Aquaporin

Overview
NameAquaporin
Smed IDSMED30030651
Length (bp)988
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aquaporin (SMED30030651) t-SNE clustered cells

Violin plots show distribution of expression levels for Aquaporin (SMED30030651) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030651

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
enteric muscle cellSMED30030651SMESG000067985.1 dd_Smed_v4_34551_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30030651SMESG000067985.1 Contig9161newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30030651SMESG000067985.1 Contig9161uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aquaporin vs. Ensembl Human
Match: AQP3 (aquaporin 3 (Gill blood group) [Source:HGNC Symbol;Acc:HGNC:636])

HSP 1 Score: 194.126 bits (492), Expect = 2.004e-59
Identity = 112/271 (41.33%), Postives = 153/271 (56.46%), Query Frame = 1
Query:   22 SMKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV--QSTGAFFITSRSTSL--LTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
              K LV+   + L +   +L   L E  GT IL++FG G + QV LS   +G FL+I+L +GFAV L +  +G++   H NPAVT A   + R  WI++P Y LAQ +GAFLG+ ++F +YY+ I  FA   D+  F+     T   F T  S  L  +  FFDQF GT  L  C +AI D     +P  L    +GL+V  I      N+G A+NPARD GPR+  A+ GWG   FT    ++WVPIV+PLLG + G   Y++ IG HL 
Sbjct:    3 RQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWHFA---DNQLFVSGPNGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSAVFTTGQHWWWVPIVSPLLGSIAGVFVYQLMIGCHLE 270          
BLAST of Aquaporin vs. Ensembl Human
Match: AQP9 (aquaporin 9 [Source:HGNC Symbol;Acc:HGNC:643])

HSP 1 Score: 186.037 bits (471), Expect = 3.220e-56
Identity = 102/261 (39.08%), Postives = 151/261 (57.85%), Query Frame = 1
Query:   49 DKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFITSRST--SLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
             + L L +S+    L E  GTFILIV G G + Q  LS  ++G  ++I++G+  AV +A++ +G +  GH NPAV+LA    GR++W ++PFY  AQ +GAF+G+  +F IYY+ ++ FA     GK ++    +T   F T  +   SL  AF DQ   T +L     AI D      P  L PI +GL++  I     +N+G A+NPARDL PR+  A+ GWG E F   + ++W+P+V PL+G V G L Y + I +H
Sbjct:   13 KQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAG----GKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIH 269          
BLAST of Aquaporin vs. Ensembl Human
Match: AQP9 (aquaporin 9 [Source:HGNC Symbol;Acc:HGNC:643])

HSP 1 Score: 186.037 bits (471), Expect = 3.220e-56
Identity = 102/261 (39.08%), Postives = 151/261 (57.85%), Query Frame = 1
Query:   49 DKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFITSRST--SLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
             + L L +S+    L E  GTFILIV G G + Q  LS  ++G  ++I++G+  AV +A++ +G +  GH NPAV+LA    GR++W ++PFY  AQ +GAF+G+  +F IYY+ ++ FA     GK ++    +T   F T  +   SL  AF DQ   T +L     AI D      P  L PI +GL++  I     +N+G A+NPARDL PR+  A+ GWG E F   + ++W+P+V PL+G V G L Y + I +H
Sbjct:   13 KQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAG----GKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIH 269          
BLAST of Aquaporin vs. Ensembl Human
Match: AQP7 (aquaporin 7 [Source:HGNC Symbol;Acc:HGNC:640])

HSP 1 Score: 160.999 bits (406), Expect = 4.501e-46
Identity = 91/254 (35.83%), Postives = 146/254 (57.48%), Query Frame = 1
Query:   64 LHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQ---STGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIG 810
            L   ++   L E   T++++VFGLG +  + L N +YGS+L ++LG+GF V + V  +G++   H N AVT A  ++GR+ W + P Y L Q +G+FL +  ++ ++Y  IL F+     G+ +V    +T   F T      +L   F ++ + T +L  C  AITD++          +++G++V  I     MN G A+NP+RDL PRI   + GWG++ F+N + ++WVP+VAPLLG   G + Y VFIG
Sbjct:   28 LQRKMVREFLAEFMSTYVMMVFGLGSVAHMVL-NKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILHFSG----GQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPGTEALVIGILVVIIGVSLGMNTGYAINPSRDLPPRIFTFIAGWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIG 276          
BLAST of Aquaporin vs. Ensembl Human
Match: AQP7 (aquaporin 7 [Source:HGNC Symbol;Acc:HGNC:640])

HSP 1 Score: 160.999 bits (406), Expect = 4.809e-46
Identity = 91/254 (35.83%), Postives = 146/254 (57.48%), Query Frame = 1
Query:   64 LHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQ---STGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIG 810
            L   ++   L E   T++++VFGLG +  + L N +YGS+L ++LG+GF V + V  +G++   H N AVT A  ++GR+ W + P Y L Q +G+FL +  ++ ++Y  IL F+     G+ +V    +T   F T      +L   F ++ + T +L  C  AITD++          +++G++V  I     MN G A+NP+RDL PRI   + GWG++ F+N + ++WVP+VAPLLG   G + Y VFIG
Sbjct:   29 LQRKMVREFLAEFMSTYVMMVFGLGSVAHMVL-NKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILHFSG----GQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPGTEALVIGILVVIIGVSLGMNTGYAINPSRDLPPRIFTFIAGWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIG 277          
BLAST of Aquaporin vs. Ensembl Celegans
Match: aqp-7 (AQuaPorin or aquaglyceroporin related [Source:UniProtKB/TrEMBL;Acc:Q21473])

HSP 1 Score: 170.244 bits (430), Expect = 1.103e-50
Identity = 95/259 (36.68%), Postives = 147/259 (56.76%), Query Frame = 1
Query:   46 IDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFF-ITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHL 819
            +   + + N +L   L E +GTF+L+  G+G+++Q  LSN +  ++++I+LGWG A+   V+   K   GH NPAV++AF ++G+L +     Y + Q +GA LGS   F +YY++ + FA           + G F    +   S  TAFFDQF GT LL      + D+    +P   HP++ GL+V  I   + MN G  +NPARDLGPR + +   +G   F+   +YFW+P++APL G +FGA  Y  F+G H+
Sbjct:   11 VRAKIQIKNPLLRNALSEFFGTFLLLFIGIGIVMQFILSNEKLNTWININLGWGLAIAFTVYTCSKTSGGHFNPAVSIAFLTLGKLPFKDFLVYCVVQTIGAALGSAAAFGLYYDQFVKFAGAYRTILGPKATAGCFCSYPALHVSNTTAFFDQFAGTALLVLFVCVVIDKRN-GIPGAAHPLLFGLVVMMIGTAYGMNLGYPINPARDLGPR-LFSFFIYGSGVFSYHSYYFWIPVIAPLFGAIFGAWSYTFFVGAHI 267          
BLAST of Aquaporin vs. Ensembl Celegans
Match: aqp-7 (AQuaPorin or aquaglyceroporin related [Source:UniProtKB/TrEMBL;Acc:Q21473])

HSP 1 Score: 170.244 bits (430), Expect = 1.103e-50
Identity = 95/259 (36.68%), Postives = 147/259 (56.76%), Query Frame = 1
Query:   46 IDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFF-ITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHL 819
            +   + + N +L   L E +GTF+L+  G+G+++Q  LSN +  ++++I+LGWG A+   V+   K   GH NPAV++AF ++G+L +     Y + Q +GA LGS   F +YY++ + FA           + G F    +   S  TAFFDQF GT LL      + D+    +P   HP++ GL+V  I   + MN G  +NPARDLGPR + +   +G   F+   +YFW+P++APL G +FGA  Y  F+G H+
Sbjct:   11 VRAKIQIKNPLLRNALSEFFGTFLLLFIGIGIVMQFILSNEKLNTWININLGWGLAIAFTVYTCSKTSGGHFNPAVSIAFLTLGKLPFKDFLVYCVVQTIGAALGSAAAFGLYYDQFVKFAGAYRTILGPKATAGCFCSYPALHVSNTTAFFDQFAGTALLVLFVCVVIDKRN-GIPGAAHPLLFGLVVMMIGTAYGMNLGYPINPARDLGPR-LFSFFIYGSGVFSYHSYYFWIPVIAPLFGAIFGAWSYTFFVGAHI 267          
BLAST of Aquaporin vs. Ensembl Celegans
Match: aqp-3 (AQuaPorin or aquaglyceroporin related [Source:UniProtKB/TrEMBL;Acc:A0A061ADS9])

HSP 1 Score: 149.443 bits (376), Expect = 2.262e-42
Identity = 97/268 (36.19%), Postives = 144/268 (53.73%), Query Frame = 1
Query:   37 VNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFITSRSTSLLT--AFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDF-YFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
            V  +    ++ N ++ A L EL+ T  L+  G  V  Q  LS  +   ++ IS+GWG  +MLAV    K+   H NPAV+    + G++  IR   Y +AQ +GAFLG+  +F +YY+ I  F    + G   V    +T + F T     L T  A  DQ  GT +L     AITD     +P +L P  +G +++ +    A+NAG A+NPARD  PR+     G+G E F+  ++ +FW+PI+ P++GGV GA  YE FIG H+ 
Sbjct:    7 VERLKPKFAIGNELIRAFLAELFCTGFLVFGGECVNAQYVLSQGKNNEWIGISVGWGLVLMLAVLMGSKISGAHLNPAVSFFQLTQGKINLIRFLVYAVAQNIGAFLGAFGVFCVYYDAINVF----EGGNRTVTGPTATASIFATYPGPFLGTFNAIVDQIAGTLVLCLGVAAITDRRN-GIPAFLQPAWIGALLAFLGMSLALNAGYAINPARDFAPRLFNLCAGYGWEVFSYRNYKWFWIPIICPMIGGVLGAWLYEFFIGFHIQ 269          
BLAST of Aquaporin vs. Ensembl Celegans
Match: aqp-3 (AQuaPorin or aquaglyceroporin related [Source:UniProtKB/TrEMBL;Acc:A0A061ADS9])

HSP 1 Score: 148.673 bits (374), Expect = 1.495e-41
Identity = 97/268 (36.19%), Postives = 144/268 (53.73%), Query Frame = 1
Query:   37 VNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFITSRSTSLLT--AFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDF-YFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
            V  +    ++ N ++ A L EL+ T  L+  G  V  Q  LS  +   ++ IS+GWG  +MLAV    K+   H NPAV+    + G++  IR   Y +AQ +GAFLG+  +F +YY+ I  F    + G   V    +T + F T     L T  A  DQ  GT +L     AITD     +P +L P  +G +++ +    A+NAG A+NPARD  PR+     G+G E F+  ++ +FW+PI+ P++GGV GA  YE FIG H+ 
Sbjct:   59 VERLKPKFAIGNELIRAFLAELFCTGFLVFGGECVNAQYVLSQGKNNEWIGISVGWGLVLMLAVLMGSKISGAHLNPAVSFFQLTQGKINLIRFLVYAVAQNIGAFLGAFGVFCVYYDAINVF----EGGNRTVTGPTATASIFATYPGPFLGTFNAIVDQIAGTLVLCLGVAAITDRRN-GIPAFLQPAWIGALLAFLGMSLALNAGYAINPARDFAPRLFNLCAGYGWEVFSYRNYKWFWIPIICPMIGGVLGAWLYEFFIGFHIQ 321          
BLAST of Aquaporin vs. Ensembl Celegans
Match: aqp-3 (AQuaPorin or aquaglyceroporin related [Source:UniProtKB/TrEMBL;Acc:A0A061ADS9])

