGLTPLYWAARNGHGAAVQVLLQAGVKIETEDKDGWTPLYWAAQNGQVEAIHALLQAGANKETADKDGLTPLHWAARNGHGEAVKALLQADVNIEAADKDGLTP 175          

HSP 2 Score: 89.7373 bits (221), Expect = 5.103e-17
Identity = 43/122 (35.25%), Postives = 62/122 (50.82%), Query Frame = 1
Query:  154 MNGNAEGVRNNFRAEFMDKIVD-DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
             NG  E +    +A    +  D DG  P+H A RNG    V+ LL    NIE  DK GL P+HW + NGH E +K+LL      E   ++G   +H+A+  G +E + LLLQ     +  ++
Sbjct:  115 QNGQVEAIHALLQAGANKETADKDGLTPLHWAARNGHGEAVKALLQADVNIEAADKDGLTPLHWAARNGHGEAMKVLLQAGANKEAASQVGWTPVHWAAENGQVEAVGLLLQAGANKEAASQ 236          

HSP 3 Score: 88.9669 bits (219), Expect = 1.042e-16
Identity = 41/107 (38.32%), Postives = 62/107 (57.94%), Query Frame = 1
Query:  211 IVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            I+ DG  P+H A RNG    V+ LL    NIE EDK G  P++W + NG  E ++ LL      E  DK G+  +++A+R GH   +++LLQ   +I+ ++KD  +P
Sbjct:    3 ILIDGWTPLHWAARNGHGEAVKALLQAGVNIEAEDKDGWTPLYWAALNGQVEAVQALLQAGGNKEAADKDGLTPLYWAARNGHGAAVQVLLQAGVKIETEDKDGWTP 109          

HSP 4 Score: 88.1965 bits (217), Expect = 2.007e-16
Identity = 43/119 (36.13%), Postives = 64/119 (53.78%), Query Frame = 1
Query:  175 VRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            ++   + E  DK   DG  P++ A +NG    +  LL    N E  DK GL P+HW + NGH E +K LL  +  IE  DK G+  +H+A+R GH E +K+LLQ     +  ++   +P
Sbjct:   93 LQAGVKIETEDK---DGWTPLYWAAQNGQVEAIHALLQAGANKETADKDGLTPLHWAARNGHGEAVKALLQADVNIEAADKDGLTPLHWAARNGHGEAMKVLLQAGANKEAASQVGWTP 208          

HSP 5 Score: 83.1889 bits (204), Expect = 9.539e-15
Identity = 48/142 (33.80%), Postives = 73/142 (51.41%), Query Frame = 1
Query:  157 NGNAEGVRNNFRA----EFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP-------GFGKAI 549
            NG+ E V+   +A    E  DK   DG  P++ A  NG    V+ LL    N E  DK GL P++W + NGH   +++LL     IE EDK G   +++A++ G +E +  LLQ     +  +KD ++P       G G+A+
Sbjct:   17 NGHGEAVKALLQAGVNIEAEDK---DGWTPLYWAALNGQVEAVQALLQAGGNKEAADKDGLTPLYWAARNGHGAAVQVLLQAGVKIETEDKDGWTPLYWAAQNGQVEAIHALLQAGANKETADKDGLTPLHWAARNGHGEAV 155          

HSP 6 Score: 75.8702 bits (185), Expect = 2.895e-12
Identity = 38/126 (30.16%), Postives = 63/126 (50.00%), Query Frame = 1
Query:  157 NGNAEGVRNNFRAEFMDKIVD-DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            NG+ E V+   +A+   +  D DG  P+H A RNG    +++LL    N E   + G  P+HW + NG  E + LLL      E   ++G   ++ A+  GH++ ++ LLQ     +  +K   +P
Sbjct:  149 NGHGEAVKALLQADVNIEAADKDGLTPLHWAARNGHGEAMKVLLQAGANKEAASQVGWTPVHWAAENGQVEAVGLLLQAGANKEAASQIGWTPLYIAAENGHVKCVEALLQAGANKEAVDKGNSTP 274          

HSP 7 Score: 65.4698 bits (158), Expect = 1.069e-8
Identity = 34/103 (33.01%), Postives = 51/103 (49.51%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P++IA  NG    V  LL    N E  DK    P+H  +  GH E+++ LL      E  DK G   +H AS EG    +++LL+    ++ +N D ++P
Sbjct:  238 GWTPLYIAAENGHVKCVEALLQAGANKEAVDKGNSTPLHSAAQKGHVEVVEALLWAGANKEAADKDGDSPLHTASHEGQTGVVEVLLRAGAPLEARNHDGLTP 340          

HSP 8 Score: 57.7658 bits (138), Expect = 3.954e-6
Identity = 36/122 (29.51%), Postives = 59/122 (48.36%), Query Frame = 1
Query:  157 NGNAEGVRNNFRAEFMDKIVDDGN-FPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD 519
            NG+ + V    +A    + VD GN  P+H A + G   VV  LL    N E  DK G  P+H  S  G + ++++LL     +E  +  G+  +H A + GH + ++ LL+     + K  +
Sbjct:  248 NGHVKCVEALLQAGANKEAVDKGNSTPLHSAAQKGHVEVVEALLWAGANKEAADKDGDSPLHTASHEGQTGVVEVLLRAGAPLEARNHDGLTPLHRACQGGHRDVVEALLRAGADHEAKTNN 369          
BLAST of SMED30030653 vs. TrEMBL
Match: A0A5A8CMN1 (ANK_REP_REGION domain-containing protein OS=Cafeteria roenbergensis OX=33653 GN=FNF29_02482 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 7.908e-18
Identity = 49/112 (43.75%), Postives = 66/112 (58.93%), Query Frame = 1
Query:  196 EFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            E  DK   DG+ P H+A   G+  V++LLLD S +IE  DK G  P H  +A GH E+L+LLLD++  IE  DK G    H A+  GH E L+LLL +   I+  +KD  +P
Sbjct:  294 EVTDK---DGHTPCHLAAAAGYKEVLQLLLDKSASIEVTDKDGHTPCHLAAAAGHKEVLQLLLDKSANIEVTDKDGHTPCHLAAAAGHKEVLQLLLDKSANIEVTDKDGHTP 402          

HSP 2 Score: 91.2781 bits (225), Expect = 1.685e-17
Identity = 49/112 (43.75%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  196 EFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            E  DK   DG  P H+A   G   V++LLLD S NIE  DK G  P H  +A GH E+L+LLLD+  +IE  D+ G    H A+  GH E L+LLL +   I+  +KD  +P
Sbjct:  129 EVTDK---DGRTPCHLAAAAGHKEVLQLLLDKSANIEVTDKDGRTPCHLAAAAGHKEVLQLLLDKTASIEVTDEDGRTPCHLAAAAGHKEVLQLLLDKTASIEVTDKDGRTP 237          

HSP 3 Score: 91.2781 bits (225), Expect = 1.854e-17
Identity = 54/137 (39.42%), Postives = 75/137 (54.74%), Query Frame = 1
Query:  124 GDFQCFKEHLMNGNAEGVRNNFRAEFMDKIVD-DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G   C +E  M G+ E ++     E   ++ D DG  P H+A   G   V++LLLD S +IE  DK G  P H  +A GH E+L+LLLD+  +IE  DK G    H A+  GH E L+LLL +   I+  +KD  +P
Sbjct:   36 GRMAC-QEAAMKGHKEVMQLLIDREADLEVTDEDGRTPCHLAAAAGHKEVLQLLLDKSASIEVTDKDGRTPCHLAAAAGHKEVLQLLLDKTASIEVTDKDGRTPCHLAAAAGHKEVLQLLLDKSANIEVTDKDGRTP 171          

HSP 4 Score: 90.5077 bits (223), Expect = 2.797e-17
Identity = 49/112 (43.75%), Postives = 65/112 (58.04%), Query Frame = 1
Query:  196 EFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            E  DK   DG+ P H+A   G   V++LLLD S NIE  DK G  P H  +A GH E+L+LLLD++  IE  DK G    H A+  GH E L+LLL +   I+  ++D  +P
Sbjct:  327 EVTDK---DGHTPCHLAAAAGHKEVLQLLLDKSANIEVTDKDGHTPCHLAAAAGHKEVLQLLLDKSANIEVTDKDGHTPCHLAAAAGHKEVLQLLLDKSANIEVTDEDGRTP 435          

HSP 5 Score: 90.5077 bits (223), Expect = 3.229e-17
Identity = 49/112 (43.75%), Postives = 65/112 (58.04%), Query Frame = 1
Query:  196 EFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            E  DK   DG+ P H+A   G   V++LLLD S NIE  DK G  P H  +A GH E+L+LLLD++  IE  D+ G    H A+  GH E L+LLL +   I+  +KD  +P
Sbjct:  360 EVTDK---DGHTPCHLAAAAGHKEVLQLLLDKSANIEVTDKDGHTPCHLAAAAGHKEVLQLLLDKSANIEVTDEDGRTPCHLAAAAGHKEVLQLLLDKSANIEVTDKDGHTP 468          

HSP 6 Score: 89.7373 bits (221), Expect = 5.731e-17
Identity = 45/105 (42.86%), Postives = 63/105 (60.00%), Query Frame = 1
Query:  217 DDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +DG  P H+A   G   V++LLLD + +IE  DK G  P H  +A GH E+L+LLLD++ +IE  DK G    H A+  GH E L+LLL +   I+  +KD  +P
Sbjct:  199 EDGRTPCHLAAAAGHKEVLQLLLDKTASIEVTDKDGRTPCHLAAAAGHKEVLQLLLDKSASIEVTDKDGRTPCHLAAAAGHKEVLQLLLDKTASIEVTDKDGHTP 303          

HSP 7 Score: 88.9669 bits (219), Expect = 1.231e-16
Identity = 49/112 (43.75%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  196 EFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            E  DK   DG+ P H+A   G   V++LLLD S NIE  D+ G  P H  +A GH E+L+LLLD++  IE  DK G    H A+  GH E L+LLL +   I+  +K   SP
Sbjct:  393 EVTDK---DGHTPCHLAAAAGHKEVLQLLLDKSANIEVTDEDGRTPCHLAAAAGHKEVLQLLLDKSANIEVTDKDGHTPCHLAAAAGHKEVLQLLLDKTANIEVTDKKGHSP 501          

HSP 8 Score: 88.5817 bits (218), Expect = 1.255e-16
Identity = 48/112 (42.86%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  196 EFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            E  DK   DG  P H+A   G   V++LLLD S +IE  DK G  P H  +A GH E+L+LLLD+  +IE  DK G    H A+  G+ E L+LLL +   I+  +KD  +P
Sbjct:  228 EVTDK---DGRTPCHLAAAAGHKEVLQLLLDKSASIEVTDKDGRTPCHLAAAAGHKEVLQLLLDKTASIEVTDKDGHTPCHLAAAAGYKEVLQLLLDKSASIEVTDKDGHTP 336          

HSP 9 Score: 88.5817 bits (218), Expect = 1.355e-16
Identity = 47/112 (41.96%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  196 EFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            E  DK   DG  P H+A   G   V++LLLD + +IE  D+ G  P H  +A GH E+L+LLLD+  +IE  DK G    H A+  GH E L+LLL +   I+  +KD  +P
Sbjct:  162 EVTDK---DGRTPCHLAAAAGHKEVLQLLLDKTASIEVTDEDGRTPCHLAAAAGHKEVLQLLLDKTASIEVTDKDGRTPCHLAAAAGHKEVLQLLLDKSASIEVTDKDGRTP 270          

HSP 10 Score: 87.8113 bits (216), Expect = 2.773e-16
Identity = 47/112 (41.96%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  196 EFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            E  DK   DG  P H+A   G   V++LLLD + +IE  DK G  P H  +A GH E+L+LLLD++  IE  DK G    H A+  GH E L+LLL +   I+  ++D  +P
Sbjct:   96 EVTDK---DGRTPCHLAAAAGHKEVLQLLLDKTASIEVTDKDGRTPCHLAAAAGHKEVLQLLLDKSANIEVTDKDGRTPCHLAAAAGHKEVLQLLLDKTASIEVTDEDGRTP 204          

