Nuclear receptor subfamily 2 group E member 3

Overview
NameNuclear receptor subfamily 2 group E member 3
Smed IDSMED30030630
Length (bp)2752
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear receptor subfamily 2 group E member 3 (SMED30030630) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear receptor subfamily 2 group E member 3 (SMED30030630) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nuclear receptor subfamily 2 group E member 3 (SMED30030630) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nuclear receptor subfamily 2 group E member 3 (SMED30030630) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030630

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30030630SMESG000078919.1 dd_Smed_v4_24412_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Human
Match: NR2E3 (nuclear receptor subfamily 2 group E member 3 [Source:HGNC Symbol;Acc:HGNC:7974])

HSP 1 Score: 111.309 bits (277), Expect = 5.988e-26
Identity = 56/170 (32.94%), Postives = 99/170 (58.24%), Query Frame = 2
Query: 2174 DFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIM---RTSSYGTVS--------EVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + + R + +  +WAK+L  F++L   DQ++LLE+ W E+ ++  +Q+  PL+   ++     S+ G           E   L + I +FR   +DP+EF  +K ++L KP T+ L D   +E LQ+ +Q+MLS H+K  + +QP RFG+ LL +P++R +  + + E+LF
Sbjct:  134 ETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERI-ELLF 302          

HSP 2 Score: 80.8777 bits (198), Expect = 9.810e-16
Identity = 35/50 (70.00%), Postives = 44/50 (88.00%), Query Frame = 2
Query:  287 CTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQIDPN 436
            C +DKAHRNQCQACRLKKCL  GMN+DAVQNERQPR+++Q+ +LD ++ N
Sbjct:    2 CPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQV-HLDSMESN 50          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Human
Match: NR2E3 (nuclear receptor subfamily 2 group E member 3 [Source:HGNC Symbol;Acc:HGNC:7974])

HSP 1 Score: 111.694 bits (278), Expect = 1.771e-25
Identity = 56/170 (32.94%), Postives = 99/170 (58.24%), Query Frame = 2
Query: 2174 DFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIM---RTSSYGTVS--------EVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + + R + +  +WAK+L  F++L   DQ++LLE+ W E+ ++  +Q+  PL+   ++     S+ G           E   L + I +FR   +DP+EF  +K ++L KP T+ L D   +E LQ+ +Q+MLS H+K  + +QP RFG+ LL +P++R +  + + E+LF
Sbjct:  222 ETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERI-ELLF 390          

HSP 2 Score: 95.5153 bits (236), Expect = 4.661e-20
Identity = 41/59 (69.49%), Postives = 50/59 (84.75%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQIDPN 436
            YRCQ G G C +DKAHRNQCQACRLKKCL  GMN+DAVQNERQPR+++Q+ +LD ++ N
Sbjct:   81 YRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQV-HLDSMESN 138          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Human
Match: NR2E1 (nuclear receptor subfamily 2 group E member 1 [Source:HGNC Symbol;Acc:HGNC:7973])

HSP 1 Score: 105.145 bits (261), Expect = 1.961e-23
Identity = 57/191 (29.84%), Postives = 101/191 (52.88%), Query Frame = 2
Query: 2132 SPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGT-----------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLK--PT-----TKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            +PM         + +   R + ++ +WAKS+ +F+ L + DQ++LLED W E+ ++   Q+  P++   ++  S               +SE++ L +++ +FR  +LD +EF  LK I+  K  PT      +S  +   I  LQ+ AQL L+ +    Y  QP RFG+ LL +P +RS++  +++EV F
Sbjct:  173 TPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFF 363          

HSP 2 Score: 72.0182 bits (175), Expect = 1.521e-12
Identity = 32/49 (65.31%), Postives = 39/49 (79.59%), Query Frame = 2
Query:  260 YRCQAGT-GRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 403
            Y C++G  G C +DK HRNQC+ACRLKKCL + MNKDAVQ+ER PR S+
Sbjct:   50 YVCKSGNQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTST 98          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Human
Match: NR2E1 (nuclear receptor subfamily 2 group E member 1 [Source:HGNC Symbol;Acc:HGNC:7973])