HSP 1 Score: 147.902 bits (372), Expect = 6.830e-41
Identity = 97/268 (36.19%), Postives = 144/268 (53.73%), Query Frame = 1
Query:   37 VNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFITSRSTSLLT--AFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDF-YFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
            V  +    ++ N ++ A L EL+ T  L+  G  V  Q  LS  +   ++ IS+GWG  +MLAV    K+   H NPAV+    + G++  IR   Y +AQ +GAFLG+  +F +YY+ I  F    + G   V    +T + F T     L T  A  DQ  GT +L     AITD     +P +L P  +G +++ +    A+NAG A+NPARD  PR+     G+G E F+  ++ +FW+PI+ P++GGV GA  YE FIG H+ 
Sbjct:  106 VERLKPKFAIGNELIRAFLAELFCTGFLVFGGECVNAQYVLSQGKNNEWIGISVGWGLVLMLAVLMGSKISGAHLNPAVSFFQLTQGKINLIRFLVYAVAQNIGAFLGAFGVFCVYYDAINVF----EGGNRTVTGPTATASIFATYPGPFLGTFNAIVDQIAGTLVLCLGVAAITDRRN-GIPAFLQPAWIGALLAFLGMSLALNAGYAINPARDFAPRLFNLCAGYGWEVFSYRNYKWFWIPIICPMIGGVLGAWLYEFFIGFHIQ 368          
BLAST of Aquaporin vs. Ensembl Fly
Match: Drip (gene:FBgn0015872 transcript:FBtr0088141)

HSP 1 Score: 76.6406 bits (187), Expect = 7.070e-16
Identity = 73/255 (28.63%), Postives = 110/255 (43.14%), Query Frame = 1
Query:   58 LSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSL--LTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            ++ +  I   +LGEL GTF LI  G+G        +   GS   I+  +G  V       G L   H NPAVTL F  +G +  ++  FY + Q VGA  G+ V+     +  LD  A  D G           ++S   SL    A   +   TF+L     A++D    D+     P+ +GL ++    C    +GA++NPAR  GP ++  +  W          Y WV  V P+ GG+   + Y +   V 
Sbjct:   16 ITENKKIWRMLLGELVGTFFLIFVGVG--------STTSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVI-----KVALDGVAGGDLG-----------VSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGS-APLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGV--W---------TYHWVYWVGPIAGGLLAGIIYRLIFKVR 234          
BLAST of Aquaporin vs. Ensembl Fly
Match: Drip (gene:FBgn0015872 transcript:FBtr0088142)

HSP 1 Score: 76.6406 bits (187), Expect = 7.070e-16
Identity = 73/255 (28.63%), Postives = 110/255 (43.14%), Query Frame = 1
Query:   58 LSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSL--LTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            ++ +  I   +LGEL GTF LI  G+G        +   GS   I+  +G  V       G L   H NPAVTL F  +G +  ++  FY + Q VGA  G+ V+     +  LD  A  D G           ++S   SL    A   +   TF+L     A++D    D+     P+ +GL ++    C    +GA++NPAR  GP ++  +  W          Y WV  V P+ GG+   + Y +   V 
Sbjct:   16 ITENKKIWRMLLGELVGTFFLIFVGVG--------STTSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVI-----KVALDGVAGGDLG-----------VSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGS-APLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGV--W---------TYHWVYWVGPIAGGLLAGIIYRLIFKVR 234          
BLAST of Aquaporin vs. Ensembl Fly
Match: Drip (gene:FBgn0015872 transcript:FBtr0331388)

HSP 1 Score: 76.2554 bits (186), Expect = 8.460e-16
Identity = 76/267 (28.46%), Postives = 114/267 (42.70%), Query Frame = 1
Query:   22 SMKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSL--LTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
             M   V + D  ++ +  I   +LGEL GTF LI  G+G        +   GS   I+  +G  V       G L   H NPAVTL F  +G +  ++  FY + Q VGA  G+ V+     +  LD  A  D G           ++S   SL    A   +   TF+L     A++D    D+     P+ +GL ++    C    +GA++NPAR  GP ++  +  W          Y WV  V P+ GG+   + Y +   V 
Sbjct:    3 EMSKFVGVAD--ITENKKIWRMLLGELVGTFFLIFVGVG--------STTSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVI-----KVALDGVAGGDLG-----------VSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGS-APLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGV--W---------TYHWVYWVGPIAGGLLAGIIYRLIFKVR 231          
BLAST of Aquaporin vs. Ensembl Fly
Match: Drip (gene:FBgn0015872 transcript:FBtr0331389)

HSP 1 Score: 76.2554 bits (186), Expect = 8.562e-16
Identity = 73/255 (28.63%), Postives = 110/255 (43.14%), Query Frame = 1
Query:   58 LSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSL--LTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            ++ +  I   +LGEL GTF LI  G+G        +   GS   I+  +G  V       G L   H NPAVTL F  +G +  ++  FY + Q VGA  G+ V+     +  LD  A  D G           ++S   SL    A   +   TF+L     A++D    D+     P+ +GL ++    C    +GA++NPAR  GP ++  +  W          Y WV  V P+ GG+   + Y +   V 
Sbjct:   10 ITENKKIWRMLLGELVGTFFLIFVGVG--------STTSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVI-----KVALDGVAGGDLG-----------VSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGS-APLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGV--W---------TYHWVYWVGPIAGGLLAGIIYRLIFKVR 228          
BLAST of Aquaporin vs. Ensembl Fly
Match: Drip (gene:FBgn0015872 transcript:FBtr0331387)

HSP 1 Score: 76.2554 bits (186), Expect = 8.848e-16
Identity = 73/255 (28.63%), Postives = 110/255 (43.14%), Query Frame = 1
Query:   58 LSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSL--LTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            ++ +  I   +LGEL GTF LI  G+G        +   GS   I+  +G  V       G L   H NPAVTL F  +G +  ++  FY + Q VGA  G+ V+     +  LD  A  D G           ++S   SL    A   +   TF+L     A++D    D+     P+ +GL ++    C    +GA++NPAR  GP ++  +  W          Y WV  V P+ GG+   + Y +   V 
Sbjct:   14 ITENKKIWRMLLGELVGTFFLIFVGVG--------STTSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVI-----KVALDGVAGGDLG-----------VSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGS-APLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGV--W---------TYHWVYWVGPIAGGLLAGIIYRLIFKVR 232          
BLAST of Aquaporin vs. Ensembl Zebrafish
Match: aqp10a (aquaporin 10a [Source:ZFIN;Acc:ZDB-GENE-040718-40])

HSP 1 Score: 191.43 bits (485), Expect = 1.706e-58
Identity = 102/263 (38.78%), Postives = 156/263 (59.32%), Query Frame = 1
Query:   46 IDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHL 819
            I K + + N +   ++GE+ GTF+L++FG     QV+ S    G FLS ++ +   VM A++    +   H NPAV+L+F  +G L WI++  Y LAQ++GA+L S +++LIY++ I++F+     G   V     T + F T  +   S+ T F DQ  GT +L  C + + D+     P+ L P ++  +V GI    + N GAA+NPARDLGPR+     GWG E FT  D++FW+P+VAP++GGV G++ Y VFI  HL
Sbjct:    7 IMKRMKVKNELARQIMGEILGTFVLLLFGCAAAAQVKTSRETKGQFLSGNIAFSVGVMSAMYLCRAVSGAHLNPAVSLSFCVLGDLAWIKLLPYSLAQILGAYLASGLVYLIYHDAIMEFSG----GVLTVFGPNETASIFATYPTDVVSVQTNFLDQVVGTAMLMLCILPLNDKRNAPAPEALLPPIVATVVLGISISMSANCGAAINPARDLGPRLFTFTAGWGTEVFTCYDYFFWIPLVAPMVGGVLGSIIYLVFIQWHL 265          
BLAST of Aquaporin vs. Ensembl Zebrafish
Match: aqp10a (aquaporin 10a [Source:ZFIN;Acc:ZDB-GENE-040718-40])

HSP 1 Score: 191.43 bits (485), Expect = 1.941e-58
Identity = 102/263 (38.78%), Postives = 156/263 (59.32%), Query Frame = 1
Query:   46 IDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHL 819
            I K + + N +   ++GE+ GTF+L++FG     QV+ S    G FLS ++ +   VM A++    +   H NPAV+L+F  +G L WI++  Y LAQ++GA+L S +++LIY++ I++F+     G   V     T + F T  +   S+ T F DQ  GT +L  C + + D+     P+ L P ++  +V GI    + N GAA+NPARDLGPR+     GWG E FT  D++FW+P+VAP++GGV G++ Y VFI  HL
Sbjct:    7 IMKRMKVKNELARQIMGEILGTFVLLLFGCAAAAQVKTSRETKGQFLSGNIAFSVGVMSAMYLCRAVSGAHLNPAVSLSFCVLGDLAWIKLLPYSLAQILGAYLASGLVYLIYHDAIMEFSG----GVLTVFGPNETASIFATYPTDVVSVQTNFLDQVVGTAMLMLCILPLNDKRNAPAPEALLPPIVATVVLGISISMSANCGAAINPARDLGPRLFTFTAGWGTEVFTCYDYFFWIPLVAPMVGGVLGSIIYLVFIQWHL 265          
BLAST of Aquaporin vs. Ensembl Zebrafish
Match: aqp3a (aquaporin 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2826])

HSP 1 Score: 185.267 bits (469), Expect = 3.168e-56
Identity = 100/269 (37.17%), Postives = 151/269 (56.13%), Query Frame = 1
Query:   25 MKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFI-VQSTGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
             K +++ + +   + N +L   L E  GT IL++FG G + Q++LS   +G FL+ +L +GF   L +   G++  GH NPAVT A   +GR +W + P Y+L Q +G+FLG+ ++F  Y++ I D+A   ++   +  + T   F T  S+  + L  FFDQ  GT  L  C +AI D     +P  L    +G  V  I      N+G A+NPARD GPR+  AM GWG E FT  D++F VPI AP +G V G + Y++ +G H+ 
Sbjct:    4 QKSVLDKLAQTFQIRNKLLRQGLAECLGTLILVMFGCGSLAQLKLSEGSHGLFLTANLAFGFGATLGILVCGQVSGGHLNPAVTFALCLLGREKWRKFPVYFLFQTLGSFLGAAIIFAEYHDAIYDYAGESNELLVLGEKETAGIFATYPSKYLTPLNGFFDQVIGTASLIVCILAIVDPYNNPIPQGLEAFTVGFSVLIIGLSMGFNSGYAVNPARDFGPRLFTAMAGWGSEVFTARDYWFLVPIFAPFIGAVIGVIVYQLMVGWHVE 272          
BLAST of Aquaporin vs. Ensembl Zebrafish
Match: aqp3b (aquaporin 3b [Source:ZFIN;Acc:ZDB-GENE-040724-66])

HSP 1 Score: 184.111 bits (466), Expect = 1.196e-55
Identity = 97/268 (36.19%), Postives = 148/268 (55.22%), Query Frame = 1
Query:   22 SMKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFI-TSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
              K ++  + +   + N ++   L E  GT IL++FG G + Q  LS   +G FL+++  +GFA  L +   G++  GH NP VT +   +GR  W + P Y+LAQ VGAFLG+ ++F +Y++ I  F     D   +  + G F    S+  +LL  FFDQ  GT  L  C +AI D     +P  L    +G +V  I      N+G A+NPARDLGPRI  A+ GWG + F+   ++ +VP+ AP +G VFG + Y++ +G H+ 
Sbjct:    3 RQKVILEKMARIFQIRNMLMRQALAECLGTLILVMFGCGALAQHILSGGSHGMFLTVNFAFGFAATLGILVCGQVSGGHINPTVTFSLCLLGREPWRKFPVYFLAQTVGAFLGAGIIFGMYFDAIWKFGQGSLDVDGVNATAGIFATYPSKHLTLLNGFFDQMIGTAALIVCILAIVDPYNNPIPQGLEAFTVGFVVLVIGLSMGFNSGYAVNPARDLGPRIFTAIAGWGSKVFSAESYWSFVPVFAPFIGAVFGVMVYQLMVGCHVK 270          
BLAST of Aquaporin vs. Ensembl Zebrafish
Match: aqp7 (aquaporin 7 [Source:ZFIN;Acc:ZDB-GENE-030131-6461])