HSP 11 Score: 87.4261 bits (215), Expect = 3.325e-16
Identity = 47/112 (41.96%), Postives = 65/112 (58.04%), Query Frame = 1
Query:  196 EFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            E  DK   DG  P H+A   G   V++LLLD + +IE  DK G  P H  +A G+ E+L+LLLD++ +IE  DK G    H A+  GH E L+LLL +   I+  +KD  +P
Sbjct:  261 EVTDK---DGRTPCHLAAAAGHKEVLQLLLDKTASIEVTDKDGHTPCHLAAAAGYKEVLQLLLDKSASIEVTDKDGHTPCHLAAAAGHKEVLQLLLDKSANIEVTDKDGHTP 369          

HSP 12 Score: 78.9518 bits (193), Expect = 3.192e-13
Identity = 42/99 (42.42%), Postives = 54/99 (54.55%), Query Frame = 1
Query:  217 DDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +DG  P H+A   G   V++LLLD S NIE  DK G  P H  +A GH E+L+LLLD+   IE  DK G    H A   G  + ++LLL R     C +
Sbjct:  430 EDGRTPCHLAAAAGHKEVLQLLLDKSANIEVTDKDGHTPCHLAAAAGHKEVLQLLLDKTANIEVTDKKGHSPCHLAVLGGRKDAVQLLLDRGADFRCPD 528          

HSP 13 Score: 77.7962 bits (190), Expect = 8.020e-13
Identity = 43/138 (31.16%), Postives = 70/138 (50.72%), Query Frame = 1
Query:  121 MGDFQCFKEHLMNGNAEGVRNNFRA-EFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            M +   F+  +  G+   V       + +++ +  G      A   G   V++LL+D   ++E  D+ G  P H  +A GH E+L+LLLD++ +IE  DK G    H A+  GH E L+LLL +   I+  +KD  +P
Sbjct:    1 MSEVTAFESAITAGDLAKVTQALDGGQDVNERLSSGRMACQEAAMKGHKEVMQLLIDREADLEVTDEDGRTPCHLAAAAGHKEVLQLLLDKSASIEVTDKDGRTPCHLAAAAGHKEVLQLLLDKTASIEVTDKDGRTP 138          

HSP 14 Score: 58.151 bits (139), Expect = 3.448e-6
Identity = 31/77 (40.26%), Postives = 40/77 (51.95%), Query Frame = 1
Query:  196 EFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGM 426
            E  DK   DG+ P H+A   G   V++LLLD + NIE  DK G  P H     G  + ++LLLDR     C D  G+
Sbjct:  459 EVTDK---DGHTPCHLAAAAGHKEVLQLLLDKTANIEVTDKKGHSPCHLAVLGGRKDAVQLLLDRGADFRCPDAAGV 532          
BLAST of SMED30030653 vs. TrEMBL
Match: A0A4Q4SXR9 (ANK_REP_REGION domain-containing protein OS=Monosporascus ibericus OX=155417 GN=DL764_008315 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 9.744e-18
Identity = 34/100 (34.00%), Postives = 62/100 (62.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+  A R G  +VV+LL+D   N+E + K+G  P+ W +ANGH  ++KLL+D+   +E +D+     + +A+R GH   +KLL+ +   ++ K+++  +P
Sbjct:   15 PLSWAARTGHEAVVKLLVDKGANVEAKSKYGQTPLSWAAANGHEAVVKLLVDKGANVETKDRDDWTPLSWAARTGHEAVVKLLVDKGANVEAKDRNGRTP 114          

HSP 2 Score: 76.6406 bits (187), Expect = 3.443e-14
Identity = 32/89 (35.96%), Postives = 53/89 (59.55%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            G  P+  A  NG  +VV+LL+D   N+E +D+    P+ W +  GH  ++KLL+D+   +E +D+ G   + +A+R GH   +KLL Q+
Sbjct:   45 GQTPLSWAAANGHEAVVKLLVDKGANVETKDRDDWTPLSWAARTGHEAVVKLLVDKGANVEAKDRNGRTPLSWAARNGHEAVIKLLRQK 133          

HSP 3 Score: 62.3882 bits (150), Expect = 1.009e-8
Identity = 23/81 (28.40%), Postives = 46/81 (56.79%), Query Frame = 1
Query:  289 LSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +  N+E +D+    P+ W +  GH  ++KLL+D+   +E + K G   + +A+  GH   +KLL+ +   ++ K++D  +P
Sbjct:    1 MGANVETKDRNDWTPLSWAARTGHEAVVKLLVDKGANVEAKSKYGQTPLSWAAANGHEAVVKLLVDKGANVETKDRDDWTP 81          
BLAST of SMED30030653 vs. TrEMBL
Match: J9HSB7 (AAEL017480-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AaeL_AAEL017480 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.743e-17
Identity = 38/110 (34.55%), Postives = 62/110 (56.36%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +D   ++G  P+H A RNG   VV+ ++D   N++  D  G  P+H+ S NG  E++K L+D    ++     G   +HYASR GHLE +KLL+  +  +D  + +  +P
Sbjct:  134 VDTTRNEGWTPLHYASRNGRLEVVKFMIDNGANVDTTDNEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTPLHYASRNGHLEVVKLLIDDEANVDTTDNEGWTP 243          

HSP 2 Score: 87.0409 bits (214), Expect = 1.605e-16
Identity = 40/104 (38.46%), Postives = 59/104 (56.73%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D   ++G  P+H A RNG   VV+ L+D   N++     G  P+H+ S NGH E++KLL+D    ++  D  G   +H AS  GHLE +KLL+     +D KN
Sbjct:  167 VDTTDNEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTPLHYASRNGHLEVVKLLIDDEANVDTTDNEGWTPLHDASLIGHLEVVKLLIDNGANVDTKN 270          

HSP 3 Score: 86.2705 bits (212), Expect = 3.483e-16
Identity = 36/100 (36.00%), Postives = 56/100 (56.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H A RNG   VV+ L+D   N++  D  G  P+H+ S NGH E++KLL+D    ++     G   +HYASR G LE +K ++     +D  + +  +P
Sbjct:   78 PLHYASRNGRLEVVKFLIDNGANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTTRNEGWTPLHYASRNGRLEVVKFMIDNGANVDTTDNEGWTP 177          

HSP 4 Score: 85.1149 bits (209), Expect = 8.101e-16
Identity = 37/110 (33.64%), Postives = 59/110 (53.64%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +D   ++G  P+H A RNG   VV+LL+D   N++     G  P+H+ S NG  E++K ++D    ++  D  G   +HYASR G LE +K L+     +D    +  +P
Sbjct:  101 VDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTTRNEGWTPLHYASRNGRLEVVKFMIDNGANVDTTDNEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTP 210          

HSP 5 Score: 84.7297 bits (208), Expect = 1.041e-15
Identity = 38/110 (34.55%), Postives = 59/110 (53.64%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +D   + G  P+H A +NG   VV+LL+D   N++        P+H+ S NG  E++K L+D    ++  D  G   +HYASR GHLE +KLL+     +D    +  +P
Sbjct:   35 VDTTQNKGWTPLHFASQNGHLEVVKLLIDNRANVDTTQNEEWTPLHYASRNGRLEVVKFLIDNGANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTTRNEGWTP 144          

HSP 6 Score: 82.0333 bits (201), Expect = 1.196e-14
Identity = 37/110 (33.64%), Postives = 59/110 (53.64%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +D   ++G  P+H A  NG   VV+LL+D   N++     G  P+H+ S NGH E++KLL+D    ++         +HYASR G LE +K L+     +D  + +  +P
Sbjct:    2 VDTTRNEGWTPLHYASLNGHLEVVKLLIDNGANVDTTQNKGWTPLHFASQNGHLEVVKLLIDNRANVDTTQNEEWTPLHYASRNGRLEVVKFLIDNGANVDTTDNEGWTP 111          

HSP 7 Score: 81.2629 bits (199), Expect = 2.219e-14
Identity = 38/104 (36.54%), Postives = 59/104 (56.73%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D   ++G  P+H A RNG   VV+LL+D   N++  D  G  P+H  S  GH E++KLL+D    ++ ++      +H AS+ G LE +KLL+     +D KN
Sbjct:  200 VDTTQNEGWTPLHYASRNGHLEVVKLLIDDEANVDTTDNEGWTPLHDASLIGHLEVVKLLIDNGANVDTKNTRRPTSLHIASQNGRLEVVKLLIDNGANVDTKN 303          

HSP 8 Score: 63.929 bits (154), Expect = 2.755e-8
Identity = 26/78 (33.33%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  298 NIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            N++     G  P+H+ S NGH E++KLL+D    ++     G   +H+AS+ GHLE +KLL+  +  +D    +  +P
Sbjct:    1 NVDTTRNEGWTPLHYASLNGHLEVVKLLIDNGANVDTTQNKGWTPLHFASQNGHLEVVKLLIDNRANVDTTQNEEWTP 78          
BLAST of SMED30030653 vs. TrEMBL
Match: A0A429GFV7 (Ankyrin repeat domain-containing protein (Fragment) OS=Candidatus Methanodesulfokores washburnensis OX=2478471 GN=D6D85_13520 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 4.220e-17
Identity = 40/121 (33.06%), Postives = 70/121 (57.85%), Query Frame = 1
Query:  169 EGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G   N ++E+       G  P+H A   G+  +V+LL+D   +I   D  G  P+H  +ANGH ++++ LLDR   +  +D++G   +H+A+  GHL+ +KLL+ R   I+ K++D  +P
Sbjct:   26 KGADVNAKSEY-------GGTPLHWAAARGYLDIVKLLVDRGADISARDVDGETPLHRAAANGHLDVVEFLLDRGADVNAKDEVGGTPLHWAAAWGHLDIVKLLVDRGADINAKDEDGETP 139          

HSP 2 Score: 84.3445 bits (207), Expect = 5.141e-16
Identity = 37/98 (37.76%), Postives = 58/98 (59.18%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            DG  P+H A  NG   VV  LLD   ++  +D+ G  P+HW +A GH +I+KLL+DR   I  +D+ G   +H+A+  G L+ ++ LL R   ++ K+
Sbjct:   69 DGETPLHRAAANGHLDVVEFLLDRGADVNAKDEVGGTPLHWAAAWGHLDIVKLLVDRGADINAKDEDGETPLHWAADNGRLDVVEFLLDRGADVNAKD 166          

HSP 3 Score: 77.7962 bits (190), Expect = 1.461e-13
Identity = 35/103 (33.98%), Postives = 57/103 (55.34%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H A   G   +V+LL+D   +I  +D+ G  P+HW + NG  ++++ LLDR   +  +D  G   +H A+  G L+ +KLLL R   ++ KN    +P
Sbjct:  103 GGTPLHWAAAWGHLDIVKLLVDRGADINAKDEDGETPLHWAADNGRLDVVEFLLDRGADVNAKDIYGWTPLHLAAYYGRLDIVKLLLDRGADVNAKNGGGKTP 205          

HSP 4 Score: 69.707 bits (169), Expect = 1.401e-10
Identity = 31/91 (34.07%), Postives = 51/91 (56.04%), Query Frame = 1
Query:  244 ACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            A   G    VR LLD   ++  + ++G  P+HW +A G+ +I+KLL+DR   I   D  G   +H A+  GHL+ ++ LL R   ++ K++
Sbjct:   11 AASRGDLEEVRRLLDKGADVNAKSEYGGTPLHWAAARGYLDIVKLLVDRGADISARDVDGETPLHRAAANGHLDVVEFLLDRGADVNAKDE 101          

HSP 5 Score: 56.6102 bits (135), Expect = 6.322e-6
Identity = 30/99 (30.30%), Postives = 49/99 (49.49%), Query Frame = 1
Query:  217 DDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +DG  P+H A  NG   VV  LLD   ++  +D +G  P+H  +  G  +I+KLLLDR   +  ++  G   +  A  + + + +  L   K   D +N
Sbjct:  134 EDGETPLHWAADNGRLDVVEFLLDRGADVNAKDIYGWTPLHLAAYYGRLDIVKLLLDRGADVNAKNGGGKTPLDLAREKKYWDIVNFL--EKAVEDAEN 230          
BLAST of SMED30030653 vs. Ensembl Cavefish
Match: ENSAMXT00000037173.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21074007:21119253:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000037173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 2.056e-15
Identity = 37/105 (35.24%), Postives = 60/105 (57.14%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            R   +D    +G  P+H+A + G  ++VRLLLD    I+ + + GL P+H  + +GH   ++LLL+R   I    K G+  +H A++  H+E +K LLQ K  +D
Sbjct:  231 RGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVD 335          