HSP 1 Score: 105.145 bits (261), Expect = 2.825e-23
Identity = 57/191 (29.84%), Postives = 101/191 (52.88%), Query Frame = 2
Query: 2132 SPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGT-----------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLK--PT-----TKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            +PM         + +   R + ++ +WAKS+ +F+ L + DQ++LLED W E+ ++   Q+  P++   ++  S               +SE++ L +++ +FR  +LD +EF  LK I+  K  PT      +S  +   I  LQ+ AQL L+ +    Y  QP RFG+ LL +P +RS++  +++EV F
Sbjct:  210 TPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFF 400          

HSP 2 Score: 72.0182 bits (175), Expect = 1.861e-12
Identity = 32/49 (65.31%), Postives = 39/49 (79.59%), Query Frame = 2
Query:  260 YRCQAGT-GRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 403
            Y C++G  G C +DK HRNQC+ACRLKKCL + MNKDAVQ+ER PR S+
Sbjct:   87 YVCKSGNQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTST 135          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Human
Match: NR2E3 (nuclear receptor subfamily 2 group E member 3 [Source:HGNC Symbol;Acc:HGNC:7974])

HSP 1 Score: 101.679 bits (252), Expect = 2.375e-22
Identity = 47/146 (32.19%), Postives = 82/146 (56.16%), Query Frame = 2
Query: 2174 DFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIM---RTSSYGTVS--------EVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPAR 2578
            + + R + +  +WAK+L  F++L   DQ++LLE+ W E+ ++  +Q+  PL+   ++     S+ G           E   L + I +FR   +DP+EF  +K ++L KP T+ L D   +E LQ+ +Q+MLS H+K  + +QP R
Sbjct:  222 ETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVR 367          

HSP 2 Score: 95.5153 bits (236), Expect = 2.549e-20
Identity = 41/59 (69.49%), Postives = 50/59 (84.75%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQIDPN 436
            YRCQ G G C +DKAHRNQCQACRLKKCL  GMN+DAVQNERQPR+++Q+ +LD ++ N
Sbjct:   81 YRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQV-HLDSMESN 138          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Celegans
Match: fax-1 (Nuclear hormone receptor FAX-1 [Source:UniProtKB/TrEMBL;Acc:G5EDJ0])

HSP 1 Score: 102.449 bits (254), Expect = 5.815e-23
Identity = 45/58 (77.59%), Postives = 49/58 (84.48%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQIDP 433
            YRCQAGTG C +DKAHRNQCQACRLKKCL  GMNKDAVQNERQPRN++ IR    +DP
Sbjct:  136 YRCQAGTGNCVVDKAHRNQCQACRLKKCLNKGMNKDAVQNERQPRNTATIRPALDMDP 193          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Celegans
Match: fax-1 (Nuclear hormone receptor FAX-1 [Source:UniProtKB/TrEMBL;Acc:G5EDJ0])

HSP 1 Score: 102.449 bits (254), Expect = 7.853e-23
Identity = 45/58 (77.59%), Postives = 49/58 (84.48%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQIDP 433
            YRCQAGTG C +DKAHRNQCQACRLKKCL  GMNKDAVQNERQPRN++ IR    +DP
Sbjct:  136 YRCQAGTGNCVVDKAHRNQCQACRLKKCLNKGMNKDAVQNERQPRNTATIRPALDMDP 193          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Celegans
Match: nhr-67 (Nuclear hormone receptor family member nhr-67 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVV3])

HSP 1 Score: 74.7146 bits (182), Expect = 8.552e-14
Identity = 31/41 (75.61%), Postives = 37/41 (90.24%), Query Frame = 2
Query:  281 GRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 403
            G+C +DK HRNQC+ACRL+KCL +GMNKDAVQ+ER PRNSS
Sbjct:   66 GQCKVDKTHRNQCRACRLRKCLEIGMNKDAVQHERGPRNSS 106          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Celegans
Match: nhr-239 (Nuclear Hormone Receptor family [Source:UniProtKB/TrEMBL;Acc:Q9BKZ8])

HSP 1 Score: 59.3066 bits (142), Expect = 3.170e-9
Identity = 25/45 (55.56%), Postives = 29/45 (64.44%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPR 394
            Y C AG  +C +DK  RN C ACRL KC  + MN+ AVQ ER PR
Sbjct:   45 YTCIAGNWKCVVDKGRRNWCPACRLAKCTRLKMNRLAVQTERGPR 89          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Celegans
Match: nhr-111 (Nuclear hormone receptor family member nhr-111 [Source:UniProtKB/Swiss-Prot;Acc:O45521])