HSP 1 Score: 160.229 bits (404), Expect = 4.046e-46
Identity = 99/262 (37.79%), Postives = 142/262 (54.20%), Query Frame = 1
Query:   46 IDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFITSRST--SLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            +   L + N  +   L E   TFI++VFGLG + QV      +G +LSI++G+G AV + V   GK+   H N AV+      GRL W  +P Y  AQ +G+FL +  +F +YY+ I  F      G   V   ++T   F T  +   S+ T FFDQ  GT LL  C +A++D+    L      + +GL+V  I      N+G A+NP RDLGPR+   M GWG E F   + ++WVP+VAP +GGV GAL Y+  + +H
Sbjct:   47 VGSMLKIKNEYIRVALAESLCTFIMMVFGLGTVAQVVTGEGYFGEYLSINIGFGLAVAMGVHVGGKVSGAHMNAAVSFTMCVFGRLRWKMLPLYVFAQFLGSFLAAGTIFSLYYDAINHFCG----GNLTVSGPKATAGIFATYPAPYISVYTGFFDQVAGTGLLLLCLMALSDQRNQPLVSGGEAVGVGLLVMLIGVSMGSNSGYAINPTRDLGPRLFTLMAGWGTEVFRAGNCWWWVPLVAPFIGGVLGALIYKALVELH 304          
BLAST of Aquaporin vs. Ensembl Xenopus
Match: aqp3 (aquaporin 3 (Gill blood group) [Source:NCBI gene;Acc:549599])

HSP 1 Score: 190.274 bits (482), Expect = 5.940e-58
Identity = 110/270 (40.74%), Postives = 156/270 (57.78%), Query Frame = 1
Query:   25 MKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV--QSTGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
             K  +N  ++ L L N +L   L E  GT IL++FG G + QV LS   +G FL+++L +GFAVML +  SG++  GH NPAVT A   + R  WI+ P Y  AQ +GAFLG+ +++ +YY+ I  F    +D  F++    T   F T  S   +L+  FFDQF GT  L  C +AI D +   +P  L    +G +V  I      N+G A+NPARD GPR+  ++ GWG E F   + ++WVPIV+PLLG   G L Y++ IG H+ 
Sbjct:    4 QKDFINKCNQLLRLRNKLLRQALSECLGTLILVMFGCGSVAQVVLSKGSHGQFLTVNLAFGFAVMLGILISGQVSGGHLNPAVTFALCIMAREPWIKFPIYSFAQTLGAFLGAGIIYGLYYDAIWFFG---NDQLFVMGENGTAGIFTTFPSEHLTLINGFFDQFIGTAALIVCVLAIVDPNNNPIPRGLEAFTVGFVVLVIGTSMGFNSGYAVNPARDFGPRLFTSLAGWGTEVFWAGNQWWWVPIVSPLLGAFTGVLVYQLMIGCHIE 270          
BLAST of Aquaporin vs. Ensembl Xenopus
Match: senp6 (SUMO specific peptidase 6 [Source:Xenbase;Acc:XB-GENE-962887])

HSP 1 Score: 168.318 bits (425), Expect = 1.738e-49
Identity = 101/257 (39.30%), Postives = 142/257 (55.25%), Query Frame = 1
Query:   58 LSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAAN--KDDGKFIVQSTGAFFITSRST--SLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            ++L NS+    L E + T +LI+ G G +    LSN    ++L+ +LG+  AV +AV+ SG +  GH NPAV+ A    GRL+W + PFY  AQ +GA  GS  +F IYY+ + ++       DG     +T   F T      S++  F DQ   T LL    +AI D      P  L PI +GL++  +     MN+G A+NPARDLGPRI  AM GWG E FT+ + ++WVP+V P+LG   GA  Y + I  H
Sbjct:   17 IALKNSLAKETLSEFFATCLLIILGCGCVATSVLSNTS-DAYLTNNLGFAMAVTIAVYVSGGVSGGHINPAVSFAMCLTGRLKWAKFPFYVSAQFLGAIAGSAAVFGIYYDALYNYTGGILTVDGP---NATAYIFATYPKPYLSIMGGFVDQVMSTALLLIGVLAIFDNKNLGTPKGLEPIAVGLLILLLGLSLGMNSGCAMNPARDLGPRIFTAMAGWGMEVFTSGNSWWWVPVVGPMLGAAIGAFIYVLCIEAH 269          
BLAST of Aquaporin vs. Ensembl Xenopus
Match: ENSXETT00000021574.1 (aquaporin-3-like [Source:NCBI gene;Acc:100489930])

HSP 1 Score: 166.007 bits (419), Expect = 1.437e-48
Identity = 100/269 (37.17%), Postives = 147/269 (54.65%), Query Frame = 1
Query:   25 MKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            + FL N+  K L   N  +   L E  GT ILI+FG G + Q+ELS      FLS+++ +GFAV    +    +   H NPAV+LA   + +L W  +  Y LAQ +GAF+G+ ++F +YY+ +  +++    G + V   Q+T   F +  S   S++  F DQ   T  L  C +AI DE     P  L P ++G++V  +      N G  +NPARDL PR   A+ GWG E F+    ++WVP++ PL+GGV G + YEVFI  H
Sbjct:    5 LAFLKNMKIK-LRTQNQYVRCGLAEFLGTLILILFGCGSVAQMELSGFAKAQFLSVNMAFGFAVTAGAYVCAGVSGAHLNPAVSLAMFILKKLSWRLLLTYCLAQFLGAFIGAALVFSLYYDALHVYSS----GNWTVYGPQATAGIFASYPSEHLSVINGFTDQVIATAALLICILAILDEANNAAPRGLQPFLIGIVVLLVGLAMGFNCGYPINPARDLAPRFFTAIAGWGSEVFSAGGHWWWVPVIGPLVGGVLGVVIYEVFIEFH 268          
BLAST of Aquaporin vs. Ensembl Xenopus
Match: AQP10 (aquaporin 10 [Source:NCBI gene;Acc:100490571])

HSP 1 Score: 150.984 bits (380), Expect = 1.112e-42
Identity = 87/258 (33.72%), Postives = 134/258 (51.94%), Query Frame = 1
Query:   58 LSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFITSRST--SLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            L L N +    L E  G F+L++  +    Q   SN   G+F  + L    AV+LA++ SG +  GH NPA +L+   +GR  W ++P Y L Q++   LG L L L +    LD   +   G   V   + T + F +  +   S+   F DQ  GT +L    +AI D     +P  L PI++G++V  I      N G  +NP RDLGPR+  A+ GWG + F   + ++WVP+VAP +G V G++ Y++ + +H
Sbjct:   14 LRLRNPLARECLAEFLGVFVLLLITVAATAQGVTSNETRGNFFCMYLAGAIAVVLAIYISGGVSGGHLNPAYSLSMCILGRFPWWKLPLYALIQLLSCILGRLTLTLYFP---LDAIRDYTKGNLTVFGPRETASIFSSYPAPYLSIGNGFLDQVMGTAMLMVGILAIVDSKNKPVPRGLEPIVVGMLVFCIGLSMGANCGYPINPTRDLGPRLFTAVAGWGLDVFRAGNNWWWVPVVAPCVGAVLGSILYQILVEIH 268          
BLAST of Aquaporin vs. Ensembl Xenopus
Match: aqp7 (aquaporin 7 [Source:NCBI gene;Acc:548443])

HSP 1 Score: 129.028 bits (323), Expect = 1.592e-35
Identity = 76/204 (37.25%), Postives = 113/204 (55.39%), Query Frame = 1
Query:  124 VFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFITSRST--SLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAF 720
            +FGLG   QV L  +++G +LSI+L +GF V + +  +G +   H N AV+L    +G L W ++P Y LAQ++G+FL ++V++ +Y E + ++      G F V     T + F T      S+   F DQ  GT  L  C +AI D            +++GL+V+ I     MN+G A+NPARDLGPRI  A+ GWG E F
Sbjct:    1 LFGLGSCAQVVLGKHEFGQYLSINLSFGFGVTMGIHVAGGVSGAHMNSAVSLTNCVLGNLPWRKLPVYVLAQMLGSFLAAVVVYCLYSEALYNYCG----GIFTVTGPNETASIFATYPQPYLSIGGGFLDQVIGTGALLLCLLAIGDRKNSPALKGTEAVIVGLLVTVIGMSMGMNSGYAINPARDLGPRIFTAIAGWGIEVF 200          
BLAST of Aquaporin vs. Ensembl Mouse
Match: Aqp3 (aquaporin 3 [Source:MGI Symbol;Acc:MGI:1333777])

HSP 1 Score: 196.438 bits (498), Expect = 1.616e-60
Identity = 113/271 (41.70%), Postives = 154/271 (56.83%), Query Frame = 1
Query:   22 SMKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV--QSTGAFFITSRSTSL--LTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
              K L+N   + L +   +L   L E  GT IL++FG G + QV LS   +G FL+I+L +GFAV L +  +G++   H NPAVT A   + R  WI++P Y LAQ +GAFLG+ ++F +YY+ I  FA N+    F+     T   F T  S  L  +  FFDQF GT  L  C +AI D     +P  L    +GL+V  I      N+G A+NPARD GPR+  A+ GWG E FT    ++WVPIV+PLLG + G   Y++ IG HL 
Sbjct:    3 RQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYALAQTLGAFLGAGIVFGLYYDAIWAFANNE---LFVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGRHWWWVPIVSPLLGSIAGVFVYQLMIGCHLE 270          
BLAST of Aquaporin vs. Ensembl Mouse
Match: Aqp9 (aquaporin 9 [Source:MGI Symbol;Acc:MGI:1891066])

HSP 1 Score: 174.481 bits (441), Expect = 5.299e-52
Identity = 101/264 (38.26%), Postives = 157/264 (59.47%), Query Frame = 1
Query:   40 NLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV--QSTGAFFITSRSTSLLT---AFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            NL+ + L+L + +    L E  GTFI+IV G G I Q  LS  + G  ++I++G+  AV++A++ +  +  GH NPAV+ A  + GR+EW + PFY  AQ++GAF+G+  +F IYY+ ++ FA    DGK ++  ++  AF   +     ++   AF DQ   T  L     AI D     +P  L PI++GL++  I     +N+G A+NPARDL PR+  A+ GWG E FT  + ++W+P+V P++G V G L Y +FI +H
Sbjct:   11 NLVQR-LALKSCLAKETLSEFLGTFIMIVLGCGSIAQAVLSREKAGGIITINIGFATAVVMALYATFGVSGGHINPAVSFAMCTFGRMEWFKFPFYVGAQLLGAFVGAATVFGIYYDGLMAFA----DGKLLITGENGTAFIFATYPKPFVSVPGAFVDQVVSTMFLLLIVFAIFDSRNLGVPRGLEPIVIGLLIIVISCSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFTFGNNFWWIPVVGPMIGAVLGGLIYVLFIQMH 269          
BLAST of Aquaporin vs. Ensembl Mouse
Match: Aqp9 (aquaporin 9 [Source:MGI Symbol;Acc:MGI:1891066])

HSP 1 Score: 174.481 bits (441), Expect = 5.299e-52
Identity = 101/264 (38.26%), Postives = 157/264 (59.47%), Query Frame = 1
Query:   40 NLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV--QSTGAFFITSRSTSLLT---AFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            NL+ + L+L + +    L E  GTFI+IV G G I Q  LS  + G  ++I++G+  AV++A++ +  +  GH NPAV+ A  + GR+EW + PFY  AQ++GAF+G+  +F IYY+ ++ FA    DGK ++  ++  AF   +     ++   AF DQ   T  L     AI D     +P  L PI++GL++  I     +N+G A+NPARDL PR+  A+ GWG E FT  + ++W+P+V P++G V G L Y +FI +H
Sbjct:   11 NLVQR-LALKSCLAKETLSEFLGTFIMIVLGCGSIAQAVLSREKAGGIITINIGFATAVVMALYATFGVSGGHINPAVSFAMCTFGRMEWFKFPFYVGAQLLGAFVGAATVFGIYYDGLMAFA----DGKLLITGENGTAFIFATYPKPFVSVPGAFVDQVVSTMFLLLIVFAIFDSRNLGVPRGLEPIVIGLLIIVISCSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFTFGNNFWWIPVVGPMIGAVLGGLIYVLFIQMH 269          
BLAST of Aquaporin vs. Ensembl Mouse
Match: Aqp9 (aquaporin 9 [Source:MGI Symbol;Acc:MGI:1891066])