HSP 2 Score: 73.1738 bits (178), Expect = 9.184e-15
Identity = 38/119 (31.93%), Postives = 67/119 (56.30%), Query Frame = 1
Query:  175 VRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            ++N+  A+   K    G  P+HIA   G  +V  LLL+    ++   + G+ P+H  S  G++ +++LLLDR   I+ + + G+  +H A+R GH   ++LLL+R   I  + K+ +SP
Sbjct:  196 LQNDHNADVQSK---SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSP 311          

HSP 3 Score: 62.7734 bits (151), Expect = 3.452e-11
Identity = 31/99 (31.31%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA R        LLL    N + + K G  P+H  +  G+  +  LLL+R   ++   + G+  +H AS+ G+   ++LLL R  +ID K +D ++P
Sbjct:  180 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTP 278          

HSP 4 Score: 54.6842 bits (130), Expect = 1.591e-8
Identity = 33/114 (28.95%), Postives = 52/114 (45.61%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H A R+G  + V LLL+    I    K GL P+H  +   H E +K LL     ++      +  +H A+  GH    KLLL ++   + +  +  +P
Sbjct:  264 RGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 377          

HSP 5 Score: 50.8322 bits (120), Expect = 3.115e-7
Identity = 29/102 (28.43%), Postives = 47/102 (46.08%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDC 507
            +D +  D    +H+A   G + V +LLLD   N       G  P+H        ++++LL+    +I+   + G+  IH A+  GHL  + LLLQ     D 
Sbjct:  334 VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDV 435          
BLAST of SMED30030653 vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 75.0998 bits (183), Expect = 2.576e-15
Identity = 39/104 (37.50%), Postives = 61/104 (58.65%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA R G   +VRLLLD    I+ + K  L P+H  + NGH  I+++LLD+   I+ + K G+  IH A++  H++ ++ LLQ    ID    D ++P
Sbjct:  210 NGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTP 313          

HSP 2 Score: 69.3218 bits (168), Expect = 2.673e-13
Identity = 37/100 (37.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD 519
            +G  P+HIAC+     V+ LLL  S ++E   + GL P+H  S  GH  I+K+LL +  +    +      +H ASR GH E  + LLQ    +D K KD
Sbjct:  342 NGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKD 441          

HSP 3 Score: 68.5514 bits (166), Expect = 4.243e-13
Identity = 37/107 (34.58%), Postives = 60/107 (56.07%), Query Frame = 1
Query:  211 IVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            I   G  P+HIA      +V +LLL+   N+    K G+ P+H  S  G+  +++LLLDR  TI+ + K  +  +H A+R GH+  +++LL +   I  K K+ +SP
Sbjct:  174 ITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSP 280          

HSP 4 Score: 60.4622 bits (145), Expect = 2.720e-10
Identity = 28/103 (27.18%), Postives = 56/103 (54.37%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+A + G   +V LL+    N+   +K GL P+H ++  GH  I  +L+ +  ++    ++G   +H A   G+++ +K LLQ++  ++ K +   +P
Sbjct:  607 GVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTP 709          

HSP 5 Score: 55.8398 bits (133), Expect = 8.745e-9
Identity = 31/110 (28.18%), Postives = 54/110 (49.09%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +D    D    +H A R G   +V+LLL+   N       G  P+H  +  GH++ +++LLD N       K G   +H A++ G ++  +LLL+R    +   K+ ++P
Sbjct:  435 VDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTP 544          

HSP 6 Score: 53.9138 bits (128), Expect = 1.161e-8
Identity = 27/84 (32.14%), Postives = 44/84 (52.38%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLL 483
            P+H+A R G   V   LL  +  ++ + K     +H  +  GH E++KLLL+           G   +H A+REGH +T+++LL
Sbjct:  412 PLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILL 495          

HSP 7 Score: 23.483 bits (49), Expect = 1.161e-8
Identity = 9/17 (52.94%), Postives = 12/17 (70.59%), Query Frame = 2
Query:  527 PLDLAKQYSRVDCVELL 577
            PL +A +Y +VD  ELL
Sbjct:  511 PLHVAAKYGKVDVAELL 527          

HSP 8 Score: 55.0694 bits (131), Expect = 1.661e-8
Identity = 32/109 (29.36%), Postives = 52/109 (47.71%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            + AE +D I  D   P+H+A   G   + ++LLD           G  P+H      H  ++ LLL  + ++E   + G+  +H AS  GHL  +K+LLQ+    +  N
Sbjct:  299 YNAE-IDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASN 406          

HSP 9 Score: 55.0694 bits (131), Expect = 1.823e-8
Identity = 28/97 (28.87%), Postives = 50/97 (51.55%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRK 492
            ++ + + G  P+H+A   G  ++V++LL    +    +     P+H  S  GH E+ + LL     ++ + K     +H A+R GH E +KLLL+ K
Sbjct:  369 LEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHK 465          

HSP 10 Score: 55.0694 bits (131), Expect = 1.840e-8
Identity = 28/89 (31.46%), Postives = 46/89 (51.69%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            G+ P+HIA R G    VR+LLD++       K G  P+H  +  G  ++ +LLL+R        K G+  +H A    +L+ + LL+ +
Sbjct:  475 GHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSK 563          

HSP 11 Score: 55.0694 bits (131), Expect = 1.892e-8
Identity = 32/114 (28.07%), Postives = 54/114 (47.37%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    D   P+H A RNG   ++ +LLD    I+ + K GL PIH  +   H + ++ LL  N  I+      +  +H A+  GH    K+LL +  + + +  +  +P
Sbjct:  233 RGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTP 346          

HSP 12 Score: 49.2914 bits (116), Expect = 1.297e-6
Identity = 22/90 (24.44%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            +G  P+HIA +     V   LL    +   E   G+ P+H  +  G ++++ LL+ +   +   +K G+  +H  ++EGH+    +L+++
Sbjct:  573 NGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQ 662          

HSP 13 Score: 48.521 bits (114), Expect = 2.862e-6
Identity = 26/104 (25.00%), Postives = 49/104 (47.12%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+H+A  +    VV LL+    +     + G  P+H  S     E+   LL    +   E   G+  +H A++EG  + + LL+ ++  ++  NK  ++P
Sbjct:  540 NGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTP 643          

HSP 14 Score: 47.7506 bits (112), Expect = 4.658e-6
Identity = 28/108 (25.93%), Postives = 51/108 (47.22%), Query Frame = 1
Query:  208 KIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            K+   G  P+H+A + G   V  LLL+   N     K GL P+H    + + +++ LL+ +  +     + G   +H AS++  +E    LLQ     + ++   V+P
Sbjct:  503 KMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTP 610          
BLAST of SMED30030653 vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 74.3294 bits (181), Expect = 4.673e-15
Identity = 38/104 (36.54%), Postives = 60/104 (57.69%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA R G   +VRLLLD    I+   K  L P+H  + NGH  ++++LLD+   I+ + K G+  IH A++  H++ ++ LLQ    ID    D ++P
Sbjct:  213 NGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTP 316          

HSP 2 Score: 66.6254 bits (161), Expect = 1.843e-12
Identity = 36/109 (33.03%), Postives = 59/109 (54.13%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D +   G  P+HIA      SV +LLL+   N+    K G+ P+H  +  G+  +++LLLDR   I+   K  +  +H A+R GH+  +++LL +   I  K K+ +SP
Sbjct:  175 DVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSP 283          

HSP 3 Score: 66.2402 bits (160), Expect = 2.978e-12
Identity = 40/121 (33.06%), Postives = 60/121 (49.59%), Query Frame = 1
Query:  169 EGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G + N RA        +G  P+HIAC+      + LLL  S ++E   + GL P+H  +  GH  I+K LL R  +    +      +H A+R GH E  + LLQ   ++D K KD  +P
Sbjct:  335 KGAKANARAL-------NGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTP 448          

HSP 4 Score: 56.9954 bits (136), Expect = 3.540e-9
Identity = 32/110 (29.09%), Postives = 53/110 (48.18%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +D    D   P+H A R G   +V+LLL+   N +     G  P+H  +  GH+   ++LLD N       K G   +H A + G ++  +LLL+R    +   K+ ++P
Sbjct:  438 VDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTP 547          

HSP 5 Score: 56.225 bits (134), Expect = 6.731e-9
Identity = 28/84 (33.33%), Postives = 44/84 (52.38%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLL 483
            P+H+A R G   V + LL     ++ + K    P+H  +  GH E++KLLL+     +     G   +H A+REGH  T ++LL
Sbjct:  415 PLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILL 498          

HSP 6 Score: 56.225 bits (134), Expect = 6.987e-9
Identity = 31/99 (31.31%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA RN       +LL    N +   K G  P+H  +   +  + +LLL+R   +    K G+  +H A+R G++  ++LLL R  +ID + KD ++P
Sbjct:  152 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTP 250          

HSP 7 Score: 55.8398 bits (133), Expect = 1.062e-8
Identity = 33/114 (28.95%), Postives = 54/114 (47.37%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    D   P+H A RNG   V+ +LLD    I+ + K GL PIH  +   H + ++ LL  N  I+      +  +H A+  GH    K+LL +  + + +  +  +P
Sbjct:  236 RGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTP 349          

HSP 8 Score: 55.0694 bits (131), Expect = 1.907e-8
Identity = 28/108 (25.93%), Postives = 56/108 (51.85%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDK-----WGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+A + G   +V LL+    N+   +K       L P+H ++  GH  I  +L+ +  ++    ++G   +H A   G+++ +K LLQ++  ++CK +   +P
Sbjct:  610 GITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTP 717          

HSP 9 Score: 53.9138 bits (128), Expect = 3.721e-8
Identity = 32/112 (28.57%), Postives = 54/112 (48.21%), Query Frame = 1
Query:  151 LMNGNAEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            L++GNA+            K+   G  P+H+AC+ G   V  LLL+   N     K GL P+H    + + +++KLL+ +  +     + G   +H A+++  LE    LLQ
Sbjct:  497 LLDGNAQ----------QTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQ 598          

HSP 10 Score: 52.7582 bits (125), Expect = 9.668e-8
Identity = 32/109 (29.36%), Postives = 50/109 (45.87%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            + AE +D I  D   P+H+A   G   + ++LLD           G  P+H      H   + LLL  + ++E   + G+  +H A+  GHL  +K LLQR    +  N
Sbjct:  302 YNAE-IDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASN 409          

HSP 11 Score: 52.373 bits (124), Expect = 1.230e-7
Identity = 28/101 (27.72%), Postives = 50/101 (49.50%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            ++ + + G  P+H+A   G  ++V+ LL    +    +     P+H  +  GH E+ + LL     ++ + K     +H A+R GH E +KLLL+ K   D
Sbjct:  372 LEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPD 472          

HSP 12 Score: 52.373 bits (124), Expect = 1.400e-7
Identity = 29/95 (30.53%), Postives = 45/95 (47.37%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            D     G+ P+HIA R G     R+LLD +       K G  P+H     G  ++ +LLL+R        K G+  +H A    +L+ +KLL+ +
Sbjct:  472 DSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSK 566          

HSP 13 Score: 47.3654 bits (111), Expect = 6.016e-6
Identity = 19/85 (22.35%), Postives = 45/85 (52.94%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            P+H+  + G   +  +L+    ++    + G   +H     G+ +++K LL +   + C+ ++G   +H A+++GH + + LLL+
Sbjct:  651 PLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLK 735          
BLAST of SMED30030653 vs. Ensembl Cavefish
Match: ENSAMXT00000048191.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:3100273:3104460:1 gene:ENSAMXG00000036724.1 transcript:ENSAMXT00000048191.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 3.824e-14
Identity = 34/97 (35.05%), Postives = 55/97 (56.70%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            G   +H A ++G   +V+LLL+   ++   DK   +PIHW +  GH E++KLL+ +     C+DK G   +H A+  GH++ +K LL+    ID  N
Sbjct:  126 GRAALHHAAQSGCQEMVKLLLNKGASLSASDKKERQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPN 222          