HSP 1 Score: 59.6918 bits (143), Expect = 3.629e-9
Identity = 25/40 (62.50%), Postives = 31/40 (77.50%), Query Frame = 2
Query:  266 CQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNER 385
            C  G G C IDKA+RN+C++CR+KKC   GMNK+AVQ ER
Sbjct:   78 CWNGDGNCVIDKANRNRCKSCRIKKCFKKGMNKNAVQPER 117          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Fly
Match: Hr51 (gene:FBgn0034012 transcript:FBtr0114456)

HSP 1 Score: 105.916 bits (263), Expect = 2.676e-23
Identity = 45/51 (88.24%), Postives = 48/51 (94.12%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIR 412
            YRCQAGTGRC +DKAHRNQCQACRLKKCL MGMNKDAVQNERQPRN++ IR
Sbjct:  145 YRCQAGTGRCVVDKAHRNQCQACRLKKCLQMGMNKDAVQNERQPRNTATIR 195          

HSP 2 Score: 105.916 bits (263), Expect = 3.278e-23
Identity = 64/197 (32.49%), Postives = 110/197 (55.84%), Query Frame = 2
Query: 2117 ISQYHSPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLI-----------MRTSSYGT--------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + Q+ SP L T  H   + + + R + +  +WAK+L SF  L   DQ++LLE+ W E+ +++ +Q+C PL+ T             +  ++ G          ++V  L ++  K++   +DP+EF  LK I+L +P T+ L D  +IE LQ+ A +MLS HTK  ++ Q ARFGR LL +P +R +++  ++ + F
Sbjct:  368 MPQFMSPNLYTHQHET-VYETSARLLFMAVKWAKNLPSFARLSFRDQVILLEESWSELFLLNAIQWCIPLDPTGCALFSVAEHCNNLENNANGDTCITKEELAADVRTLHEIFCKYKAVLVDPAEFACLKAIVLFRPETRGLKDPAQIENLQDQAHVMLSQHTKTQFTAQIARFGRLLLMLPLLRMISSHKIESIYF 563          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Fly
Match: dsf (gene:FBgn0015381 transcript:FBtr0333245)

HSP 1 Score: 98.5969 bits (244), Expect = 7.897e-21
Identity = 54/169 (31.95%), Postives = 91/169 (53.85%), Query Frame = 2
Query: 2168 LIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTS--------SYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            L + T R + +  RW K L  F  L   DQ +LL++ W E+ +++  Q+  PL+LT I+ +            T +E++ + +++ +FR    D SE   +K I L  P T  L D   +E+LQ+ AQ +LS H +  Y  Q  RFGR LL +P++R++   +++ + F
Sbjct:  497 LQETTARLLFMAVRWVKCLMPFQTLSKNDQHLLLQESWKELFLLNLAQWTIPLDLTPILESPLIRERVLQDEATQTEMKTIQEILCRFRQITPDGSEVGCMKAIALFAPETAGLCDVQPVEMLQDQAQCILSDHVRLRYPRQATRFGRLLLLLPSLRTIRAATIEALFF 665          

HSP 2 Score: 67.3958 bits (163), Expect = 3.926e-11
Identity = 30/48 (62.50%), Postives = 34/48 (70.83%), Query Frame = 2
Query:  260 YRCQAGT---GRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPR 394
            Y C+A     GRC +DK HRNQC+ACRL KC    MNKDAVQ+ER PR
Sbjct:   47 YTCKATGDLKGRCPVDKTHRNQCRACRLAKCFQSAMNKDAVQHERGPR 94          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Fly
Match: dsf (gene:FBgn0015381 transcript:FBtr0079145)