HSP 1 Score: 155.992 bits (393), Expect = 1.480e-44
Identity = 90/237 (37.97%), Postives = 141/237 (59.49%), Query Frame = 1
Query:  121 IVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV--QSTGAFFITSRSTSLLT---AFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            +V G G I Q  LS  + G  ++I++G+  AV++A++ +  +  GH NPAV+ A  + GR+EW + PFY  AQ++GAF+G+  +F IYY+ ++ FA    DGK ++  ++  AF   +     ++   AF DQ   T  L     AI D     +P  L PI++GL++  I     +N+G A+NPARDL PR+  A+ GWG E FT  + ++W+P+V P++G V G L Y +FI +H
Sbjct:   63 LVLGCGSIAQAVLSREKAGGIITINIGFATAVVMALYATFGVSGGHINPAVSFAMCTFGRMEWFKFPFYVGAQLLGAFVGAATVFGIYYDGLMAFA----DGKLLITGENGTAFIFATYPKPFVSVPGAFVDQVVSTMFLLLIVFAIFDSRNLGVPRGLEPIVIGLLIIVISCSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFTFGNNFWWIPVVGPMIGAVLGGLIYVLFIQMH 295          
BLAST of Aquaporin vs. Ensembl Mouse
Match: Aqp7 (aquaporin 7 [Source:MGI Symbol;Acc:MGI:1314647])

HSP 1 Score: 149.828 bits (377), Expect = 2.199e-42
Identity = 86/249 (34.54%), Postives = 137/249 (55.02%), Query Frame = 1
Query:   64 LHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFY 795
            L  +++   L E   T++++VFGLG +  + L  N  GS+L ++LG+GF V + V  +G +   H N AVT    ++GR+ W + P Y L Q +G+F  +   +LI+Y  I  FA     G  +V   ++T   F T      +L   F D+ F T +L  C  AITD+          P+++G++V+ +     MN+G A+NP+RDL PR+   + GWG++ F   + ++WVP+VAPLLG   G + Y
Sbjct:   14 LQKNMVREFLAEFLSTYVMMVFGLGSVAHMVLGENS-GSYLGVNLGFGFGVTMGVHVAGGISGAHMNAAVTFTNCALGRMTWKKFPVYVLGQFLGSFSAAATTYLIFYGAINHFAG----GDLLVTGSKATANIFATYLPEYMTLWRGFLDEAFVTGMLQLCLFAITDKKNSPALQGTEPLVIGILVTVLGVSLGMNSGYAINPSRDLPPRLFTFIAGWGKQVFRAGNNWWWVPVVAPLLGAYLGGIVY 257          
BLAST of Aquaporin vs. UniProt/SwissProt
Match: sp|P47862|AQP3_RAT (Aquaporin-3 OS=Rattus norvegicus OX=10116 GN=Aqp3 PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 2.615e-60
Identity = 114/272 (41.91%), Postives = 155/272 (56.99%), Query Frame = 1
Query:   22 SMKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFITSRSTSL--LTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
              K L+N   + L +   +L   L E  GT IL++FG G + QV LS   +G FL+I+L +GFAV LA+  +G++   H NPAVT A   + R  WI++P Y LAQ +GAFLG+ ++F +YY+ I  FA N    + +V     T   F T  S  L  +  FFDQF GT  L  C +AI D     +P  L    +GL+V  I      N+G A+NPARD GPR+  A+ GWG E FT    ++WVPIV+PLLG + G   Y++ IG HL 
Sbjct:    3 RQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLAILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWAFAGN----ELVVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGQNWWWVPIVSPLLGSIGGVFVYQLMIGCHLE 270          
BLAST of Aquaporin vs. UniProt/SwissProt
Match: sp|Q08DE6|AQP3_BOVIN (Aquaporin-3 OS=Bos taurus OX=9913 GN=AQP3 PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 2.820e-60
Identity = 115/272 (42.28%), Postives = 154/272 (56.62%), Query Frame = 1
Query:   22 SMKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFITSRSTSL--LTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
              K LVN   + L +   +L   L E  GT IL++FG G + QV LS   +G FL+I+L +GFAV L +  +G++   H NPAVT A   + R  WI++P Y LAQ +GAFLG+ ++F +YY+ I  FA N    + IV     T   F T  S  L  +  FFDQF GT  L  C +AI D     +P  L    +GL+V  I      N+G A+NPARD GPR+  A+ GWG E FT    ++WVPIV+PLLG + G   Y++ IG HL 
Sbjct:    3 RQKELVNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPVYTLAQTLGAFLGAGIIFGLYYDAIWAFANN----QLIVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTAIAGWGSEVFTTGRHWWWVPIVSPLLGSIAGVFVYQLMIGCHLE 270          
BLAST of Aquaporin vs. UniProt/SwissProt
Match: sp|A9Y006|AQP3_PIG (Aquaporin-3 OS=Sus scrofa OX=9823 GN=AQP3 PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.102e-59
Identity = 113/272 (41.54%), Postives = 153/272 (56.25%), Query Frame = 1
Query:   22 SMKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFITSRSTSL--LTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
              K LV    + L +   +L   L E  GT IL++FG G + QV LS   +G FL+I+L +GFAV L +  +G++   H NPAVT A   + R  WI++P Y LAQ +GAFLG+ ++F +YY+ I  FA N    + IV     T   F T  S  L  +  FFDQF GT  L  C +AI D +   +P  L    +GL+V  I      N+G A+NPARD GPR+  A+ GWG E FT    ++WVPI +PLLG + G   Y++ IG HL 
Sbjct:    3 RQKELVTRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPVYTLAQTLGAFLGAGIIFGLYYDAIWAFANN----QLIVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTASLIVCVLAIVDPNNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTAIAGWGSEVFTTGRHWWWVPIASPLLGSIAGVFVYQLMIGCHLE 270          
BLAST of Aquaporin vs. UniProt/SwissProt
Match: sp|Q8R2N1|AQP3_MOUSE (Aquaporin-3 OS=Mus musculus OX=10090 GN=Aqp3 PE=1 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.131e-59
Identity = 113/271 (41.70%), Postives = 154/271 (56.83%), Query Frame = 1
Query:   22 SMKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV--QSTGAFFITSRSTSL--LTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
              K L+N   + L +   +L   L E  GT IL++FG G + QV LS   +G FL+I+L +GFAV L +  +G++   H NPAVT A   + R  WI++P Y LAQ +GAFLG+ ++F +YY+ I  FA N+    F+     T   F T  S  L  +  FFDQF GT  L  C +AI D     +P  L    +GL+V  I      N+G A+NPARD GPR+  A+ GWG E FT    ++WVPIV+PLLG + G   Y++ IG HL 
Sbjct:    3 RQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYALAQTLGAFLGAGIVFGLYYDAIWAFANNE---LFVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGRHWWWVPIVSPLLGSIAGVFVYQLMIGCHLE 270          
BLAST of Aquaporin vs. UniProt/SwissProt
Match: sp|Q92482|AQP3_HUMAN (Aquaporin-3 OS=Homo sapiens OX=9606 GN=AQP3 PE=1 SV=2)

HSP 1 Score: 194.126 bits (492), Expect = 9.624e-59
Identity = 112/271 (41.33%), Postives = 153/271 (56.46%), Query Frame = 1
Query:   22 SMKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV--QSTGAFFITSRSTSL--LTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
              K LV+   + L +   +L   L E  GT IL++FG G + QV LS   +G FL+I+L +GFAV L +  +G++   H NPAVT A   + R  WI++P Y LAQ +GAFLG+ ++F +YY+ I  FA   D+  F+     T   F T  S  L  +  FFDQF GT  L  C +AI D     +P  L    +GL+V  I      N+G A+NPARD GPR+  A+ GWG   FT    ++WVPIV+PLLG + G   Y++ IG HL 
Sbjct:    3 RQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWHFA---DNQLFVSGPNGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSAVFTTGQHWWWVPIVSPLLGSIAGVFVYQLMIGCHLE 270          
BLAST of Aquaporin vs. TrEMBL
Match: A0A430Q1N5 (Aquaporin-3 OS=Schistosoma bovis OX=6184 GN=DC041_0007317 PE=3 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 1.413e-91
Identity = 141/262 (53.82%), Postives = 190/262 (72.52%), Query Frame = 1
Query:   43 LIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNN---QYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHL 819
            + D+     + ++ A LGE  G+ IL++FG GV+ QV L ++    +G+F+SIS+GWGFAV +AV +SG+ G GH NPAVTLA A +G+L + R+PFY   Q++GAFLGSLV+F +Y EKI ++A   D+GK +V STG  F+T+ S S LT F DQ  GT LL + A AITD +G+ LPDYLHP+ L  MV  IVGCFA+NAGAALNPARDLGPR+MI + GWG +AF+  +++FW+PI  P +G V GA+ YE+ IG+HL
Sbjct:   15 IADRLRLTSSPLVRACLGEFMGSIILMIFGSGVLAQVILGDHGRHAHGTFISISMGWGFAVYMAVMFSGQCGSGHCNPAVTLAAAVVGKLPFRRIPFYTFFQILGAFLGSLVVFALYREKITEYADLHDNGKLLVNSTGGIFVTNPSASHLTCFLDQILGTALLTAGAFAITDPNGWKLPDYLHPLHLAFMVYAIVGCFALNAGAALNPARDLGPRLMIFIFGWGNQAFSGGNYFFWIPIAGPYIGAVIGAVLYELTIGIHL 276          
BLAST of Aquaporin vs. TrEMBL
Match: A0A5K4F7U6 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 7.911e-90
Identity = 136/260 (52.31%), Postives = 189/260 (72.69%), Query Frame = 1
Query:   49 DKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNN---QYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHL 819
            D+     + ++ A LGE  G+ IL++FG GV+ QV L ++    +G+F+S+SLGWGFAV +AV +SG+ G GH NPAVTLA A +G+L + R+PFY   Q++GAFLGSLV+F +Y EKI+++A   D+G  ++ +TG  F+T+ S S LT F DQ  GT LL + A AITD +G+ +PDYLHP+ L  +V  IVGCFA+NAGAALNPARDLGPR+MI + GWG +AF+  +++FW+PIV P +G V G + YE+ IG+HL
Sbjct:   17 DRLRLTSSPLVRACLGEFMGSIILMIFGSGVLAQVILGDHGKHAHGTFISVSLGWGFAVYMAVMFSGQCGSGHCNPAVTLAAAVVGKLPFRRIPFYTFFQILGAFLGSLVVFALYREKIIEYAKLNDNGALLLNTTGGIFVTNPSASHLTCFLDQVMGTALLTAGAFAITDPNGWKIPDYLHPLHLAFLVYAIVGCFALNAGAALNPARDLGPRLMIFIFGWGNKAFSGANYFFWIPIVGPYIGAVIGGILYEMTIGIHL 276          
BLAST of Aquaporin vs. TrEMBL
Match: C4PYI6 (Aquaporin OS=Schistosoma mansoni OX=6183 GN=AQP1 PE=2 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 7.998e-90
Identity = 136/260 (52.31%), Postives = 189/260 (72.69%), Query Frame = 1
Query:   49 DKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNN---QYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHL 819
            D+     + ++ A LGE  G+ IL++FG GV+ QV L ++    +G+F+S+SLGWGFAV +AV +SG+ G GH NPAVTLA A +G+L + R+PFY   Q++GAFLGSLV+F +Y EKI+++A   D+G  ++ +TG  F+T+ S S LT F DQ  GT LL + A AITD +G+ +PDYLHP+ L  +V  IVGCFA+NAGAALNPARDLGPR+MI + GWG +AF+  +++FW+PIV P +G V G + YE+ IG+HL
Sbjct:   17 DRLRLTSSPLVRACLGEFMGSIILMIFGSGVLAQVILGDHGKHAHGTFISVSLGWGFAVYMAVMFSGQCGSGHCNPAVTLAAAVVGKLPFRRIPFYTFFQILGAFLGSLVVFALYREKIIEYAKLNDNGALLLNTTGGIFVTNPSASHLTCFLDQVMGTALLTAGAFAITDPNGWKIPDYLHPLHLAFLVYAIVGCFALNAGAALNPARDLGPRLMIFIFGWGNKAFSGANYFFWIPIVGPYIGAVIGGILYEMTIGIHL 276          
BLAST of Aquaporin vs. TrEMBL
Match: C1L817 (Aquaporin-9 OS=Schistosoma japonicum OX=6182 GN=EWB00_004792 PE=2 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 2.826e-89
Identity = 137/262 (52.29%), Postives = 189/262 (72.14%), Query Frame = 1
Query:   43 LIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNN---QYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHL 819
            + D+     + +L A LGE  G+ IL++FG GV+ QV L ++    +G+F+S+SLGWGFAV + VF+SG+ G GH NPAVTLA A +G+L + RVPFY   Q++GAFLGSLV+F +Y EKIL++A   D  K ++ STG  F+T+ S S LT F DQ  GT LL + A AI D +G++LPD+LHP+ L  +V  +VGCFA+NAGAALNPARDLGPR+MI + GWG +AF+  +++FW+PIV P +G + G + YE+ IG+HL
Sbjct:   15 MADRLRLTSSPLLRACLGEFIGSVILLIFGSGVLAQVFLGDHGKHAHGTFISVSLGWGFAVYMGVFFSGQCGSGHINPAVTLASAIVGKLPFRRVPFYTFVQLLGAFLGSLVVFAVYREKILEYARLHDHDKLLLNSTGGIFVTNPSASHLTCFLDQILGTALLTAGAFAIIDRNGWNLPDHLHPLHLAFLVYALVGCFALNAGAALNPARDLGPRLMIFLFGWGSQAFSGANYFFWIPIVGPYIGAIIGGVLYELTIGIHL 276          
BLAST of Aquaporin vs. TrEMBL
Match: Q5DH56 (Aquaporin-9 (AQP-9) (Small solute channel 1) OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 3.666e-89
Identity = 137/262 (52.29%), Postives = 189/262 (72.14%), Query Frame = 1
Query:   43 LIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNN---QYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHL 819
            + D+     + +L A LGE  G+ IL++FG GV+ QV L ++    +G+F+S+SLGWGFAV + VF+SG+ G GH NPAVTLA A +G+L + RVPFY   Q++GAFLGSLV+F +Y EKIL++A   D  K ++ STG  F+T+ S S LT F DQ  GT LL + A AI D +G++LPD+LHP+ L  +V  +VGCFA+NAGAALNPARDLGPR+MI + GWG +AF+  +++FW+PIV P +G + G + YE+ IG+HL
Sbjct:   15 MADRLRLTSSPLLRACLGEFIGSVILLIFGSGVLAQVFLGDHGKHAHGTFISVSLGWGFAVYMGVFFSGQCGSGHINPAVTLASAIVGKLPFRRVPFYTFVQLLGAFLGSLVVFAVYREKILEYARLHDHDKLLLNSTGGIFVTNPSASHLTCFLDQILGTALLTAGAFAIIDRNGWNLPDHLHPLHLAFLVYALVGCFALNAGAALNPARDLGPRLMIFLFGWGSQAFSGANYFFWIPIVGPYIGAIIGGVLYELTIGIHL 276          
BLAST of Aquaporin vs. Ensembl Cavefish
Match: ENSAMXT00000015220.2 (aquaporin-9-like [Source:NCBI gene;Acc:103027797])