HSP 2 Score: 56.9954 bits (136), Expect = 1.993e-9
Identity = 30/100 (30.00%), Postives = 47/100 (47.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            PIH A   G   VV+LL+    +  C+DK G  P+H  +A+GH +++K LL     I+  +  G   +H A   G       L+ R   ++  N    +P
Sbjct:  162 PIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYMGQEAVANELVNRGANVNQPNNRGYTP 261          

HSP 3 Score: 55.8398 bits (133), Expect = 4.691e-9
Identity = 31/99 (31.31%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA  N        LL    ++   D+ G   +H  + +G  E++KLLL++  ++   DK   + IH+A+  GHLE +KLL+ +     CK+K   +P
Sbjct:   97 LHIAAANRATRCADTLLPHISSLNIADRTGRAALHHAAQSGCQEMVKLLLNKGASLSASDKKERQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTP 195          
BLAST of SMED30030653 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 71.2478 bits (173), Expect = 6.653e-14
Identity = 33/91 (36.26%), Postives = 57/91 (62.64%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            P+H+A + G  ++V+LLLD    I+ + K GL P+H  + +GH +++++LLDR   I  + K G+  +H A++  HL  ++LLLQ    +D
Sbjct:  273 PLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVD 363          

HSP 2 Score: 65.0846 bits (157), Expect = 7.902e-12
Identity = 37/119 (31.09%), Postives = 64/119 (53.78%), Query Frame = 1
Query:  175 VRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            ++N+  A+   K    G  P+HIA   G  +V  LLL+    ++   +  + P+H  +  G+  ++KLLLDR   I+ + K G+  +H  +R GH + +++LL R   I  K K+ +SP
Sbjct:  224 LQNDHNADVESK---SGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSP 339          

HSP 3 Score: 61.6178 bits (148), Expect = 1.053e-10
Identity = 32/100 (32.00%), Postives = 51/100 (51.00%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD 519
            +G  P+HIAC+     V+ LLL    +++   + GL PIH  +  GH  I+K L     +    +  G   +H A+R G  + ++ LLQ   ++D K KD
Sbjct:  401 NGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKD 500          

HSP 4 Score: 58.5362 bits (140), Expect = 1.100e-9
Identity = 34/110 (30.91%), Postives = 50/110 (45.45%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +D    D    +HIA R G   +V+LLL            G  P+H     GH E   LLL+   ++    K G   +H A++ G +E  KLLLQ++   D   K  ++P
Sbjct:  494 VDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTP 603          

HSP 5 Score: 57.3806 bits (137), Expect = 2.770e-9
Identity = 32/99 (32.32%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA R        LLL    N + E K G  P+H  +  G+  +  LLL+R   ++   +  +  +H A++ G+   +KLLL R  +ID K KD ++P
Sbjct:  208 LHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTP 306          

HSP 6 Score: 56.9954 bits (136), Expect = 3.464e-9
Identity = 31/115 (26.96%), Postives = 58/115 (50.43%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            F AE  + +   G  P+H+A + G   +V LLL  + N+   +K GL P+H  +      + ++LL+    ++   K G   +H A   G+++ +  LL+ + +I+ K K   +P
Sbjct:  655 FGAE-TNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTP 768          

HSP 7 Score: 53.1434 bits (126), Expect = 7.362e-8
Identity = 33/103 (32.04%), Postives = 47/103 (45.63%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G   +H+A R G   VVR LL     ++ + K     +H  S  G +EI++LLL +          G   +H A REGH ET  LLL+    +    K   +P
Sbjct:  468 GETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTP 570          

HSP 8 Score: 53.1434 bits (126), Expect = 7.500e-8
Identity = 31/114 (27.19%), Postives = 54/114 (47.37%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H   R+G   VV +LLD    I  + K GL P+H  +   H   ++LLL  +  ++      +  +H A+  GH +  K+++ +K   + K  +  +P
Sbjct:  292 RGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTP 405          

HSP 9 Score: 51.6026 bits (122), Expect = 2.298e-7
Identity = 25/104 (24.04%), Postives = 49/104 (47.12%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA +     +   LL+         + G+ P+H  +  G  +++ LLL +N  +   +K G+  +H A++E  +   ++LL     +D   K   +P
Sbjct:  632 NGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTP 735          

HSP 10 Score: 50.8322 bits (120), Expect = 4.766e-7
Identity = 24/91 (26.37%), Postives = 46/91 (50.55%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRK 492
            +G  P+H+A +     V  +LL+    ++   K G  P+H     G+ +++  LL+    I  + K G   +H A+++GH   + +LLQ +
Sbjct:  698 NGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHR 788          
BLAST of SMED30030653 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 6.669e-16
Identity = 36/110 (32.73%), Postives = 66/110 (60.00%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +++  + G  P+HIA   G  +V  LLL+L   ++   + G+ P+H  +  G++ ++KLLLDR   I+ + + G+  +H A+R GH + +++LL+R   I  K K+ +SP
Sbjct:  205 LNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSP 314          

HSP 2 Score: 72.4034 bits (176), Expect = 4.687e-15
Identity = 40/128 (31.25%), Postives = 73/128 (57.03%), Query Frame = 1
Query:  148 HLMNGNAEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            H  N N   +  N  A  +D    +G  P+H+A + G  ++V+LLLD    I+ + + GL P+H  + +GH +++++LL+R+  I  + K G+  +H A++  HL  ++LLL R+  +D    D ++P
Sbjct:  221 HYGNMNVATLLLNLGAA-VDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTP 347          

HSP 3 Score: 68.5514 bits (166), Expect = 1.009e-13
Identity = 37/104 (35.58%), Postives = 54/104 (51.92%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     V+ LLL    +I    + GL PIH  S  GH  +++LLL    +    +  G   +H ASR G LE +K LLQ   R+  K ++  +P
Sbjct:  376 NGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTP 479          

HSP 4 Score: 60.4622 bits (145), Expect = 4.937e-11
Identity = 34/100 (34.00%), Postives = 51/100 (51.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+HIA R G   +V+LLL    +       G  P+++ S  GH ++  LLL+    I    K G   +H AS+ G LE   LLL++    D K K+ ++P
Sbjct:  479 PLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTP 578          

HSP 5 Score: 56.6102 bits (135), Expect = 9.098e-10
Identity = 27/99 (27.27%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            +G  P+HIA +     V ++LL+L        + G+ P+H  +  GH++++ LLL R+ +I    K G+  +H A++E  +   ++L + K  ++   K
Sbjct:  607 NGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTK 705          

HSP 6 Score: 55.4546 bits (132), Expect = 2.084e-9
Identity = 42/140 (30.00%), Postives = 59/140 (42.14%), Query Frame = 1
Query:  121 MGDFQCFKEHLMNG---NAEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            MG     +  L NG   NA  VR              G  P+H+A R G   VV+ LL     +  + +    P+H  S  G +EI++LLL R          G   +++ASREGH +   LLL+    I    K   +P
Sbjct:  420 MGHLNVVQLLLQNGASSNATNVR--------------GETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTP 545          

HSP 7 Score: 53.9138 bits (128), Expect = 8.965e-9
Identity = 32/101 (31.68%), Postives = 52/101 (51.49%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDR--NCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            R   +D     GN  +HIA   G   +VR+L++   NI  + + G  P++  +   H EI+K LLD   N ++  ED  G   +  A ++GH + + LLL+
Sbjct:   65 REAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATED--GFTPLAVALQQGHEQVVGLLLE 163          

HSP 8 Score: 53.5286 bits (127), Expect = 1.011e-8
Identity = 32/100 (32.00%), Postives = 48/100 (48.00%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            R   +D    DG  P+H A R+G   V+ +LL+    I  + K GL P+H  +   H   ++LLL R   ++      +  +H A+  GH    KLLL R
Sbjct:  267 RGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDR 366          

HSP 9 Score: 52.7582 bits (125), Expect = 1.797e-8
Identity = 31/107 (28.97%), Postives = 53/107 (49.53%), Query Frame = 1
Query:  211 IVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +   G  P+HIA + G   V  LLL+   + + + K GL P+H  +   H ++  LLLD+  +     K G   +H A+++  LE  K+LL+     +   +  V+P
Sbjct:  538 VTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAP 644          

HSP 10 Score: 52.7582 bits (125), Expect = 1.918e-8
Identity = 31/91 (34.07%), Postives = 46/91 (50.55%), Query Frame = 1
Query:  217 DDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            + G  PIH+A   G  +VV+LLL    +    +  G  P+H  S  G  E++K LL     +  + +     +H ASR G  E ++LLLQR
Sbjct:  408 ESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQR 498          

HSP 11 Score: 48.521 bits (114), Expect = 5.139e-7
Identity = 28/89 (31.46%), Postives = 45/89 (50.56%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            G+ P++ A R G   V  LLL+   +I    K G  P+H  S  G  E+  LLL++  + + + K G+  +H A+   H +   LLL +
Sbjct:  509 GSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDK 597          

HSP 12 Score: 46.9802 bits (110), Expect = 1.549e-6
Identity = 29/99 (29.29%), Postives = 45/99 (45.45%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            +G  P+H+A       V  LLLD   +     K G  P+H  +     E+ K+LL+         + G+  +H A++EGH + + LLL R   I    K
Sbjct:  574 NGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATK 672          

HSP 13 Score: 45.4394 bits (106), Expect = 4.527e-6
Identity = 25/107 (23.36%), Postives = 49/107 (45.79%), Query Frame = 1
Query:  211 IVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +   G  P+H+A + G   +V LLL    +I    K GL  +H  +      + ++L      +    KL    +H AS  G+++ +  LL+ +  ++ K ++  +P
Sbjct:  637 LTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTP 743          
BLAST of SMED30030653 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 3.228e-15
Identity = 37/109 (33.94%), Postives = 63/109 (57.80%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D     G  P+HIA   G  +V  LLL+L   ++   + G+ P+H  +  G++ ++KLLLDR   I+ + + G+  +H A+R GH + +++LL+R   I  K K+ +SP
Sbjct:  199 DVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSP 307          

HSP 2 Score: 72.4034 bits (176), Expect = 4.624e-15
Identity = 40/128 (31.25%), Postives = 73/128 (57.03%), Query Frame = 1
Query:  148 HLMNGNAEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            H  N N   +  N  A  +D    +G  P+H+A + G  ++V+LLLD    I+ + + GL P+H  + +GH +++++LL+R+  I  + K G+  +H A++  HL  ++LLL R+  +D    D ++P
Sbjct:  214 HYGNMNVATLLLNLGAA-VDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTP 340          

HSP 3 Score: 68.5514 bits (166), Expect = 9.957e-14
Identity = 37/104 (35.58%), Postives = 54/104 (51.92%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     V+ LLL    +I    + GL PIH  S  GH  +++LLL    +    +  G   +H ASR G LE +K LLQ   R+  K ++  +P
Sbjct:  369 NGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTP 472          

HSP 4 Score: 56.6102 bits (135), Expect = 8.985e-10
Identity = 27/99 (27.27%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            +G  P+HIA +     V ++LL+L        + G+ P+H  +  GH++++ LLL R+ +I    K G+  +H A++E  +   ++L + K  ++   K
Sbjct:  602 NGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTK 700          

HSP 5 Score: 55.8398 bits (133), Expect = 1.677e-9
Identity = 32/93 (34.41%), Postives = 46/93 (49.46%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCK 510
            P+HIA R G   +V+LLL    +       G  P+++ S  GH ++  LLL+    I    K G   +H AS+ G LE   LLL++    D K
Sbjct:  472 PLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPK 564          

HSP 6 Score: 55.8398 bits (133), Expect = 1.946e-9
Identity = 30/99 (30.30%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA R    +   LLL    N +   K G  P+H  +  G+  +  LLL+    ++   + G+  +H A++ G+   +KLLL R  +ID K +D ++P
Sbjct:  176 LHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTP 274          