HSP 1 Score: 98.5969 bits (244), Expect = 7.897e-21
Identity = 54/169 (31.95%), Postives = 91/169 (53.85%), Query Frame = 2
Query: 2168 LIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTS--------SYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            L + T R + +  RW K L  F  L   DQ +LL++ W E+ +++  Q+  PL+LT I+ +            T +E++ + +++ +FR    D SE   +K I L  P T  L D   +E+LQ+ AQ +LS H +  Y  Q  RFGR LL +P++R++   +++ + F
Sbjct:  497 LQETTARLLFMAVRWVKCLMPFQTLSKNDQHLLLQESWKELFLLNLAQWTIPLDLTPILESPLIRERVLQDEATQTEMKTIQEILCRFRQITPDGSEVGCMKAIALFAPETAGLCDVQPVEMLQDQAQCILSDHVRLRYPRQATRFGRLLLLLPSLRTIRAATIEALFF 665          

HSP 2 Score: 67.3958 bits (163), Expect = 3.926e-11
Identity = 30/48 (62.50%), Postives = 34/48 (70.83%), Query Frame = 2
Query:  260 YRCQAGT---GRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPR 394
            Y C+A     GRC +DK HRNQC+ACRL KC    MNKDAVQ+ER PR
Sbjct:   47 YTCKATGDLKGRCPVDKTHRNQCRACRLAKCFQSAMNKDAVQHERGPR 94          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Fly
Match: svp (gene:FBgn0003651 transcript:FBtr0082562)

HSP 1 Score: 89.7373 bits (221), Expect = 2.804e-19
Identity = 51/172 (29.65%), Postives = 86/172 (50.00%), Query Frame = 2
Query: 2168 LIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTS----SYGTVSEVEFLMDLIK-------KFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + +   R +     WAK++  F  L + DQ+ LL  VW E+ +++  Q   PL +  ++  +    S      V   MD I+       K +   +D +E+  LK I+L       L D   IE LQE +Q  L  + +  Y NQP RFG+ LL +P++R+V++Q ++++ F
Sbjct:   79 ICELAARLLFSAVEWAKNIPFFPELQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVTHIESLQEKSQCALEEYCRTQYPNQPTRFGKLLLRLPSLRTVSSQVIEQLFF 250          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Fly
Match: svp (gene:FBgn0003651 transcript:FBtr0082564)

HSP 1 Score: 91.2781 bits (225), Expect = 1.193e-18
Identity = 51/172 (29.65%), Postives = 86/172 (50.00%), Query Frame = 2
Query: 2168 LIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTS----SYGTVSEVEFLMDLIK-------KFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + +   R +     WAK++  F  L + DQ+ LL  VW E+ +++  Q   PL +  ++  +    S      V   MD I+       K +   +D +E+  LK I+L       L D   IE LQE +Q  L  + +  Y NQP RFG+ LL +P++R+V++Q ++++ F
Sbjct:  341 ICELAARLLFSAVEWAKNIPFFPELQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVTHIESLQEKSQCALEEYCRTQYPNQPTRFGKLLLRLPSLRTVSSQVIEQLFF 512          

HSP 2 Score: 59.6918 bits (143), Expect = 1.037e-8
Identity = 27/44 (61.36%), Postives = 32/44 (72.73%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQP 391
            Y C+ G+  C ID+ HRNQCQ CRLKKCL MGM ++AVQ  R P
Sbjct:  234 YSCR-GSRNCPIDQHHRNQCQYCRLKKCLKMGMRREAVQRGRVP 276          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Zebrafish
Match: nr2e3 (nuclear receptor subfamily 2, group E, member 3 [Source:ZFIN;Acc:ZDB-GENE-041114-63])

HSP 1 Score: 110.153 bits (274), Expect = 4.774e-25
Identity = 54/166 (32.53%), Postives = 100/166 (60.24%), Query Frame = 2
Query: 2180 TFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLE---------LTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + R + ++ +WAK+L  F++L   DQ++LLE+ W E+ ++  +Q+  PL+         L+   +     + S+V  L ++  +F+  Q+DP+EF  LK I+L KP T+ L D  ++E LQ+ +Q++L+ H    Y +Q ARFGR LL +P++  V+++ ++ + F
Sbjct:  242 SARLLFMSVKWAKNLPVFSHLPFRDQVILLEEAWSELFLLCAIQWSLPLDNCPLLSLPDLSPTGQGKGSPSASDVRVLQEVFSRFKPLQVDPTEFACLKAIVLFKPETRGLKDPEQVENLQDQSQVLLAQHIHTLYPSQVARFGRLLLLLPSLHFVSSERIEHLFF 407          