HSP 1 Score: 191.045 bits (484), Expect = 1.949e-58
Identity = 101/259 (39.00%), Postives = 154/259 (59.46%), Query Frame = 1
Query:   46 IDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            + ++ +L + I    L E  GTF+L++FG G + Q  LS N  G  L+I LG+   +M+ V+ +G +  GH NPAV+LA   +G+L+  + P Y +AQ +GAF G+  +F +YY+  +DF +       I  +TG  F +   R  ++L  F DQ FGT +L  C +AITD      P  + P+ +GL++ GI     MN G  LNPARDLGPR+  A+ GWG E F+  D+++W+P+  PL+GG+ GA+ Y + I +H
Sbjct:    1 MKQHCALKHGIFKEFLAEFLGTFVLVLFGCGSVAQTVLSRNTLGEPLTIHLGFTTGLMMGVYVAGGVSGGHLNPAVSLAMVILGKLKIWKFPIYVIAQFLGAFAGAAGVFGLYYDAFMDFTSGILSVTGI-NATGHIFASYPGRHLTVLGGFIDQVFGTGMLVLCILAITDGKNIGAPKGVEPLAIGLIILGISVSMGMNCGYPLNPARDLGPRLFTAVAGWGMEVFSTADYWWWIPVAGPLIGGITGAVVYFLLIELH 258          
BLAST of Aquaporin vs. Ensembl Cavefish
Match: aqp10a (aquaporin 10a [Source:ZFIN;Acc:ZDB-GENE-040718-40])

HSP 1 Score: 188.348 bits (477), Expect = 2.507e-57
Identity = 104/255 (40.78%), Postives = 149/255 (58.43%), Query Frame = 1
Query:   70 NSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHL 819
            N +    LGE+ GTF+L++FG     QV+   +  G FLS +L +   VM A++ S  +   H NPAV+L+F  +G L W ++  Y L+QV+GA+L S V+F +YY+ I++++     G   V     T + F T  S   SL T FFDQ  GT  L  C + + D+     P+ L P ++  +V GI    + N G A+NPARDLGPR+     GWG E FT+  ++FWVP+VAPL+G V G++FY VFI  HL
Sbjct:   16 NDLARECLGEIIGTFVLLLFGCSGAAQVKTGRDMKGQFLSANLSFAVGVMSAMYLSMGVSGAHLNPAVSLSFCVLGNLPWRKLLPYSLSQVLGAYLASAVVFFMYYDAIMEYSG----GVLTVTGPNETASIFATYPSEGMSLQTNFFDQVVGTATLLLCILPLNDKRNRPAPEALLPPIVAAVVLGIAMSMSSNCGGAINPARDLGPRLFTFTAGWGTEVFTSFSYFFWVPLVAPLVGAVLGSIFYLVFIQWHL 266          
BLAST of Aquaporin vs. Ensembl Cavefish
Match: aqp9b (aquaporin 9 [Source:NCBI gene;Acc:103043118])

HSP 1 Score: 178.333 bits (451), Expect = 1.093e-53
Identity = 97/262 (37.02%), Postives = 148/262 (56.49%), Query Frame = 1
Query:   46 IDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            + +  +L   IL   L E+ GTF+LI+FG G + Q  LS    G  L+I +G+   VMLAV+ +G +  GH NPAV+LA   +G+L   + P Y +AQ +GAF GS  +F +YY+ ++D      +G  +V    +T   F +  ++  S+L  F DQ  GT  L  C +AI D      P  + P+++GL +  I     +N G  +NPARDLGPR+  A+ GWG + F     ++W+P+  P++GGV GA+ Y + I +H
Sbjct:    9 LRERCALKQDILREFLAEILGTFVLILFGCGSVAQTVLSKGALGEPLTIHIGFTTGVMLAVYMAGGVSGGHVNPAVSLAMVVLGKLPLKKFPVYVVAQFIGAFAGSCAVFGLYYDALMDHT----NGVLLVTGENATANIFASYPAKHLSVLNGFIDQVVGTGALVLCILAIVDRKNMGAPKGMEPLIIGLTILAIGVSMGLNCGYPINPARDLGPRLFTAIAGWGMDVFRAGGCWWWIPVAGPMVGGVVGAVIYFLVIELH 266          
BLAST of Aquaporin vs. Ensembl Cavefish
Match: aqp3a (aquaporin-3-like [Source:NCBI gene;Acc:103047125])

HSP 1 Score: 176.792 bits (447), Expect = 4.766e-53
Identity = 95/267 (35.58%), Postives = 146/267 (54.68%), Query Frame = 1
Query:   22 SMKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
              K  ++ + + L + N ++   L E  GT IL++FG G + Q  LS   +G FL+++L +GFA  L +   G++  GH NPAVT A   +GR +W + P Y+L Q +GAFLG+ V+F +Y++ +    A   + +  +     +       S +  FFDQ  GT  L  C +AI D     +P  L    +G  V  I      N+G A+NPARDLGPR+  ++ GWG   FTN +++F VPI AP LG + G + Y++ +G H+ 
Sbjct:    3 KQKIFLDKLSQSLQIRNLLVRQGLAECLGTLILVMFGCGSVAQFTLSGGTHGIFLAVNLAFGFAATLGILVCGQVSGGHLNPAVTFALCLLGREKWRKFPVYFLFQTLGAFLGAGVIFGLYFDALQRKVAETPNNELPIGIFATY--PGEHLSTVNGFFDQLIGTAALIVCILAIVDPFNNPIPQGLEAFTVGFTVLVIGLSMGFNSGYAVNPARDLGPRLFTSIAGWGSRVFTNGNYWFLVPIFAPFLGTIVGVIVYQLMVGWHVE 267          
BLAST of Aquaporin vs. Ensembl Cavefish
Match: aqp3a (aquaporin-3-like [Source:NCBI gene;Acc:103047125])

HSP 1 Score: 176.792 bits (447), Expect = 4.766e-53
Identity = 95/267 (35.58%), Postives = 146/267 (54.68%), Query Frame = 1
Query:   22 SMKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
              K  ++ + + L + N ++   L E  GT IL++FG G + Q  LS   +G FL+++L +GFA  L +   G++  GH NPAVT A   +GR +W + P Y+L Q +GAFLG+ V+F +Y++ +    A   + +  +     +       S +  FFDQ  GT  L  C +AI D     +P  L    +G  V  I      N+G A+NPARDLGPR+  ++ GWG   FTN +++F VPI AP LG + G + Y++ +G H+ 
Sbjct:    3 KQKIFLDKLSQSLQIRNLLVRQGLAECLGTLILVMFGCGSVAQFTLSGGTHGIFLAVNLAFGFAATLGILVCGQVSGGHLNPAVTFALCLLGREKWRKFPVYFLFQTLGAFLGAGVIFGLYFDALQRKVAETPNNELPIGIFATY--PGEHLSTVNGFFDQLIGTAALIVCILAIVDPFNNPIPQGLEAFTVGFTVLVIGLSMGFNSGYAVNPARDLGPRLFTSIAGWGSRVFTNGNYWFLVPIFAPFLGTIVGVIVYQLMVGWHVE 267          
BLAST of Aquaporin vs. Ensembl Sea Lamprey
Match: aqp3b (aquaporin 3b [Source:ZFIN;Acc:ZDB-GENE-040724-66])