HSP 7 Score: 55.4546 bits (132), Expect = 2.058e-9
Identity = 42/140 (30.00%), Postives = 59/140 (42.14%), Query Frame = 1
Query:  121 MGDFQCFKEHLMNG---NAEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            MG     +  L NG   NA  VR              G  P+H+A R G   VV+ LL     +  + +    P+H  S  G +EI++LLL R          G   +++ASREGH +   LLL+    I    K   +P
Sbjct:  413 MGHLNVVQLLLQNGASSNATNVR--------------GETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTP 538          

HSP 8 Score: 53.9138 bits (128), Expect = 8.856e-9
Identity = 32/101 (31.68%), Postives = 52/101 (51.49%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDR--NCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            R   +D     GN  +HIA   G   +VR+L++   NI  + + G  P++  +   H EI+K LLD   N ++  ED  G   +  A ++GH + + LLL+
Sbjct:   66 REAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATED--GFTPLAVALQQGHEQVVGLLLE 164          

HSP 9 Score: 53.5286 bits (127), Expect = 9.992e-9
Identity = 32/100 (32.00%), Postives = 48/100 (48.00%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            R   +D    DG  P+H A R+G   V+ +LL+    I  + K GL P+H  +   H   ++LLL R   ++      +  +H A+  GH    KLLL R
Sbjct:  260 RGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDR 359          

HSP 10 Score: 52.7582 bits (125), Expect = 1.895e-8
Identity = 31/91 (34.07%), Postives = 46/91 (50.55%), Query Frame = 1
Query:  217 DDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            + G  PIH+A   G  +VV+LLL    +    +  G  P+H  S  G  E++K LL     +  + +     +H ASR G  E ++LLLQR
Sbjct:  401 ESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQR 491          

HSP 11 Score: 48.9062 bits (115), Expect = 4.111e-7
Identity = 31/109 (28.44%), Postives = 53/109 (48.62%), Query Frame = 1
Query:  211 IVDDGNFPIHIACRNGFFSVVRLLLD--LSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +   G  P+HIA + G   V  LLL+   S + +   + GL P+H  +   H ++  LLLD+  +     K G   +H A+++  LE  K+LL+     +   +  V+P
Sbjct:  531 VTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAP 639          

HSP 12 Score: 46.9802 bits (110), Expect = 1.531e-6
Identity = 29/99 (29.29%), Postives = 45/99 (45.45%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            +G  P+H+A       V  LLLD   +     K G  P+H  +     E+ K+LL+         + G+  +H A++EGH + + LLL R   I    K
Sbjct:  569 NGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATK 667          

HSP 13 Score: 45.4394 bits (106), Expect = 4.477e-6
Identity = 25/107 (23.36%), Postives = 49/107 (45.79%), Query Frame = 1
Query:  211 IVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +   G  P+H+A + G   +V LLL    +I    K GL  +H  +      + ++L      +    KL    +H AS  G+++ +  LL+ +  ++ K ++  +P
Sbjct:  632 LTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTP 738          
BLAST of SMED30030653 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 2.226e-12
Identity = 35/97 (36.08%), Postives = 49/97 (50.52%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            G   +H A  NG   +V  L+    NI   DK   R IHW +  GH+E++K+L+     + C+DK G   +H AS  G +  +KLLL     ID  N
Sbjct:  138 GRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPN 234          

HSP 2 Score: 60.077 bits (144), Expect = 7.416e-11
Identity = 30/100 (30.00%), Postives = 50/100 (50.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A  N        ++ +  +    D+ G   +H  + NGHSE++  L+ +   I   DK   R IH+A+  GH E +K+L+     + CK+K   SP
Sbjct:  108 PLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSP 207          

HSP 3 Score: 51.6026 bits (122), Expect = 4.225e-8
Identity = 34/114 (29.82%), Postives = 53/114 (46.49%), Query Frame = 1
Query:  157 NGNAEGVR----NNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            NG+ E +R    N    E +D    +   P+ +A  NG      LLL    +I  +D  G   +H  +A GH E + LLL R+  +   ++ G   +H A+  GH+  L  L+Q
Sbjct:  660 NGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQ 773          

HSP 4 Score: 50.0618 bits (118), Expect = 1.643e-7
Identity = 30/104 (28.85%), Postives = 53/104 (50.96%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGH-LETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H A  +G   VV+LLLDL  +I+  + +G   +H    NG   ++  L+D    +   ++ G   +H+A+   H    L+LL+     ++ ++KD  SP
Sbjct:  204 GYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSP 307          

HSP 5 Score: 50.0618 bits (118), Expect = 1.785e-7
Identity = 30/107 (28.04%), Postives = 49/107 (45.79%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLL---DLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D    +H A  NG    +RLL+   D +  ++  D     P+     NGH++   LLL +  +I  +D  G   +H  +  GH E + LLLQR   +  + +   +P
Sbjct:  649 DRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAP 755          

HSP 6 Score: 47.7506 bits (112), Expect = 9.707e-7
Identity = 25/75 (33.33%), Postives = 39/75 (52.00%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGH 459
            IH A   G   VV++L+    ++ C+DK G  P+H  S++G   ++KLLLD    I+  +  G   +H A   G 
Sbjct:  175 IHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQ 249          

HSP 7 Score: 45.4394 bits (106), Expect = 4.919e-6
Identity = 31/106 (29.25%), Postives = 49/106 (46.23%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDR--NCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+H AC NG    V LLL+L    + ++     P+H    N +    ++L+D      I C D  G   +H A+   H+E L+LLL     ++  +    SP
Sbjct:  788 NGYTPLHWACYNGHDGCVELLLELDV-FQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSP 892          
BLAST of SMED30030653 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007954.1 (pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gene:ENSPMAG00000007165.1 transcript:ENSPMAT00000007954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 5.204e-12
Identity = 35/106 (33.02%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSPGFG 540
            G   +H A  NG   +V LL+    N+   DK   R +HW    GH+E++K+LL     +  +DK G   +H A+  GH+  ++LLL  K  ++  N      GFG
Sbjct:   47 GRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFN------GFG 146          

HSP 2 Score: 57.7658 bits (138), Expect = 4.119e-10
Identity = 29/100 (29.00%), Postives = 50/100 (50.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A  N        L+ L  N+   D+ G   +H  + NG+ E++ LL+ +   +   DK   R +H+A   GH E +K+LL     ++ K+K   +P
Sbjct:   17 PLHVASANRAIKCADALIPLLSNVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTP 116          
BLAST of SMED30030653 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 5.605e-12
Identity = 38/125 (30.40%), Postives = 60/125 (48.00%), Query Frame = 1
Query:  160 GNAEGVRNNFR-AEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  E VR+  R    +D    +   P+HIA R G   +V+LLL    + +     G  P+H  +  GH ++  +LL+   ++    K G   +H AS+ G +E   LLLQR    D   K+ ++P
Sbjct:   92 GQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTP 216          

HSP 2 Score: 56.9954 bits (136), Expect = 7.825e-10
Identity = 31/104 (29.81%), Postives = 54/104 (51.92%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIAC+     V+ LLL    +IE   + GL P+H  +  G+  I+ +LL    +    +  G   +H A+R G  E ++ LL+   ++D K ++  +P
Sbjct:   14 NGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTP 117          

HSP 3 Score: 50.0618 bits (118), Expect = 1.619e-7
Identity = 31/109 (28.44%), Postives = 49/109 (44.95%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D    +G  P+H+A R G   V  +LL+   ++    K G  P+H  S  G  E+  LLL R  + +   K G+  +H AS   + +   LLL +        K+  +P
Sbjct:  141 DAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTP 249          

HSP 4 Score: 48.521 bits (114), Expect = 5.614e-7
Identity = 23/99 (23.23%), Postives = 47/99 (47.47%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            +G  P+HIA +     +   LL+         + G+ P+H  +  GH+++  LLL R   +    K G+  +H A++E  +   ++L++    ++   K
Sbjct:  245 NGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTK 343          

HSP 5 Score: 48.1358 bits (113), Expect = 7.817e-7
Identity = 29/103 (28.16%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G   +H+A R G   VVR LL     ++ + +    P+H  +  G  EI++LLL    + +     G   +H A+REGH +   +LL+    +    K   +P
Sbjct:   81 GETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTP 183          

HSP 6 Score: 46.595 bits (109), Expect = 2.508e-6
Identity = 29/103 (28.16%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+A + G   V  LLL    + +   K GL P+H  S   + ++  LLLD+  +     K G   +H A+++  LE    LL+     +   +  V+P
Sbjct:  180 GFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAP 282          

HSP 7 Score: 45.8246 bits (107), Expect = 4.345e-6
Identity = 29/104 (27.88%), Postives = 45/104 (43.27%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+H+A       V  LLLD   +     K G  P+H  +     EI   LL+         + G+  +H  ++EGH +   LLL R   ++   K  +SP
Sbjct:  212 NGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSP 315          

HSP 8 Score: 45.4394 bits (106), Expect = 4.761e-6
Identity = 26/109 (23.85%), Postives = 48/109 (44.04%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            + I   G  P+H+  + G   V  LLL    ++    K GL P+H  +      + ++L+     +    KLG   +  A   G+++ +  LLQ    ++ K K+  +P
Sbjct:  273 NAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTP 381          
BLAST of SMED30030653 vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 46.2098 bits (108), Expect = 1.759e-6
Identity = 27/87 (31.03%), Postives = 45/87 (51.72%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDK-WGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            P+++ACR  FF     LL    ++E  +K +G   I   +A G ++I+KLL+  N   + ED+ G   + +A   GHL    ++  R
Sbjct:  542 PLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMVQIR 628          
BLAST of SMED30030653 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 45.0542 bits (105), Expect = 2.134e-6
Identity = 31/98 (31.63%), Postives = 44/98 (44.90%), Query Frame = 1
Query:  223 GNFPIHIAC-RNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTI---ECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
             N+P+H AC  N FF V  LL      +  +D+ G  P+HW  +    EI   LL +   +   +  D  G    H A   G+LE +K L  R  + D
Sbjct:    2 SNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPD 99          
BLAST of SMED30030653 vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 44.2838 bits (103), Expect = 7.360e-6
Identity = 23/59 (38.98%), Postives = 33/59 (55.93%), Query Frame = 1
Query:  313 DKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            +KW   PI +   +GHSE++  LL  N  ++ ED  G   + YA  E H++ L  LLQR
Sbjct:  591 NKW--TPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQR 647          
BLAST of SMED30030653 vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 64.6994 bits (156), Expect = 3.175e-12
Identity = 36/97 (37.11%), Postives = 54/97 (55.67%), Query Frame = 1
Query:  217 DDG--NFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRI 501
            +DG  N P+H+A  +G  +VV+ LL     I+  +     P+   +A G  E+  +LLD +  ++  DK     +H ASREGH+E +KLLL RK  I
Sbjct:  313 EDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANI 409          

HSP 2 Score: 47.7506 bits (112), Expect = 1.317e-6
Identity = 26/79 (32.91%), Postives = 34/79 (43.04%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLET 468
            P+  A   G   V  +LLD    ++  DK    P+H  S  GH E++KLLL R   I   D  G   +  A    H E 
Sbjct:  353 PLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEV 431          
BLAST of SMED30030653 vs. Ensembl Nematostella
Match: EDO34823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNB2])

HSP 1 Score: 57.7658 bits (138), Expect = 1.745e-10
Identity = 37/112 (33.04%), Postives = 57/112 (50.89%), Query Frame = 1
Query:  193 AEFMDKIVDDGNFPIHIACRNGFFSVVRLL--LDLSCNIECEDKWGLRPIHWLSANGHSEILKLL-LDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD 519
            A  +++   DG  P+++A ++G F  ++ L  +   CNI   D  G+ PIH  + NGH + L  L +    ++   D+ G    HYA+ +GHL  LK L     R D K KD
Sbjct:   22 ASSVNESATDGTTPLYLAAQDGNFDCLKFLHGVGAKCNITSRD--GMHPIHAAAQNGHLDCLGYLAIHGRVSMTERDRTGATPAHYAAGQGHLSVLKWL---NVRCDVKIKD 128          