HSP 2 Score: 102.834 bits (255), Expect = 1.059e-22
Identity = 47/68 (69.12%), Postives = 55/68 (80.88%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLD--QIDPNMNHVTVT 457
            YRCQAGTG C +DKAHRNQCQACRLKKCL  GMNKDAVQNERQPR+++Q+R LD   +D +  H+  T
Sbjct:   80 YRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNERQPRSTAQVR-LDALDVDKDKEHLATT 146          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Zebrafish
Match: nr2e3 (nuclear receptor subfamily 2, group E, member 3 [Source:ZFIN;Acc:ZDB-GENE-041114-63])

HSP 1 Score: 109.768 bits (273), Expect = 5.060e-25
Identity = 54/166 (32.53%), Postives = 100/166 (60.24%), Query Frame = 2
Query: 2180 TFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLE---------LTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + R + ++ +WAK+L  F++L   DQ++LLE+ W E+ ++  +Q+  PL+         L+   +     + S+V  L ++  +F+  Q+DP+EF  LK I+L KP T+ L D  ++E LQ+ +Q++L+ H    Y +Q ARFGR LL +P++  V+++ ++ + F
Sbjct:  235 SARLLFMSVKWAKNLPVFSHLPFRDQVILLEEAWSELFLLCAIQWSLPLDNCPLLSLPDLSPTGQGKGSPSASDVRVLQEVFSRFKPLQVDPTEFACLKAIVLFKPETRGLKDPEQVENLQDQSQVLLAQHIHTLYPSQVARFGRLLLLLPSLHFVSSERIEHLFF 400          

HSP 2 Score: 102.834 bits (255), Expect = 1.082e-22
Identity = 47/68 (69.12%), Postives = 55/68 (80.88%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLD--QIDPNMNHVTVT 457
            YRCQAGTG C +DKAHRNQCQACRLKKCL  GMNKDAVQNERQPR+++Q+R LD   +D +  H+  T
Sbjct:   73 YRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNERQPRSTAQVR-LDALDVDKDKEHLATT 139          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Zebrafish
Match: nr2e1 (nuclear receptor subfamily 2, group E, member 1 [Source:ZFIN;Acc:ZDB-GENE-040801-127])

HSP 1 Score: 107.457 bits (267), Expect = 2.678e-24
Identity = 59/191 (30.89%), Postives = 102/191 (53.40%), Query Frame = 2
Query: 2132 SPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGT-----------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLK--PT-----TKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            +PM         + +   R + ++ +WAKS+ +F+ L + DQ++LLED W E+ ++   Q+  P++ + ++  S   T           +SE++ L +++ +FR  +LD +EF  LK I+  K  PT      +S  +   I  LQ+ AQL L+ +    Y  QP RFG+ LL +P +RSV   +++EV F
Sbjct:  184 TPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLPLPDQLILLEDAWRELFVLGIAQWAIPVDSSTLLAVSGMNTENTDSQRLNKIISEIQALQEVVTRFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNASAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSVGPSTIEEVFF 374          

HSP 2 Score: 74.7146 bits (182), Expect = 1.524e-13
Identity = 33/49 (67.35%), Postives = 40/49 (81.63%), Query Frame = 2
Query:  260 YRCQAGT-GRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 403
            Y C++GT G C +DK HRNQC+ACRLKKCL + MNKDAVQ+ER PR S+
Sbjct:   61 YVCKSGTQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTST 109          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Zebrafish
Match: rxrgb (retinoid X receptor, gamma b [Source:NCBI gene;Acc:436617])

HSP 1 Score: 92.0485 bits (227), Expect = 5.207e-19
Identity = 55/224 (24.55%), Postives = 114/224 (50.89%), Query Frame = 2
Query: 2027 GSNRAHQDVNYSSQFE---TLNQFFKQKIEWKGISQYHSPMLSTTTHNNPLIDFTF---RHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIM-------RTSSY-GTVSEV--EFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            G  ++  +V  +S+F     +++    ++  +  ++ ++    + + N+P+ +      + +     WAK +  F++L + DQ++LL   W E+LI SF      ++  +++       R+S++   V  +    L +L+ K +  Q+D +E   L+ I+L  P  K L + +++E L+E     L  +TKQ Y +QP RF + LL +P +RS+  + L+ + F
Sbjct:  207 GKEKSDTEVETTSRFNEDMPVDKILDAELSVEPKTETYTESSPSNSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLPLDDQVILLRAGWNELLIASFSHRSITVKDGILLGTGLHVHRSSAHSAGVGSIFNRVLTELVSKMKDMQMDKTELGCLRAIVLFNPDAKGLSNSLEVEALREKVYASLETYTKQKYPDQPGRFAKLLLRLPALRSIGLKCLEHLFF 430          