HSP 1 Score: 210.69 bits (535), Expect = 7.748e-67
Identity = 112/262 (42.75%), Postives = 164/262 (62.60%), Query Frame = 1
Query:   37 VNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFI-TSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHL 819
            +  + + L + N+++   + E  GT+IL++FG G + QVELS    G FL+I+L +GFAV + +  +  +  GH NPAVT AFA +GR EW ++P Y LAQ++GAF+G+  +F +YY+  L FAAN   G + +Q  G F    S   SL   F DQ  GT  L  C +A+ D+     P  + P ++GL+V  I      NAG A+NPARDLGPR+  ++ GWG   F++ +++ WVP+VAP++GGV GA FYE+F+G HL
Sbjct:    8 IKRLQRRLFIRNTLVCEAMAEFVGTYILVLFGCGSVAQVELSGGLKGQFLTINLAFGFAVTMGLHAAAGVSGGHLNPAVTFAFAVLGRFEWHKLPLYMLAQLLGAFMGAGTVFGLYYDAFL-FAAN---GNYTIQLAGVFATYPSEHLSLGNGFVDQLIGTAALLVCIMAVIDKRNNPAPKGMQPYIIGLVVVLIGLSMGFNAGYAVNPARDLGPRLFTSIAGWGWAVFSSGNYWSWVPVVAPMIGGVLGAFFYELFVGFHL 265          
BLAST of Aquaporin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008324.1 (pep scaffold:Pmarinus_7.0:GL479140:275:9118:1 gene:ENSPMAG00000007511.1 transcript:ENSPMAT00000008324.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 6.723e-49
Identity = 102/254 (40.16%), Postives = 148/254 (58.27%), Query Frame = 1
Query:   70 NSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQ---STGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            N I+   L E  GTF+LIVFG G + QVELS++  G  L+I+L + F V++  + S  +   H NPAV+ + + IGR  W ++P + LAQ +GAF  +  ++ +Y+E ++ F    + G   V    +T A F T  S   S+   F DQ  GT LL  C +A+ D     +P  L P+++GL+V  I      NAG A+NPARDLGPR+  AM G+G E FT    ++WVP+VAPL+GG  G + Y  F+ +H
Sbjct:   19 NPIVREALAEFLGTFVLIVFGCGSVAQVELSHHSAGETLTINLAFAFGVVMGAYLSWGISGAHLNPAVSFSMSLIGRFHWWKLPIFCLAQFLGAFTAAATVYGLYHEALMAF----NGGNLTVTGPGATAAIFATYPSEHLSIAGGFLDQVLGTALLLLCVMALLDPKNNAVPRGLEPLLVGLVVLVIGLSMGFNAGYAINPARDLGPRVFTAMVGYGSEVFTMGPHWWWVPVVAPLVGGPLGTMCYIFFVDLH 268          
BLAST of Aquaporin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003222.1 (pep scaffold:Pmarinus_7.0:GL490162:5550:6590:-1 gene:ENSPMAG00000002946.1 transcript:ENSPMAT00000003222.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 3.309e-25
Identity = 49/104 (47.12%), Postives = 66/104 (63.46%), Query Frame = 1
Query:  505 FFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
              GT  L  C +A+ D     +P  L P+++GL V GI    A N+G A+NPARD GPR+  AM G+GRE FT    ++WVPI+APL+GG  GAL Y +F+ +H
Sbjct:    1 LLGTAELLLCIMALLDSKNNAVPRGLEPLLIGLAVFGISLSMAFNSGCAINPARDFGPRLFTAMAGYGREVFTVGPHWWWVPIIAPLMGGPLGALCYILFVDLH 104          
BLAST of Aquaporin vs. Ensembl Sea Lamprey
Match: aqp8a.1 (aquaporin 8a, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040912-106])

HSP 1 Score: 47.3654 bits (111), Expect = 9.432e-7
Identity = 36/99 (36.36%), Postives = 52/99 (52.53%), Query Frame = 1
Query:   97 ELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEK 393
            EL G+F  I  G    L V  + +  G+ L  +L  G A+ L +   GKL  GH NPAVT   A +G +    V  YW++Q+VG  LG+L+   +  E+
Sbjct:   48 ELVGSFFFIFIG---CLSVITNPSDTGA-LQPALAHGLALGLCIAVLGKLSGGHFNPAVTAGVAVVGGVSLRLVIPYWVSQLVGGMLGALLARGVVGEE 142          
BLAST of Aquaporin vs. Ensembl Yeast
Match: AQY3 (Putative channel-like protein; similar to Fps1p; mediates passive diffusion of glycerol in the presence of ethanol [Source:SGD;Acc:S000001840])

HSP 1 Score: 129.028 bits (323), Expect = 9.419e-34
Identity = 73/211 (34.60%), Postives = 115/211 (54.50%), Query Frame = 1
Query:   97 ELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFI-VQSTGAFFITSRSTSLL--TAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAF 720
            E  GT +L++FG+G  LQ  ++    GS+ S+S  WGF  ML V+ +G +  GH NPAVT++ A   +  W +VP Y +AQ++GA+ G  + +  ++  I +F      G  I   +TGA   T   + +    AFFD+F G  +L  C +A+ D+      + +  +++G +V+ I           +NPARDLGPRI  +M G+G  AF
Sbjct:  353 EFLGTLVLVIFGVGGNLQATVTKGSGGSYESLSFAWGFGCMLGVYVAGGISGGHINPAVTISMAIFRKFPWKKVPVYIVAQIIGAYFGGAMAYGYFWSSITEFEG----GPHIRTTATGACLFTDPKSYVTWRNAFFDEFIGASILVGCLMALLDDSNAPPGNGMTALIIGFLVAAIGMALGYQTSFTINPARDLGPRIFASMIGYGPHAF 559          
BLAST of Aquaporin vs. Ensembl Yeast
Match: FPS1 (Aquaglyceroporin, plasma membrane channel; involved in efflux of glycerol and xylitol, and in uptake of acetic acid, arsenite, and antimonite; key factor in maintaining redox balance by mediating passive diffusion of glycerol; phosphorylated by Hog1p MAPK under acetate stress; deletion improves xylose fermentation; regulated by Rgc1p and Ask10p, which are regulated by Hog1p phosphorylation under osmotic stress; phosphorylation by Ypk1p required to maintain an open state [Source:SGD;Acc:S000003966])

HSP 1 Score: 103.605 bits (257), Expect = 5.202e-25
Identity = 83/295 (28.14%), Postives = 141/295 (47.80%), Query Frame = 1
Query:   46 IDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQV----ELSNNQY--------------------------------GSFLSISLGWGFAVMLAVFWSG--KLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLT--AFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAF-TNLDFYFWVPIVAPLLGGVFGALFYEVFI 807
            I+K+ S+ N+ L   L E  GT ++I+FG  V+ QV    ++  + +                                G+F  ++LGW  AV++  F +G   +   H NP++TLA          +VP+Y+  Q++GAF G+L+LF I+Y+++L  A +     ++ +S    F       L +   FF +F    +L +   A+TD     L   + P+M+ +++  I    A   G A+N ARDLGPR+ +   G+  +    +   +FWVP+V P +G + G L Y+V I
Sbjct:  242 INKWSSVKNTYLKEFLAEFMGTMVMIIFGSAVVCQVNVAGKIQQDNFNVALDNLNVTGSSAETIDAMKSLTSLVSSVAGGTFDDVALGWAAAVVMGYFCAGGSAISGAHLNPSITLANLVYRGFPLKKVPYYFAGQLIGAFTGALILF-IWYKRVLQEAYSD---WWMNESVAGMFCVFPKPYLSSGRQFFSEFLCGAMLQAGTFALTDPYTC-LSSDVFPLMMFILIFIINASMAYQTGTAMNLARDLGPRLALYAVGFDHKMLWVHHHHFFWVPMVGPFIGALMGGLVYDVCI 531          
BLAST of Aquaporin vs. Ensembl Nematostella
Match: EDO45027 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU63])

HSP 1 Score: 186.422 bits (472), Expect = 2.263e-57
Identity = 113/259 (43.63%), Postives = 149/259 (57.53%), Query Frame = 1
Query:   58 LSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFITSRSTSLLT--AFFDQFFGTFLLASCAIAITDEDGFDLPDY-LHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            +  H+ I+ + L E   TFIL+ FG G I Q+ LSN   G+F S++  WG  V L  +W+G +   H NPAVTLAFA   RL W  V  Y LAQ++GAF  S  ++ +Y++ +  F    D+G   V   ++T   + T     L T  AF DQ FGT LL  C  AI D+   + PD    PI++GL V  I   F  N G A+NPARDLGPR+  AM GWG E FT    + WVP+VA L+GGV GAL Y +F+ +H
Sbjct:   11 MRTHSPIIRSFLAEFIATFILVSFGCGSIAQMLLSNETKGTFFSVNFSWGIGVTLGCYWAGGISGAHMNPAVTLAFAVARRLPWRFVLVYCLAQLLGAFAASACVYGVYHDALNHF----DNGIRNVTGEKATAGVWATYPQPWLSTQGAFGDQVFGTMLLTGCIFAILDKHN-NAPDKGTAPILIGLTVFCIGTAFGFNCGYAINPARDLGPRLFTAMAGWGGEVFTVYHSFAWVPVVACLVGGVAGALIYMLFVEIH 264          
BLAST of Aquaporin vs. Ensembl Nematostella
Match: EDO45028 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU64])

HSP 1 Score: 176.792 bits (447), Expect = 4.052e-53
Identity = 102/247 (41.30%), Postives = 139/247 (56.28%), Query Frame = 1
Query:   91 LGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFITSRSTSLLT--AFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            L E   TFILIVFG+G + Q  LSN  +G+F SI+  WG  V +  + +G +   H NPAVT+AFA + RL W +VP Y LAQ++GAF  S  ++ +YY+ + +F    D G   +   + T   + T     L T   F DQ F T LL S   AI D+        + P+++GL+V  I   F  N G A+NPARDLGPR+  A+ GWG   FT  + + WVP V  ++GG+ GA FY   I VH
Sbjct:   21 LAEFTSTFILIVFGVGSVAQSVLSNQTHGTFFSINFSWGMGVTMGCYMAGGVSGAHMNPAVTVAFAVVRRLRWWKVPVYILAQMLGAFTASACVYGVYYDALNNF----DGGTRQILGPKGTAGIWATYPQPFLTTWVGFADQLFATALLVSGVFAIVDKKNVGPDRTIAPVLIGLLVFVIGATFGFNCGYAINPARDLGPRLFTAVAGWGSGVFTAGNNWSWVPCVGCIIGGILGAWFYMALIEVH 263          
BLAST of Aquaporin vs. Ensembl Nematostella
Match: EDO40995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5L0])

HSP 1 Score: 101.293 bits (251), Expect = 3.009e-26
Identity = 45/101 (44.55%), Postives = 63/101 (62.38%), Query Frame = 1
Query:   91 LGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEK 393
            + E   TFILI+FG G + Q  LS   +G+F SI+  WG  V +  +W+G +   H NPAVTLA A   R +W RV F+W AQ+ GAF+G+  ++ +YYE 
Sbjct:   16 MAEFIATFILIIFGCGSVAQAVLSRQSHGTFFSINFSWGVGVTMGCYWAGGISGAHMNPAVTLALAVTRRFQWRRVAFFWAAQLTGAFVGAACVYGVYYES 116          
BLAST of Aquaporin vs. Ensembl Nematostella
Match: EDO28882 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T581])

HSP 1 Score: 89.7373 bits (221), Expect = 2.023e-22
Identity = 47/104 (45.19%), Postives = 63/104 (60.58%), Query Frame = 1
Query:   76 ILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYY 387
            I+ + L E   TFIL+ FG G I Q+ LSN   G+F S++  WG  V L  +W+G +   H NPAVTLAFA   RL W  V  Y LAQ++GAF  S  ++ +Y+
Sbjct:    1 IIRSFLAEFIATFILVSFGCGSIAQMLLSNETKGTFFSVNFSWGIGVTLGCYWAGGISGAHMNPAVTLAFAVARRLPWRFVLVYCLAQLLGAFAASACVYGVYH 104          
BLAST of Aquaporin vs. Ensembl Nematostella
Match: EDO28361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6P4])

HSP 1 Score: 67.781 bits (164), Expect = 2.764e-13
Identity = 72/239 (30.13%), Postives = 105/239 (43.93%), Query Frame = 1
Query:   91 LGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIR-VPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVF 804
            + E  GTF L+  G G I+  E SN   G  + I+L +G  +   ++  G +   H NP+VT+A   IG+L   R   FY LAQ++GA L S +L  ++ E +               S GA   T  S  LL +F  +F  TF L    + IT +  F     L   ++   +    G  +   G + NPAR L P ++          FT L    W+ I AP LG +   L +  F
Sbjct:    5 VAEFIGTFALVFCGTGAIIVNEQSNGSLG-LIGIALTFGIIISAMIYVFGNISGTHINPSVTIALV-IGKLTLKRDALFYILAQILGAILASSLLKFMFTENL---------------SLGA---TIPSGELLQSFILEFVLTFFLMLTILGITSKKEFTNIVGLIIGIVVTGIILFAGPIS---GGSFNPARSLAPALI-------SGNFTAL----WIYIAAPTLGAIVAMLIWNSF 209          
BLAST of Aquaporin vs. Ensembl Medaka
Match: aqp3a (aquaporin-3 [Source:NCBI gene;Acc:101163089])