HSP 2 Score: 24.2534 bits (51), Expect = 1.745e-10
Identity = 11/25 (44.00%), Postives = 16/25 (64.00%), Query Frame = 2
Query:  527 PLDLAKQYSRVDCVELL--AHMKKV 595
            P+DLA++Y  V C E +  AH K +
Sbjct:  168 PIDLAERYGHVTCHEYMKTAHAKNL 192          
BLAST of SMED30030653 vs. Ensembl Nematostella
Match: EDO28732 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5M7])

HSP 1 Score: 54.299 bits (129), Expect = 3.379e-10
Identity = 26/82 (31.71%), Postives = 40/82 (48.78%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKL 477
            PIH AC N     ++ LL+       +D+ G +P+H+   NGHS +   LL      +  D  G   +HYA+  G +  L+L
Sbjct:    1 PIHAACINPNAKYLKQLLNSVPEYNIQDRAGFKPVHYAIKNGHSPVAAYLLRLGVNPDSSDTSGNTTVHYAAAYGWIHCLRL 82          
BLAST of SMED30030653 vs. Ensembl Nematostella
Match: EDO46099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR35])

HSP 1 Score: 53.9138 bits (128), Expect = 1.970e-9
Identity = 29/99 (29.29%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQ---IHYASREGHLE-TLKLLLQRKCRIDCKNKD 519
            +H A R G    + LLL     +    ++G RPIH  + NGH+E +++LL        +    +R    +HYA+R GHL+  +++L++R   ++   +D
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRD 99          

HSP 2 Score: 45.0542 bits (105), Expect = 2.836e-6
Identity = 36/122 (29.51%), Postives = 55/122 (45.08%), Query Frame = 1
Query:  130 FQCFKEHLMNGNAEGVRNNFR----AEFMDKIVDDGNFPIHIACRNGFFS-VVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECED-KLGMRQIHYASREGHLETLKL 477
            ++   E  MNG+ E VR   R    A            P+H A R G     VR+L++   ++E   + G R IH  S NG  ++L  LLD    IE +  +  +  +H A+R+G +    L
Sbjct:   31 WRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          
BLAST of SMED30030653 vs. Ensembl Nematostella
Match: EDO45485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSW0])

HSP 1 Score: 49.6766 bits (117), Expect = 1.400e-8
Identity = 23/56 (41.07%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  322 GLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            G  P+H     GH EI+KLLLD    +E + K G + +H A++ GH   +++LLQR
Sbjct:    1 GFTPLHIAVVYGHWEIVKLLLDEGADVEAQTKNGYQPLHLAAQYGHKIIIEILLQR 56          

HSP 2 Score: 48.1358 bits (113), Expect = 4.495e-8
Identity = 22/56 (39.29%), Postives = 35/56 (62.50%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDR 390
            G  P+HIA   G + +V+LLLD   ++E + K G +P+H  +  GH  I+++LL R
Sbjct:    1 GFTPLHIAVVYGHWEIVKLLLDEGADVEAQTKNGYQPLHLAAQYGHKIIIEILLQR 56          
BLAST of SMED30030653 vs. Ensembl Medaka
Match: ENSORLT00000039903.1 (pep primary_assembly:ASM223467v1:15:18469388:18484014:-1 gene:ENSORLG00000030042.1 transcript:ENSORLT00000039903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 1.047e-15
Identity = 37/105 (35.24%), Postives = 63/105 (60.00%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            RA  +D +  +   P+H+A + G  ++V+LLLD    IE + K GL P+H  + +GH +++++LLDR   I  + K G+  +H A++  HL  ++LLLQ    +D
Sbjct:  233 RAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVD 337          

HSP 2 Score: 71.633 bits (174), Expect = 3.542e-14
Identity = 39/119 (32.77%), Postives = 66/119 (55.46%), Query Frame = 1
Query:  175 VRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            ++N+  A+   K    G  P+HIA   G  +V  LLL+ +  ++   +  + P+H  +  G+S ++KLLLDR   IE + K G+  +H  +R GH + +++LL R   I  K K+ +SP
Sbjct:  198 LQNDHNADVESK---SGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSP 313          

HSP 3 Score: 60.4622 bits (145), Expect = 1.811e-10
Identity = 32/99 (32.32%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA R        LLL    N + E K G  P+H  +  G+  +  LLL+R   ++   +  +  +H A++ G+   +KLLL R  RI+ K KD ++P
Sbjct:  182 LHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTP 280          

HSP 4 Score: 54.6842 bits (130), Expect = 1.719e-8
Identity = 31/114 (27.19%), Postives = 54/114 (47.37%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   ++    DG  P+H   R+G   VV +LLD    I  + K GL P+H  +   H   ++LLL  +  ++      +  +H A+  GH +  KL++ +K   + K  +  +P
Sbjct:  266 RGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTP 379          

HSP 5 Score: 48.9062 bits (115), Expect = 1.425e-6
Identity = 23/99 (23.23%), Postives = 47/99 (47.47%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCR 498
            +D     GN  +HI+   G   VV  L+    N+  + + G  P++  +   H E+++ LL+ + +     + G   +  A ++GH + + LLL+   +
Sbjct:   76 VDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK 174          

HSP 6 Score: 48.1358 bits (113), Expect = 2.956e-6
Identity = 24/104 (23.08%), Postives = 46/104 (44.23%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D + +D    +H+A   G + V +L++D   N   +   G  P+H         +++LLL    +I+   + G+  IH A+  GH   +  L+      +  N
Sbjct:  336 VDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGASPNTTN 439          

HSP 7 Score: 47.3654 bits (111), Expect = 5.383e-6
Identity = 27/104 (25.96%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+++A +     VVR LL+ S +     + G  P+      GH +++ LLL+     + + K+ +  +H A+R+   +   LLLQ     D ++K   +P
Sbjct:  115 NGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTP 214          
BLAST of SMED30030653 vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 73.559 bits (179), Expect = 8.354e-15
Identity = 38/104 (36.54%), Postives = 60/104 (57.69%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+HIA R G   +VRLLLD    I+ + K  L P+H  + NGH  I+++LL+    I+ + K G+  IH A++  H++ ++ LLQ    ID    D ++P
Sbjct:  236 NGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTP 339          

HSP 2 Score: 69.3218 bits (168), Expect = 2.755e-13
Identity = 37/109 (33.94%), Postives = 60/109 (55.05%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            D +   G  P+HIA      SV +LLL+   N+    K G+ P+H  S  G+  +++LLLDR   I+ + K  +  +H A+R GH+  +++LL+    I  K K+ +SP
Sbjct:  198 DVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSP 306          

HSP 3 Score: 66.6254 bits (161), Expect = 2.089e-12
Identity = 40/121 (33.06%), Postives = 60/121 (49.59%), Query Frame = 1
Query:  169 EGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G + N RA        +G  P+HIAC+      + LLL  S ++E   + GL P+H  +  GH  I+K LL R  +    +      +H ASR GH E  + LLQ   ++D + KD  +P
Sbjct:  358 KGAKANARAL-------NGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTP 471          

HSP 4 Score: 61.2326 bits (147), Expect = 1.312e-10
Identity = 29/84 (34.52%), Postives = 46/84 (54.76%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLL 483
            P+H+A R G   V + LL  +  ++   K    P+H  +  GH E++KLLLD     +     G   +H A+REGH+ T+++LL
Sbjct:  438 PLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILL 521          

HSP 5 Score: 57.7658 bits (138), Expect = 1.899e-9
Identity = 32/99 (32.32%), Postives = 52/99 (52.53%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA RN       +LL    N +   K G  P+H  +   +  + +LLL+R   +    K G+  +H ASR G++  ++LLL R  +ID + KD ++P
Sbjct:  175 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTP 273          

HSP 6 Score: 57.7658 bits (138), Expect = 2.397e-9
Identity = 27/103 (26.21%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  P+H+A + G   +V +L+    N+   +K GL P+H ++  GH  I   L+ +  ++    ++G   +H A   G+++ +K LLQ++  ++ K +   +P
Sbjct:  633 GITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTP 735          

HSP 7 Score: 57.7658 bits (138), Expect = 2.420e-9
Identity = 33/110 (30.00%), Postives = 53/110 (48.18%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +D    D   P+H A R G   +V+LLLD   N +     G  P+H  +  GH   +++LLD         K G   +H AS+ G ++  +LLL+R    +   K+ ++P
Sbjct:  461 VDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTP 570          

HSP 8 Score: 56.225 bits (134), Expect = 7.398e-9
Identity = 30/95 (31.58%), Postives = 46/95 (48.42%), Query Frame = 1
Query:  205 DKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            D     G+ P+HIA R G    +R+LLD         K G  P+H  S  G  ++ +LLL+R        K G+  +H A    +L+ +KLL+ +
Sbjct:  495 DSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSK 589          

HSP 9 Score: 53.9138 bits (128), Expect = 3.760e-8
Identity = 26/104 (25.00%), Postives = 53/104 (50.96%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  P+H+A  +    VV+LL+    +     + G  P+H  +     E+  +LL    +  CE   G+  +H AS+EG  + + +L+ ++  ++  NK+ ++P
Sbjct:  566 NGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTP 669          

HSP 10 Score: 53.9138 bits (128), Expect = 4.611e-8
Identity = 28/108 (25.93%), Postives = 54/108 (50.00%), Query Frame = 1
Query:  208 KIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            K+   G  P+H+A + G   V  LLL+   N     K GL P+H    + + +++KLL+ +  +     + G   +H A+++  +E   +LLQ     +C++   ++P
Sbjct:  529 KMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITP 636          

HSP 11 Score: 53.1434 bits (126), Expect = 7.397e-8
Identity = 31/114 (27.19%), Postives = 54/114 (47.37%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    D   P+H A RNG   ++ +LL+    I+ + K GL PIH  +   H + ++ LL  N  I+      +  +H A+  GH    K+LL +  + + +  +  +P
Sbjct:  259 RGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTP 372          

HSP 12 Score: 52.7582 bits (125), Expect = 1.023e-7
Identity = 29/101 (28.71%), Postives = 48/101 (47.52%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            ++ + + G  P+H+A   G  ++V+ LL    +    +     P+H  S  GH E+ + LL     ++   K     +H A+R GH E +KLLL  K   D
Sbjct:  395 LEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPD 495          

HSP 13 Score: 52.373 bits (124), Expect = 1.338e-7
Identity = 32/109 (29.36%), Postives = 50/109 (45.87%), Query Frame = 1
Query:  187 FRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            + AE +D I  D   P+H+A   G   + ++LLD           G  P+H      H   + LLL  + ++E   + G+  +H A+  GHL  +K LLQR    +  N
Sbjct:  325 YNAE-IDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASN 432          

HSP 14 Score: 51.6026 bits (122), Expect = 2.485e-7
Identity = 23/90 (25.56%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQR 489
            +G  P+HIA +     V  +LL    +  CE   G+ P+H  S  G  +++ +L+ +   +   +K G+  +H  ++EGH+     L+++
Sbjct:  599 NGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQ 688          

HSP 15 Score: 47.7506 bits (112), Expect = 4.281e-6
Identity = 27/104 (25.96%), Postives = 49/104 (47.12%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +G  PIH+A +      VR LL  +  I+      L P+H  +  GH  + K+LLD+          G   +H A ++ H+ ++ LLL+    ++   +  ++P
Sbjct:  302 NGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTP 405          

HSP 16 Score: 46.9802 bits (110), Expect = 8.519e-6
Identity = 20/89 (22.47%), Postives = 46/89 (51.69%), Query Frame = 1
Query:  220 DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            +G  P+H+  + G   +   L+    ++    + G  P+H     G+ +++K LL +   +  + ++G   +H A+++GH + + LLL+
Sbjct:  665 NGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLK 753          
BLAST of SMED30030653 vs. Ensembl Medaka
Match: ENSORLT00000006308.2 (pep primary_assembly:ASM223467v1:1:12516834:12530692:1 gene:ENSORLG00000005003.2 transcript:ENSORLT00000006308.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 8.761e-15
Identity = 35/105 (33.33%), Postives = 60/105 (57.14%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRID 504
            R   +D    +G  P+H+A + G  ++V LLLD    I+ + + GL P+H  + +GH   ++LLL+R   I    K G+  +H +++  H+E +KLLLQ +  +D
Sbjct:  203 RGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVD 307          