HSP 2 Score: 54.6842 bits (130), Expect = 3.333e-7
Identity = 22/34 (64.71%), Postives = 26/34 (76.47%), Query Frame = 2
Query:  287 CTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQ 388
            C IDK  RN+CQ CR +KCL MGM ++AVQ ERQ
Sbjct:  172 CLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQ 205          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Zebrafish
Match: rxrgb (retinoid X receptor, gamma b [Source:NCBI gene;Acc:436617])

HSP 1 Score: 92.0485 bits (227), Expect = 5.921e-19
Identity = 55/224 (24.55%), Postives = 114/224 (50.89%), Query Frame = 2
Query: 2027 GSNRAHQDVNYSSQFE---TLNQFFKQKIEWKGISQYHSPMLSTTTHNNPLIDFTF---RHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIM-------RTSSY-GTVSEV--EFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            G  ++  +V  +S+F     +++    ++  +  ++ ++    + + N+P+ +      + +     WAK +  F++L + DQ++LL   W E+LI SF      ++  +++       R+S++   V  +    L +L+ K +  Q+D +E   L+ I+L  P  K L + +++E L+E     L  +TKQ Y +QP RF + LL +P +RS+  + L+ + F
Sbjct:  205 GKEKSDTEVETTSRFNEDMPVDKILDAELSVEPKTETYTESSPSNSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLPLDDQVILLRAGWNELLIASFSHRSITVKDGILLGTGLHVHRSSAHSAGVGSIFNRVLTELVSKMKDMQMDKTELGCLRAIVLFNPDAKGLSNSLEVEALREKVYASLETYTKQKYPDQPGRFAKLLLRLPALRSIGLKCLEHLFF 428          

HSP 2 Score: 55.0694 bits (131), Expect = 3.179e-7
Identity = 22/34 (64.71%), Postives = 26/34 (76.47%), Query Frame = 2
Query:  287 CTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQ 388
            C IDK  RN+CQ CR +KCL MGM ++AVQ ERQ
Sbjct:  170 CLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQ 203          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Xenopus
Match: nr2e3 (nuclear receptor subfamily 2 group E member 3 [Source:NCBI gene;Acc:100036597])

HSP 1 Score: 117.472 bits (293), Expect = 2.066e-27
Identity = 59/176 (33.52%), Postives = 104/176 (59.09%), Query Frame = 2
Query: 2150 TTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLE---------LTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            T+    + + + R + +  +WAK+L  F+NL   DQ++LLE+ W E+ ++  +Q+  PL+         L+  +   S  +  +V  L + I +F+   +DP+EF  LK ++L KP T+ L D  +IE LQ+ +Q+ML+ HT+  Y  QP RFG+ LL  P++R ++++ + E+LF
Sbjct:  215 TSSPEGVYETSARLLFMAVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLCAIQWSMPLDSCPLLSVPDLSSQVHGKSVSSTIDVRILQETISRFKSLNVDPTEFACLKAVLLFKPETRGLKDPEQIENLQDQSQMMLAQHTRNQYPAQPVRFGKLLLLSPSLRFISSERI-ELLF 389          

HSP 2 Score: 104.375 bits (259), Expect = 4.601e-23
Identity = 47/57 (82.46%), Postives = 51/57 (89.47%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQID 430
            YRCQAGTG C +DKAHRNQCQACRLKKCL  GMNKDAVQNERQPR+++QIR LD ID
Sbjct:   71 YRCQAGTGLCPVDKAHRNQCQACRLKKCLQTGMNKDAVQNERQPRSTAQIR-LDSID 126          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Xenopus
Match: nr2e3 (nuclear receptor subfamily 2 group E member 3 [Source:NCBI gene;Acc:100036597])