HSP 1 Score: 193.356 bits (490), Expect = 2.756e-59
Identity = 101/269 (37.55%), Postives = 149/269 (55.39%), Query Frame = 1
Query:   22 SMKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLH 822
              K +++ + +   + N +L   L E  GT IL++FG G   Q  LS   +G F++++  +GF   L +   G++  GH NPAVT A   +GR  W + P Y+L Q +GAF G+ ++F +YY+ + DF  + +    +   T   F T  ++  +LL  FFDQF GT  L  C +AI D     +P  L    +G +V  I      N+G A+NPARDLGPRI  AM GWG E FT  D +F +PI AP LG +FG + Y++ +G H+ 
Sbjct:    3 RQKIILDKLARTFQIRNKLLRQSLAECLGTLILVMFGCGACAQHVLSEGSHGRFMTVNFAFGFGATLGILVCGQVSGGHLNPAVTFALCLLGRERWRKFPMYFLFQTIGAFFGAAIIFGMYYDALWDFPESFNMN--VTSPTAGIFSTYPAKHLTLLNGFFDQFIGTSALIVCILAIVDPYNNPIPQGLEAFTVGFVVLVIGLSMGFNSGYAVNPARDLGPRIFTAMAGWGMEVFTARDGWFLIPIFAPFLGAIFGTMIYQLMVGFHVE 269          
BLAST of Aquaporin vs. Ensembl Medaka
Match: aqp10a (aquaporin-10 [Source:NCBI gene;Acc:101174130])

HSP 1 Score: 176.407 bits (446), Expect = 7.280e-53
Identity = 97/257 (37.74%), Postives = 151/257 (58.75%), Query Frame = 1
Query:   52 KYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFI 807
            + L   ++++   + E  GTFIL++FG     QV+ SN + G FLS+++ +   VM A++ +  +   H NPAVTL+F  +G++ W R+  Y L QV+GA++ SL+++L+YY+ I++++     G   V     T + F T      S+  +F DQ  GT LL  C + + ++     P  L P ++ +MV GI    + N G A+NPARDLGPR+     GWG E FT  +++FWVPIV PLLGG+ G+  Y +FI
Sbjct:    5 RILRCRSALIRECMAEFLGTFILLLFGCSAAAQVKTSNEKNGQFLSVNMAFSVGVMSAMYLTKGISGAHLNPAVTLSFCILGKVNWGRLLPYSLFQVLGAYMASLMVYLVYYDAIMEYSG----GNLTVYGQNETASIFATYPKEFVSVGRSFLDQVVGTGLLLLCILCLDEKRNTPAPPDLIPAIVAVMVLGIAMSLSANCGGAINPARDLGPRLFTLTAGWGTEVFTCYNYWFWVPIVGPLLGGILGSFIYLIFI 257          
BLAST of Aquaporin vs. Ensembl Medaka
Match: ENSORLT00000031617.1 (aquaporin-9-like [Source:NCBI gene;Acc:101172729])

HSP 1 Score: 172.17 bits (435), Expect = 3.972e-51
Identity = 95/259 (36.68%), Postives = 153/259 (59.07%), Query Frame = 1
Query:   46 IDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            + ++ ++ + I   +L E  GTF+L++FG G + Q  LS N  G  L+I +G+   + +AV+ +G +  GH NPAV+LA   +G+L+  + PFY +AQ +GAF G+  +F +YY+  +DF  N       + +T   F +  +R  S+L  F DQ  GT +L  C +AI D      P  + P+ +GL++  I     +N G  LNPARDLGPR+  A+ GWG E F+  D+++W+P+  P++GGV GA+ Y + + +H
Sbjct:    1 MRQHCAIKHGIFKEILAEFLGTFVLVLFGCGSVAQTILSRNTLGEPLTIHIGFSVGLAMAVYVAGGVSGGHVNPAVSLAMVILGKLKIWKFPFYVIAQFLGAFAGAAAVFGLYYDAFMDFT-NGILSVTGINATAHIFASYPARHLSVLGGFIDQVVGTGMLVLCILAIIDGGNIGAPKGVEPLAIGLILMAISVSMGLNCGYPLNPARDLGPRLFTAVAGWGMEVFSTADYWWWIPVAGPMVGGVVGAVLYFLLVEMH 258          
BLAST of Aquaporin vs. Ensembl Medaka
Match: aqp9b (aquaporin 9 [Source:NCBI gene;Acc:101162108])

HSP 1 Score: 168.703 bits (426), Expect = 6.043e-50
Identity = 93/262 (35.50%), Postives = 142/262 (54.20%), Query Frame = 1
Query:   46 IDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            + +   L   I    L E  G F+LI+FG G + Q  LS    G  L+I +G+   VM+AV+ +G +  GH NPAV+LA   +G+L   + P Y  AQ +GAF GS  +F +YY+ + +F     +G+F V    +T   F +  ++  S++  F DQ   T  L  C +AITD      P  + P+ +GL++  I     +N G  +NPARDLGPR+  A+ GWG + F     ++W+P+  P++GG  GA  Y + I +H
Sbjct:    9 MKEKFGLRRDIFKEFLAEFLGIFVLILFGCGSVAQAVLSKGALGEPLTIHVGFTLGVMMAVYIAGGVSGGHVNPAVSLAMVILGKLPLKKFPVYVAAQFLGAFAGSCAVFGLYYDALREFT----NGEFAVTGANATAGIFASYPAKHLSVINGFVDQVIATAALVLCILAITDRKNIGAPKGMEPLCIGLIILAIGVSMGLNCGYPINPARDLGPRLFTAVAGWGMDVFRAGGCWWWIPVAGPMVGGAVGAGIYFLIIDLH 266          
BLAST of Aquaporin vs. Ensembl Medaka
Match: aqp9b (aquaporin 9 [Source:NCBI gene;Acc:101162108])

HSP 1 Score: 168.703 bits (426), Expect = 6.043e-50
Identity = 93/262 (35.50%), Postives = 142/262 (54.20%), Query Frame = 1
Query:   46 IDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIV---QSTGAFFIT--SRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVH 816
            + +   L   I    L E  G F+LI+FG G + Q  LS    G  L+I +G+   VM+AV+ +G +  GH NPAV+LA   +G+L   + P Y  AQ +GAF GS  +F +YY+ + +F     +G+F V    +T   F +  ++  S++  F DQ   T  L  C +AITD      P  + P+ +GL++  I     +N G  +NPARDLGPR+  A+ GWG + F     ++W+P+  P++GG  GA  Y + I +H
Sbjct:    9 MKEKFGLRRDIFKEFLAEFLGIFVLILFGCGSVAQAVLSKGALGEPLTIHVGFTLGVMMAVYIAGGVSGGHVNPAVSLAMVILGKLPLKKFPVYVAAQFLGAFAGSCAVFGLYYDALREFT----NGEFAVTGANATAGIFASYPAKHLSVINGFVDQVIATAALVLCILAITDRKNIGAPKGMEPLCIGLIILAIGVSMGLNCGYPINPARDLGPRLFTAVAGWGMDVFRAGGCWWWIPVAGPMVGGAVGAGIYFLIIDLH 266          
BLAST of Aquaporin vs. Planmine SMEST
Match: SMESG000067985.1 (SMESG000067985.1)

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 294/294 (100.00%), Postives = 294/294 (100.00%), Query Frame = 1
Query:   25 MKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLHXXXXXXXXXXXXXXXLIGSAETEVKVVG 906
            MKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLHAKSKKSMSNNSANSKLIGSAETEVKVVG
Sbjct:    1 MKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVFIGVHLHAKSKKSMSNNSANSKLIGSAETEVKVVG 294          
BLAST of Aquaporin vs. Planmine SMEST
Match: SMESG000023346.1 (SMESG000023346.1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.151e-17
Identity = 64/241 (26.56%), Postives = 110/241 (45.64%), Query Frame = 1
Query:   85 AMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGF-DLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEVF 804
            A+  E  GTFIL+  GLG   +        G  L ++L +G    + ++ S  L  GH NPAV++      ++ ++R   Y L Q++GA L +  + L+ YE       NK  G           I+        A + +   +F+L    + +  E    ++   L  +++G+ ++  V C A  +G ++NPAR LGP I+           +N+    W+ IV PL+GG+   L  ++F
Sbjct:   30 ALFAEFLGTFILVFIGLGACYE-------NGDVLKVALAFGLGGAIGIYISAPLSGGHINPAVSVGLLVARQISFVRCILYILFQIIGALLAAKSISLMTYE-----TYNKTHG-----------ISHAHAPWDKALYCEIIISFVLVFTVMRMCVEKSRSEVEKGLAALLIGISITVGVLCGANISGGSMNPARSLGPAIV----------HSNMKL-IWIYIVGPLIGGILAGLVQQLF 236          
BLAST of Aquaporin vs. Planmine SMEST
Match: SMESG000023353.1 (SMESG000023353.1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.215e-9
Identity = 59/251 (23.51%), Postives = 105/251 (41.83%), Query Frame = 1
Query:   85 AMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAIT------------DEDGFDLPDYLHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEV 801
            +++ EL GTF+L   G G +     SN      + + LG+G A ++ ++  G +  GH NPAV+       ++  IR   Y   Q++GA  G L + ++   K+L      +   F + S+      + +   +T   D+     L   C + IT            ++        L P+++G+ ++  V C    +G ++NPA  L       MC    +   +        IV PLLGG   A+  ++
Sbjct:   21 SIIAELLGTFLLAFIGFGSVF----SNMNP---VKVGLGFGLAGVVIIYCIGPISGGHINPAVSFGLLIARQISLIRFILYIFVQILGATFGYLFISILTKGKVL------NPSHFSILSSNNLTKFNSADYKITENIDKIKDLHLKILCELVITFVLVFTVMRLCVEKSRNPTEKGLAPLIIGISITVGVYCGMNISGGSMNPAVSLAK----FMCTKQSKGLIS-------HIVGPLLGGFLAAILQQL 247          
BLAST of Aquaporin vs. Planmine SMEST
Match: SMESG000028474.1 (SMESG000028474.1)

HSP 1 Score: 58.151 bits (139), Expect = 1.629e-9
Identity = 63/238 (26.47%), Postives = 107/238 (44.96%), Query Frame = 1
Query:   97 ELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVGCFAMN----AGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYE 798
            E  GTF L+  G   ++    S N   +F  I +G     ++ VF   + G  H NPA+++A     R+++IR  FY +AQ  G+  G++++ ++      D   N+ +              SR+  +      +   TF+L    I  T ++ F+   Y + ++LG+ V   V  F +     +GA++NPAR  GP I  +              + W+  V P+LG V G LFY+
Sbjct:   23 EFLGTFFLLFIGSSSLMNSNASFNAGSTFGLILVG-----LITVF--SERGGCHLNPAISIAHFISHRIQFIRFIFYVIAQHCGSISGTILINVLTNHS-FDNTVNEPN-----------IANSRAVVI------EGILTFIL--VLIIFTVKNNFNSEIY-NGLLLGVAVGVTVFVFHIGFMGISGASMNPARSFGPAIYYSKTN-----------HIWIYYVGPILGSVAGTLFYD 221          
BLAST of Aquaporin vs. Planmine SMEST
Match: SMESG000023352.1 (SMESG000023352.1)