HSP 2 Score: 71.633 bits (174), Expect = 3.121e-14
Identity = 38/119 (31.93%), Postives = 66/119 (55.46%), Query Frame = 1
Query:  175 VRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            ++N+  A+   K    G  P+HIA   G  +V  LLL+    ++   + G+ P+H  S  G++ ++ LLLDR   I+ + + G+  +H A+R GH   ++LLL+R   I  + K+ +SP
Sbjct:  168 LQNDHNADVQSK---SGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSP 283          

HSP 3 Score: 61.2326 bits (147), Expect = 9.575e-11
Identity = 31/99 (31.31%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            +HIA R        LLL    N + + K G  P+H  +  G+  +  LLL+R   ++   + G+  +H AS+ G+   + LLL R  +ID K +D ++P
Sbjct:  152 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTP 250          

HSP 4 Score: 56.6102 bits (135), Expect = 4.305e-9
Identity = 34/114 (29.82%), Postives = 52/114 (45.61%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            R   +D    DG  P+H A R+G    V LLL+    I    K GL P+H  +   H E +KLLL     ++      +  +H A+  GH    K+LL +K   + +  +  +P
Sbjct:  236 RGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKANPNARALNGFTP 349          

HSP 5 Score: 53.5286 bits (127), Expect = 3.611e-8
Identity = 29/104 (27.88%), Postives = 49/104 (47.12%), Query Frame = 1
Query:  202 MDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            +D +  D    +H+A   G + V ++LLD   N       G  P+H        ++++LL+    +I+   + G+  IH A+  GHL  + LLLQ     D +N
Sbjct:  306 VDDVTLDYLTALHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVRN 409          

HSP 6 Score: 53.1434 bits (126), Expect = 5.914e-8
Identity = 30/118 (25.42%), Postives = 55/118 (46.61%), Query Frame = 1
Query:  196 EFMDKIVD------DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            EF+   VD      +G   +H+A + G   +V  LL     ++   K G   +H  S  G  E++KLL+ R   +  + + G   ++ A++E HLE ++  L+ +       +D  +P
Sbjct:    5 EFLKNGVDISTCNQNGLNALHLAAKEGHKDLVEELLQRGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATEDGFTP 122          

HSP 7 Score: 50.0618 bits (118), Expect = 5.594e-7
Identity = 28/105 (26.67%), Postives = 50/105 (47.62%), Query Frame = 1
Query:  190 RAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDR--NCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCR 498
            R   +D     GN  +HIA   G   VV+LL+    ++  + + G  P++  +   H E+++  L+   N +I  ED  G   +  A ++GH   + LLL+   +
Sbjct:   42 RGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATED--GFTPLAIALQQGHNSVVSLLLEHDTK 144          
BLAST of SMED30030653 vs. Ensembl Medaka
Match: ENSORLT00000028696.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A [Source:NCBI gene;Acc:101168382])

HSP 1 Score: 73.559 bits (179), Expect = 1.030e-14
Identity = 36/100 (36.00%), Postives = 55/100 (55.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A  N        L+    N+   D+ G   +H  + +GH+E+++LLL R   I   DK   R IH+A+  GHLE +KLL++    +DCK+K   SP
Sbjct:  110 PLHVAASNKAVRCAEALVPQLSNVNVSDRAGRTALHHAAFSGHTEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHLEVVKLLVESGAEVDCKDKKGYSP 209          

HSP 2 Score: 62.3882 bits (150), Expect = 5.161e-11
Identity = 33/87 (37.93%), Postives = 47/87 (54.02%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLL 483
            G   +H A  +G   +VRLLL    NI   DK   R IHW +  GH E++KLL++    ++C+DK G   +H A+  G   T+  LL
Sbjct:  140 GRTALHHAAFSGHTEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHLEVVKLLVESGAEVDCKDKKGYSPLHAAASSGMSSTVHYLL 226          

HSP 3 Score: 53.1434 bits (126), Expect = 7.313e-8
Identity = 35/115 (30.43%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  154 MNGNAEGVR----NNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            MNG+AE +R    N+ +   +D     G  P+ +A  +G    V  LL    ++E +D WG   +H  +  G  + ++ LL R   +  +D  G   +H AS  GH+  L  LLQ
Sbjct:  617 MNGHAECLRLLLSNDNQHMNIDTQDSSGQTPLMLAVLSGHIECVYSLLSHGASVEFQDCWGRTALHRGAVTGQEDCVEALLQRQAGVCVKDTRGRTPLHLASACGHVGVLGALLQ 731          
BLAST of SMED30030653 vs. Ensembl Medaka
Match: ENSORLT00000037670.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A [Source:NCBI gene;Acc:101168382])

HSP 1 Score: 73.559 bits (179), Expect = 1.032e-14
Identity = 36/100 (36.00%), Postives = 55/100 (55.00%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            P+H+A  N        L+    N+   D+ G   +H  + +GH+E+++LLL R   I   DK   R IH+A+  GHLE +KLL++    +DCK+K   SP
Sbjct:  110 PLHVAASNKAVRCAEALVPQLSNVNVSDRAGRTALHHAAFSGHTEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHLEVVKLLVESGAEVDCKDKKGYSP 209          

HSP 2 Score: 62.3882 bits (150), Expect = 5.120e-11
Identity = 33/87 (37.93%), Postives = 47/87 (54.02%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLL 483
            G   +H A  +G   +VRLLL    NI   DK   R IHW +  GH E++KLL++    ++C+DK G   +H A+  G   T+  LL
Sbjct:  140 GRTALHHAAFSGHTEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHLEVVKLLVESGAEVDCKDKKGYSPLHAAASSGMSSTVHYLL 226          

HSP 3 Score: 53.1434 bits (126), Expect = 7.391e-8
Identity = 35/115 (30.43%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  154 MNGNAEGVR----NNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQ 486
            MNG+AE +R    N+ +   +D     G  P+ +A  +G    V  LL    ++E +D WG   +H  +  G  + ++ LL R   +  +D  G   +H AS  GH+  L  LLQ
Sbjct:  626 MNGHAECLRLLLSNDNQHMNIDTQDSSGQTPLMLAVLSGHIECVYSLLSHGASVEFQDCWGRTALHRGAVTGQEDCVEALLQRQAGVCVKDTRGRTPLHLASACGHVGVLGALLQ 740          
BLAST of SMED30030653 vs. Planmine SMEST
Match: SMESG000043462.1 (SMESG000043462.1)

HSP 1 Score: 204.912 bits (520), Expect = 9.295e-65
Identity = 101/133 (75.94%), Postives = 110/133 (82.71%), Query Frame = 1
Query:  121 MGDFQCFKEHLMNGNAEGVRNNFRAEFMDKIVD-DGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            MGDFQCFKEHLMNGN EGVRNN + EF+DKIVD DGNFPIHI CRNGF SVVRLLLD +CNIECEDK G+RPIHW S NGH EILKLLLDRNC IECE++ G   IHYAS  GH E LKLLL R C I+C++K
Sbjct:    1 MGDFQCFKEHLMNGNVEGVRNNLKWEFVDKIVDNDGNFPIHIVCRNGFLSVVRLLLDCNCNIECEDKCGMRPIHWASENGHLEILKLLLDRNCNIECENRWGRIPIHYASGNGHSEILKLLLDRNCNIECQDK 133          

HSP 2 Score: 145.206 bits (365), Expect = 8.683e-42
Identity = 70/103 (67.96%), Postives = 78/103 (75.73%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            G  PIH A  NG   +++LLLD +CNIEC+DKWG RPIHW   NGHSEILKLLLDRNC IECE+K G R +H+AS  GH E LKLLLQRKCR DCK KD  SP
Sbjct:  102 GRIPIHYASGNGHSEILKLLLDRNCNIECQDKWGNRPIHWACRNGHSEILKLLLDRNCNIECENKSGRRSVHFASSNGHSEILKLLLQRKCRFDCKTKDGKSP 204          

HSP 3 Score: 89.7373 bits (221), Expect = 5.815e-21
Identity = 44/86 (51.16%), Postives = 61/86 (70.93%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLL 480
            GN PIH ACRNG   +++LLLD +CNIECE+K G R +H+ S+NGHSEILKLLL R C  +C+ K G   +  A +  +++ ++LL
Sbjct:  135 GNRPIHWACRNGHSEILKLLLDRNCNIECENKSGRRSVHFASSNGHSEILKLLLQRKCRFDCKTKDGKSPLDLAKQFNNVDCVELL 220          
BLAST of SMED30030653 vs. Planmine SMEST
Match: SMESG000010347.1 (SMESG000010347.1)

HSP 1 Score: 198.749 bits (504), Expect = 4.812e-61
Identity = 102/139 (73.38%), Postives = 108/139 (77.70%), Query Frame = 1
Query:  121 MGDFQCFKEHLMNGNAEGVRNNFRAEFMDKIVDD--GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            MGD+Q FKEHLM GNAEGVRNN R EF+DKIV D  G FPIHIAC  GF +V +LLLD +CNIECED  G RPIHW S NGHSEI+KLLLDRNC IECEDK   R IH AS  GH ETLKLLLQ KCRID KNKD  SP
Sbjct:    1 MGDYQSFKEHLMKGNAEGVRNNLRGEFVDKIVHDIFGYFPIHIACGYGFVAVAKLLLDRNCNIECEDTSGNRPIHWASWNGHSEIVKLLLDRNCNIECEDKSKWRPIHCASWNGHSETLKLLLQWKCRIDYKNKDGKSP 139          
BLAST of SMED30030653 vs. Planmine SMEST
Match: SMESG000043474.1 (SMESG000043474.1)

HSP 1 Score: 203.371 bits (516), Expect = 4.551e-60
Identity = 95/131 (72.52%), Postives = 107/131 (81.68%), Query Frame = 1
Query:  121 MGDFQCFKEHLMNGNAEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            MGDFQCFKEHLMNGN EGVRNN R  F+DKIVDD NFPIHIACRNGF +VVRLLLD +CNIECE+KW +RPIH   +NGHSEILKLLLDRNC +ECEDK G R IH+    GH E LKLLL R C ++C++
Sbjct:    1 MGDFQCFKEHLMNGNVEGVRNNLRGGFVDKIVDDVNFPIHIACRNGFIAVVRLLLDRNCNIECENKWRMRPIHLACSNGHSEILKLLLDRNCNVECEDKWGWRPIHWTYSNGHSEILKLLLDRNCNVECED 131          

HSP 2 Score: 189.889 bits (481), Expect = 2.963e-55
Identity = 91/125 (72.80%), Postives = 102/125 (81.60%), Query Frame = 1
Query:  142 KEHLMNGNAEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            KEHLMNGNAEGVRNN R  F+DKIVDD NFPIHIACRNGF +VVRLLLD +CNIECE+KW +RPIH   +NGHSEILKLLLDRNC +ECEDK G R IH A   GH E LKLLL R C ++C++K
Sbjct:  223 KEHLMNGNAEGVRNNLRGGFVDKIVDDVNFPIHIACRNGFIAVVRLLLDRNCNIECENKWRMRPIHLACSNGHSEILKLLLDRNCNVECEDKRGWRPIHLACSNGHSEILKLLLDRNCNVECEDK 347          

HSP 3 Score: 125.561 bits (314), Expect = 9.264e-35
Identity = 60/95 (63.16%), Postives = 71/95 (74.74%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            PIH A RNG   +++LLLD +CN+ECEDK G RPIHW  +NGHSEILKLLLDRNC +E ED  GMR IH AS  G  + LKLLL R C I+C++K
Sbjct:  352 PIHYASRNGHSDILKLLLDRNCNVECEDKRGWRPIHWTYSNGHSEILKLLLDRNCNVESEDHSGMRLIHLASSNGRSDILKLLLDRNCNIECEDK 446          

HSP 4 Score: 39.6614 bits (91), Expect = 9.264e-35
Identity = 16/23 (69.57%), Postives = 21/23 (91.30%), Query Frame = 2
Query:  527 PLDLAKQYSRVDCVELLAHMKKV 595
            PLDLAKQ++ VDCVELL H++K+
Sbjct:  484 PLDLAKQFNNVDCVELLTHVEKL 506          