HSP 1 Score: 51.6026 bits (122), Expect = 2.330e-7
Identity = 55/242 (22.73%), Postives = 105/242 (43.39%), Query Frame = 1
Query:   85 AMLGELWGTFILIVFGLGVILQVELSNNQYGSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPFYWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFF--ITSRSTSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDY-LHPIMLGLMVSGIVGCFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGGVFGALFYEV 801
            +++ E  GTF+L+  G G        NN   + + + LG+GFA ++ ++  G +  GH NPAV+        +   +   + + Q++GA  G  +++ +  + +L    +K   +F + +T      +  R  +       +   TF+L    + +  E      +  L P+++GL ++  V C    +G ++NPA  LG            + F       W  I+ PL GG    L Y++
Sbjct:   21 SVVAEFLGTFLLVFIGFGTAY-----NNM--NPVKLGLGFGFAGIVVIYCIGPISGGHINPAVSFGLLIAREISLAKFIIFSIIQILGASAGFGMIYGVSGKGVL----HKSFLRFNISNTSIRIDEVIHRVENPAFKILCEMVITFVLVFTVMRLCVEKTRTSTEKGLAPLVIGLAIAVGVFCGMNISGGSMNPAASLG------------KYFYAGSTTIWTHIIGPLSGGAIAGLLYQL 239          
The following BLAST results are available for this feature:
BLAST of Aquaporin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AQP32.004e-5941.33aquaporin 3 (Gill blood group) [Source:HGNC Symbol... [more]
AQP93.220e-5639.08aquaporin 9 [Source:HGNC Symbol;Acc:HGNC:643][more]
AQP93.220e-5639.08aquaporin 9 [Source:HGNC Symbol;Acc:HGNC:643][more]
AQP74.501e-4635.83aquaporin 7 [Source:HGNC Symbol;Acc:HGNC:640][more]
AQP74.809e-4635.83aquaporin 7 [Source:HGNC Symbol;Acc:HGNC:640][more]
back to top
BLAST of Aquaporin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aqp-71.103e-5036.68AQuaPorin or aquaglyceroporin related [Source:Uni... [more]
aqp-71.103e-5036.68AQuaPorin or aquaglyceroporin related [Source:Uni... [more]
aqp-32.262e-4236.19AQuaPorin or aquaglyceroporin related [Source:Uni... [more]
aqp-31.495e-4136.19AQuaPorin or aquaglyceroporin related [Source:Uni... [more]
aqp-36.830e-4136.19AQuaPorin or aquaglyceroporin related [Source:Uni... [more]
back to top
BLAST of Aquaporin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drip7.070e-1628.63gene:FBgn0015872 transcript:FBtr0088141[more]
Drip7.070e-1628.63gene:FBgn0015872 transcript:FBtr0088142[more]
Drip8.460e-1628.46gene:FBgn0015872 transcript:FBtr0331388[more]
Drip8.562e-1628.63gene:FBgn0015872 transcript:FBtr0331389[more]
Drip8.848e-1628.63gene:FBgn0015872 transcript:FBtr0331387[more]
back to top
BLAST of Aquaporin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aqp10a1.706e-5838.78aquaporin 10a [Source:ZFIN;Acc:ZDB-GENE-040718-40][more]
aqp10a1.941e-5838.78aquaporin 10a [Source:ZFIN;Acc:ZDB-GENE-040718-40][more]
aqp3a3.168e-5637.17aquaporin 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2826... [more]
aqp3b1.196e-5536.19aquaporin 3b [Source:ZFIN;Acc:ZDB-GENE-040724-66][more]
aqp74.046e-4637.79aquaporin 7 [Source:ZFIN;Acc:ZDB-GENE-030131-6461][more]
back to top
BLAST of Aquaporin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aqp35.940e-5840.74aquaporin 3 (Gill blood group) [Source:NCBI gene;A... [more]
senp61.738e-4939.30SUMO specific peptidase 6 [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000021574.11.437e-4837.17aquaporin-3-like [Source:NCBI gene;Acc:100489930][more]
AQP101.112e-4233.72aquaporin 10 [Source:NCBI gene;Acc:100490571][more]
aqp71.592e-3537.25aquaporin 7 [Source:NCBI gene;Acc:548443][more]
back to top
BLAST of Aquaporin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aqp31.616e-6041.70aquaporin 3 [Source:MGI Symbol;Acc:MGI:1333777][more]
Aqp95.299e-5238.26aquaporin 9 [Source:MGI Symbol;Acc:MGI:1891066][more]
Aqp95.299e-5238.26aquaporin 9 [Source:MGI Symbol;Acc:MGI:1891066][more]
Aqp91.480e-4437.97aquaporin 9 [Source:MGI Symbol;Acc:MGI:1891066][more]
Aqp72.199e-4234.54aquaporin 7 [Source:MGI Symbol;Acc:MGI:1314647][more]
back to top
BLAST of Aquaporin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P47862|AQP3_RAT2.615e-6041.91Aquaporin-3 OS=Rattus norvegicus OX=10116 GN=Aqp3 ... [more]
sp|Q08DE6|AQP3_BOVIN2.820e-6042.28Aquaporin-3 OS=Bos taurus OX=9913 GN=AQP3 PE=2 SV=... [more]
sp|A9Y006|AQP3_PIG1.102e-5941.54Aquaporin-3 OS=Sus scrofa OX=9823 GN=AQP3 PE=2 SV=... [more]
sp|Q8R2N1|AQP3_MOUSE1.131e-5941.70Aquaporin-3 OS=Mus musculus OX=10090 GN=Aqp3 PE=1 ... [more]
sp|Q92482|AQP3_HUMAN9.624e-5941.33Aquaporin-3 OS=Homo sapiens OX=9606 GN=AQP3 PE=1 S... [more]
back to top
BLAST of Aquaporin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430Q1N51.413e-9153.82Aquaporin-3 OS=Schistosoma bovis OX=6184 GN=DC041_... [more]
A0A5K4F7U67.911e-9052.31Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
C4PYI67.998e-9052.31Aquaporin OS=Schistosoma mansoni OX=6183 GN=AQP1 P... [more]
C1L8172.826e-8952.29Aquaporin-9 OS=Schistosoma japonicum OX=6182 GN=EW... [more]
Q5DH563.666e-8952.29Aquaporin-9 (AQP-9) (Small solute channel 1) OS=Sc... [more]
back to top
BLAST of Aquaporin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000015220.21.949e-5839.00aquaporin-9-like [Source:NCBI gene;Acc:103027797][more]
aqp10a2.507e-5740.78aquaporin 10a [Source:ZFIN;Acc:ZDB-GENE-040718-40][more]
aqp9b1.093e-5337.02aquaporin 9 [Source:NCBI gene;Acc:103043118][more]
aqp3a4.766e-5335.58aquaporin-3-like [Source:NCBI gene;Acc:103047125][more]
aqp3a4.766e-5335.58aquaporin-3-like [Source:NCBI gene;Acc:103047125][more]
back to top
BLAST of Aquaporin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
aqp3b7.748e-6742.75aquaporin 3b [Source:ZFIN;Acc:ZDB-GENE-040724-66][more]
ENSPMAT00000008324.16.723e-4940.16pep scaffold:Pmarinus_7.0:GL479140:275:9118:1 gene... [more]
ENSPMAT00000003222.13.309e-2547.12pep scaffold:Pmarinus_7.0:GL490162:5550:6590:-1 ge... [more]
aqp8a.19.432e-736.36aquaporin 8a, tandem duplicate 1 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Aquaporin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
AQY39.419e-3434.60Putative channel-like protein; similar to Fps1p; m... [more]
FPS15.202e-2528.14Aquaglyceroporin, plasma membrane channel; involve... [more]
back to top
BLAST of Aquaporin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO450272.263e-5743.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450284.052e-5341.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409953.009e-2644.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288822.023e-2245.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283612.764e-1330.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aquaporin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aqp3a2.756e-5937.55aquaporin-3 [Source:NCBI gene;Acc:101163089][more]
aqp10a7.280e-5337.74aquaporin-10 [Source:NCBI gene;Acc:101174130][more]
ENSORLT00000031617.13.972e-5136.68aquaporin-9-like [Source:NCBI gene;Acc:101172729][more]
aqp9b6.043e-5035.50aquaporin 9 [Source:NCBI gene;Acc:101162108][more]
aqp9b6.043e-5035.50aquaporin 9 [Source:NCBI gene;Acc:101162108][more]
back to top
BLAST of Aquaporin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067985.10.000e+0100.00SMESG000067985.1[more]
SMESG000023346.12.151e-1726.56SMESG000023346.1[more]
SMESG000023353.11.215e-923.51SMESG000023353.1[more]
SMESG000028474.11.629e-926.47SMESG000028474.1[more]
SMESG000023352.12.330e-722.73SMESG000023352.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030651 ID=SMED30030651|Name=Aquaporin|organism=Schmidtea mediterranea sexual|type=transcript|length=988bp
TTTAATTGAATTTAATATCAATCGATGAAATTCTTAGTCAATCTCATTGA
TAAATATCTTAGTCTCCACAATTCTATTCTGGGCGCCATGCTCGGAGAAT
TGTGGGGAACTTTTATTTTGATTGTCTTCGGTTTAGGGGTCATTTTGCAA
GTGGAGCTCAGCAATAATCAGTACGGATCGTTTCTTTCCATTAGTCTCGG
ATGGGGATTTGCTGTGATGTTGGCAGTATTTTGGTCTGGTAAATTGGGTC
ATGGTCATACCAACCCAGCGGTAACGTTAGCTTTTGCCTCAATCGGTCGT
TTGGAATGGATTCGAGTTCCATTTTATTGGCTCGCTCAAGTAGTCGGAGC
ATTTCTCGGATCATTGGTTTTGTTTTTGATCTATTATGAAAAGATTCTTG
ATTTTGCCGCAAATAAAGATGATGGAAAATTCATCGTTCAATCGACTGGA
GCGTTTTTCATCACATCTAGAAGCACAAGCTTGTTGACTGCATTTTTTGA
TCAGTTTTTCGGTACTTTTCTCTTAGCCAGTTGTGCAATAGCTATAACCG
ATGAGGATGGGTTTGACTTGCCAGATTATCTCCACCCAATAATGCTGGGT
TTAATGGTATCTGGAATTGTTGGCTGTTTTGCAATGAATGCTGGGGCTGC
CTTGAATCCTGCCAGAGATCTTGGTCCAAGAATTATGATAGCAATGTGTG
GTTGGGGAAGAGAAGCTTTCACAAATTTAGATTTTTATTTTTGGGTACCA
ATTGTTGCTCCTTTGCTTGGAGGAGTTTTCGGAGCATTGTTTTATGAAGT
ATTTATCGGAGTACATCTTCACGCTAAATCAAAGAAGAGCATGTCAAATA
ATTCTGCAAATTCAAAGTTGATCGGTTCAGCAGAAACGGAAGTGAAAGTC
GTCGGATAAACTGATTGAGTTGATTTAATTTATTTTAATCGGGTTCAGAC
ATTCAAATTAACATTTTTTTCATTGAAATATACTCATT
back to top

protein sequence of SMED30030651-orf-1

>SMED30030651-orf-1 ID=SMED30030651-orf-1|Name=SMED30030651-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=295bp
MKFLVNLIDKYLSLHNSILGAMLGELWGTFILIVFGLGVILQVELSNNQY
GSFLSISLGWGFAVMLAVFWSGKLGHGHTNPAVTLAFASIGRLEWIRVPF
YWLAQVVGAFLGSLVLFLIYYEKILDFAANKDDGKFIVQSTGAFFITSRS
TSLLTAFFDQFFGTFLLASCAIAITDEDGFDLPDYLHPIMLGLMVSGIVG
CFAMNAGAALNPARDLGPRIMIAMCGWGREAFTNLDFYFWVPIVAPLLGG
VFGALFYEVFIGVHLHAKSKKSMSNNSANSKLIGSAETEVKVVG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015267channel activity
GO:0005215transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000425MIP
IPR023271Aquaporin-like
IPR022357MIP_CS
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000425Major intrinsic proteinPRINTSPR00783MINTRINSICPcoord: 240..260
score: 36.89
coord: 159..177
score: 26.72
coord: 192..214
score: 34.08
coord: 97..116
score: 39.64
coord: 20..39
score: 32.66
coord: 60..84
score: 40.11
IPR000425Major intrinsic proteinTIGRFAMTIGR00861TIGR00861coord: 25..257
e-value: 2.3E-57
score: 192.3
IPR000425Major intrinsic proteinPFAMPF00230MIPcoord: 17..257
e-value: 6.0E-45
score: 153.7
IPR000425Major intrinsic proteinCDDcd00333MIPcoord: 21..260
e-value: 1.49783E-57
score: 182.453
IPR023271Aquaporin-likeGENE3DG3DSA:1.20.1080.10coord: 11..277
e-value: 2.8E-78
score: 264.5
IPR023271Aquaporin-likeSUPERFAMILYSSF81338Aquaporin-likecoord: 19..263
NoneNo IPR availablePANTHERPTHR43829FAMILY NOT NAMEDcoord: 12..276
NoneNo IPR availableTMHMMTMhelixcoord: 190..212
NoneNo IPR availableTMHMMTMhelixcoord: 239..261
NoneNo IPR availableTMHMMTMhelixcoord: 99..121
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 50..72
NoneNo IPR availableTMHMMTMhelixcoord: 153..175
IPR022357Major intrinsic protein, conserved sitePROSITEPS00221MIPcoord: 78..86