HSP 5 Score: 124.02 bits (310), Expect = 2.371e-32
Identity = 57/94 (60.64%), Postives = 71/94 (75.53%), Query Frame = 1
Query:  232 PIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKN 513
            PIH+AC NG   +++LLLD +CN+ECEDK G RPIH+ S NGHS+ILKLLLDRNC +ECEDK G R IH+    GH E LKLLL R C ++ ++
Sbjct:  319 PIHLACSNGHSEILKLLLDRNCNVECEDKLGWRPIHYASRNGHSDILKLLLDRNCNVECEDKRGWRPIHWTYSNGHSEILKLLLDRNCNVESED 412          

HSP 6 Score: 88.9669 bits (219), Expect = 3.569e-20
Identity = 44/86 (51.16%), Postives = 61/86 (70.93%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRK 492
            IH+A  NG   +++LLLD +CNIECEDK G RPIH  S+NG++EILKLLL R C I+C++KLG   +  A +  H++ ++LL   K
Sbjct:  138 IHLASSNGRSDILKLLLDRNCNIECEDKRGERPIHLASSNGNTEILKLLLQRKCRIDCKNKLGKSPLDLAKQYNHVDCVELLTIEK 223          

HSP 7 Score: 82.0333 bits (201), Expect = 9.382e-18
Identity = 41/82 (50.00%), Postives = 58/82 (70.73%), Query Frame = 1
Query:  235 IHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLL 480
            IH+A  NG   +++LLLD +CNIECEDK G RPIH  S+NGH+EILKLLL   C I+C++K G   +  A +  +++ ++LL
Sbjct:  419 IHLASSNGRSDILKLLLDRNCNIECEDKRGERPIHLASSNGHTEILKLLLQCKCRIDCKNKCGKSPLDLAKQFNNVDCVELL 500          

HSP 8 Score: 77.0258 bits (188), Expect = 3.958e-16
Identity = 51/148 (34.46%), Postives = 66/148 (44.59%), Query Frame = 1
Query:  223 GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWG-------------------------------------LR-------------PIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNK 516
            G  PIH+A  NG   +++LLL   C I+C++K G                                     LR             PIH    NG   +++LLLDRNC IECE+K  MR IH A   GH E LKLLL R C ++C++K
Sbjct:  167 GERPIHLASSNGNTEILKLLLQRKCRIDCKNKLGKSPLDLAKQYNHVDCVELLTIEKEHLMNGNAEGVRNNLRGGFVDKIVDDVNFPIHIACRNGFIAVVRLLLDRNCNIECENKWRMRPIHLACSNGHSEILKLLLDRNCNVECEDK 314          
BLAST of SMED30030653 vs. Planmine SMEST
Match: SMESG000010368.1 (SMESG000010368.1)

HSP 1 Score: 201.445 bits (511), Expect = 1.515e-59
Identity = 97/139 (69.78%), Postives = 109/139 (78.42%), Query Frame = 1
Query:  121 MGDFQCFKEHLMNGNAEGVRNNFRAEFMDKIVDD--GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            MGDFQ FKEHLM GNAEGVRNN R EF+DKI+DD  G+FPIHI CR+GF +V +LLLD +C IECE KWG RPIH+ +  GHSEI+KLLLDRNC IECE K   R IHY S +G  E LKLLL+RKCRIDCK KD  SP
Sbjct:    1 MGDFQSFKEHLMKGNAEGVRNNLRGEFVDKIIDDDNGDFPIHITCRDGFVAVAKLLLDRNCKIECETKWGNRPIHYATCYGHSEIVKLLLDRNCNIECETKWKWRPIHYVSWKGQSEILKLLLRRKCRIDCKTKDGKSP 139          
BLAST of SMED30030653 vs. Planmine SMEST
Match: SMESG000010218.1 (SMESG000010218.1)

HSP 1 Score: 193.356 bits (490), Expect = 4.635e-59
Identity = 95/139 (68.35%), Postives = 109/139 (78.42%), Query Frame = 1
Query:  121 MGDFQCFKEHLMNGNAEGVRNNFRAEFMDKIVDD--GNFPIHIACRNGFFSVVRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKLGMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*VSP 531
            MGDFQ FK++LM GNAEGV NN R EF+DKIV D  G F IHIACR+GF +V +LLLD +CNIECE K G+RPIH+ S  GHSEI+KLLLDRNC  ECEDK G R IH+ASR GH E +KLLL+RKCRID K KD  +P
Sbjct:    1 MGDFQSFKKNLMKGNAEGVMNNLRGEFVDKIVCDYNGYFSIHIACRDGFVAVAKLLLDRNCNIECESKSGMRPIHYASRQGHSEIVKLLLDRNCNTECEDKSGKRPIHWASRNGHTEIVKLLLERKCRIDSKTKDGRTP 139          
The following BLAST results are available for this feature:
BLAST of SMED30030653 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK19.229e-1640.38ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK19.229e-1640.38ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK19.236e-1640.38ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK31.530e-1433.33ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK26.092e-1433.33ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of SMED30030653 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-448.561e-1235.00AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-448.561e-1235.00AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-448.571e-1235.00AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-448.571e-1235.00AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-448.581e-1235.00AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of SMED30030653 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank24.872e-1331.87gene:FBgn0261788 transcript:FBtr0334062[more]
Ank26.743e-1231.87gene:FBgn0261788 transcript:FBtr0303120[more]
Ank6.754e-1237.36gene:FBgn0011747 transcript:FBtr0089172[more]
Ank6.754e-1237.36gene:FBgn0011747 transcript:FBtr0300497[more]
Ank6.754e-1237.36gene:FBgn0011747 transcript:FBtr0089171[more]
back to top
BLAST of SMED30030653 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1a1.410e-1538.46ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ankrd52a3.511e-1537.11ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
ankrd52a3.760e-1537.11ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
ank1b1.367e-1435.58ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b1.387e-1435.58ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30030653 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK26.116e-1433.33ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK26.118e-1433.33ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK26.119e-1433.33ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK26.161e-1433.33ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK26.162e-1433.33ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
back to top
BLAST of SMED30030653 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank13.377e-1637.72ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank24.793e-1632.43ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank25.183e-1632.43ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank25.240e-1632.43ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank16.622e-1640.38ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
back to top
BLAST of SMED30030653 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16157|ANK1_HUMAN4.432e-1540.38Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
sp|Q02357|ANK1_MOUSE4.962e-1540.38Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV... [more]
sp|Q502K3|ANR52_DANRE2.811e-1437.11Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q8C8R3|ANK2_MOUSE1.127e-1332.73Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV... [more]
sp|O15084|ANR28_HUMAN2.959e-1336.00Serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of SMED30030653 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A150G2U22.442e-1837.01ANK_REP_REGION domain-containing protein OS=Gonium... [more]
A0A5A8CMN17.908e-1843.75ANK_REP_REGION domain-containing protein OS=Cafete... [more]
A0A4Q4SXR99.744e-1834.00ANK_REP_REGION domain-containing protein OS=Monosp... [more]
J9HSB72.743e-1734.55AAEL017480-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
A0A429GFV74.220e-1733.06Ankyrin repeat domain-containing protein (Fragment... [more]
back to top
BLAST of SMED30030653 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000037173.12.056e-1535.24pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
ank1a2.576e-1537.50ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b4.673e-1536.54ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSAMXT00000048191.13.824e-1435.05pep primary_assembly:Astyanax_mexicanus-2.0:15:310... [more]
ank3a6.653e-1436.26ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of SMED30030653 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.16.669e-1632.73pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.13.228e-1533.94pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000003991.12.226e-1236.08pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000007954.15.204e-1233.02pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gen... [more]
ENSPMAT00000007449.15.605e-1230.40pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
back to top
BLAST of SMED30030653 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
GDE11.759e-631.03Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
NAS62.134e-631.63Evolutionarily conserved 19S regulatory particle a... [more]
PHO817.360e-638.98Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
back to top
BLAST of SMED30030653 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO387023.175e-1237.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348231.745e-1033.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287323.379e-1031.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460991.970e-929.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454851.400e-841.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30030653 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000039903.11.047e-1535.24pep primary_assembly:ASM223467v1:15:18469388:18484... [more]
ank1b8.354e-1536.54ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000006308.28.761e-1533.33pep primary_assembly:ASM223467v1:1:12516834:125306... [more]
ENSORLT00000028696.11.030e-1436.00serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000037670.11.032e-1436.00serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of SMED30030653 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043462.19.295e-6575.94SMESG000043462.1[more]
SMESG000010347.14.812e-6173.38SMESG000010347.1[more]
SMESG000043474.14.551e-6072.52SMESG000043474.1[more]
SMESG000010368.11.515e-5969.78SMESG000010368.1[more]
SMESG000010218.14.635e-5968.35SMESG000010218.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030653 ID=SMED30030653|Name=SMED30030653|organism=Schmidtea mediterranea sexual|type=transcript|length=673bp
TATACTTCATATTTTGGAAGTATTAAAAAAATAAGTTTTGATTAATTTCT
ATTTATTATGATCAATTATTATGTTATTATTTATGATTATTATTAGCAAA
TAACAGTGATATTTATCTAGATGGGAGATTTTCAATGTTTCAAGGAGCAC
TTGATGAATGGCAATGCGGAGGGAGTCAGAAATAATTTTAGGGCCGAATT
TATGGATAAAATTGTTGATGATGGCAATTTTCCAATTCATATCGCCTGTC
GTAATGGATTTTTTTCTGTTGTCAGGTTGTTGCTTGACCTCAGCTGCAAT
ATTGAATGTGAAGACAAATGGGGATTGAGACCGATTCATTGGTTAAGCGC
TAATGGGCATTCGGAAATATTGAAATTATTGCTTGACAGGAATTGCACTA
TTGAGTGTGAGGACAAATTAGGAATGAGACAGATTCATTATGCAAGTCGT
GAAGGGCATTTAGAAACATTGAAATTGTTGCTGCAACGAAAATGCCGAAT
CGATTGCAAGAATAAAGATTGAGTGTCCCCTGGATTTGGCAAAGCAATAT
AGTCGTGTTGATTGCGTGGAATTATTGGCTCATATGAAGAAAGTGTGAAT
TATAAATTCGAATAAATATTTCAGTTATTTGCTATCATTTAACCCTATTT
AATTTTAATGTCTTTTGAATGTG
back to top

protein sequence of SMED30030653-orf-1

>SMED30030653-orf-1 ID=SMED30030653-orf-1|Name=SMED30030653-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=134bp
MGDFQCFKEHLMNGNAEGVRNNFRAEFMDKIVDDGNFPIHIACRNGFFSV
VRLLLDLSCNIECEDKWGLRPIHWLSANGHSEILKLLLDRNCTIECEDKL
GMRQIHYASREGHLETLKLLLQRKCRIDCKNKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008093cytoskeletal adaptor activity
GO:0019899enzyme binding
GO:0030507spectrin binding
GO:0051117ATPase binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0014731spectrin-associated cytoskeleton
GO:0016020membrane
GO:0016529sarcoplasmic reticulum
GO:0030863cortical cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0006779porphyrin-containing compound biosynthetic process
GO:0006888ER to Golgi vesicle-mediated transport
GO:0007165signal transduction
GO:0015672monovalent inorganic cation transport
GO:0048821erythrocyte development
GO:0055072iron ion homeostasis
GO:0072661protein targeting to plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 65..94
e-value: 0.41
score: 19.7
coord: 32..61
e-value: 0.91
score: 18.6
coord: 98..127
e-value: 0.0068
score: 25.6
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 98..130
score: 10.953
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 65..97
score: 9.057
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 32..64
score: 9.831
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 64..128
e-value: 1.5E-9
score: 38.3
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 32..131
score: 27.106
NoneNo IPR availableGENE3DG3DSA:1.25.40.960coord: 104..131
e-value: 9.0E-6
score: 27.6
NoneNo IPR availablePANTHERPTHR24198ANKYRIN REPEAT AND PROTEIN KINASE DOMAIN-CONTAINING PROTEINcoord: 32..99
coord: 34..130
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 5..103
e-value: 7.2E-20
score: 72.9
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 18..131