HSP 1 Score: 116.701 bits (291), Expect = 2.948e-27
Identity = 56/166 (33.73%), Postives = 99/166 (59.64%), Query Frame = 2
Query: 2180 TFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLE---------LTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + R + +  +WAK+L  F+NL   DQ++LLE+ W E+ ++  +Q+  PL+         L+  +   S  +  +V  L + I +F+   +DP+EF  LK ++L KP T+ L D  +IE LQ+ +Q+ML+ HT+  Y  QP RFG+ LL  P++R ++++ ++ + F
Sbjct:  219 SARLLFMAVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLCAIQWSMPLDSCPLLSVPDLSSQVHGKSVSSTIDVRILQETISRFKSLNVDPTEFACLKAVLLFKPETRGLKDPEQIENLQDQSQMMLAQHTRNQYPAQPVRFGKLLLLSPSLRFISSERIELLFF 384          

HSP 2 Score: 103.99 bits (258), Expect = 5.888e-23
Identity = 47/57 (82.46%), Postives = 51/57 (89.47%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQID 430
            YRCQAGTG C +DKAHRNQCQACRLKKCL  GMNKDAVQNERQPR+++QIR LD ID
Sbjct:   65 YRCQAGTGLCPVDKAHRNQCQACRLKKCLQTGMNKDAVQNERQPRSTAQIR-LDSID 120          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Xenopus
Match: NR2E1 (nuclear receptor subfamily 2 group E member 1 [Source:NCBI gene;Acc:100491500])

HSP 1 Score: 103.605 bits (257), Expect = 5.935e-23
Identity = 53/180 (29.44%), Postives = 97/180 (53.89%), Query Frame = 2
Query: 2168 LIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGT-----------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTT--------KSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + +   R + ++ +WAKS+ +F+ L + DQ++LLED W E+ ++   Q+  P++ + ++  S   +           +SE++ L +++ +FR  +LD +EF  LK I+  K           +S  +   I  LQ+ AQL L+ +    Y  QP RFG+ LL +P +RS+   +++EV F
Sbjct:  185 VCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDASTLLAVSGMNSDNTESQKLNKIISEIQALQEVVSRFRQLRLDATEFACLKCIVTFKAGVPPHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSINPSTIEEVFF 364          

HSP 2 Score: 72.4034 bits (176), Expect = 1.062e-12
Identity = 32/49 (65.31%), Postives = 39/49 (79.59%), Query Frame = 2
Query:  260 YRCQAGT-GRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 403
            Y C++G  G C +DK HRNQC+ACRLKKCL + MNKDAVQ+ER PR S+
Sbjct:   50 YVCKSGNQGGCLVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTST 98          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Xenopus
Match: NR2E1 (nuclear receptor subfamily 2 group E member 1 [Source:NCBI gene;Acc:100491500])

HSP 1 Score: 103.605 bits (257), Expect = 7.004e-23
Identity = 53/179 (29.61%), Postives = 97/179 (54.19%), Query Frame = 2
Query: 2168 LIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGT-----------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTT-------KSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + +   R + ++ +WAKS+ +F+ L + DQ++LLED W E+ ++   Q+  P++ + ++  S   +           +SE++ L +++ +FR  +LD +EF  LK I+  K          +S  +   I  LQ+ AQL L+ +    Y  QP RFG+ LL +P +RS+   +++EV F
Sbjct:  195 VCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDASTLLAVSGMNSDNTESQKLNKIISEIQALQEVVSRFRQLRLDATEFACLKCIVTFKAVPPHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSINPSTIEEVFF 373          

HSP 2 Score: 72.0182 bits (175), Expect = 1.405e-12
Identity = 32/49 (65.31%), Postives = 39/49 (79.59%), Query Frame = 2
Query:  260 YRCQAGT-GRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 403
            Y C++G  G C +DK HRNQC+ACRLKKCL + MNKDAVQ+ER PR S+
Sbjct:   60 YVCKSGNQGGCLVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTST 108          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Xenopus
Match: NR2E1 (nuclear receptor subfamily 2 group E member 1 [Source:NCBI gene;Acc:100491500])

HSP 1 Score: 103.605 bits (257), Expect = 7.321e-23
Identity = 53/180 (29.44%), Postives = 97/180 (53.89%), Query Frame = 2
Query: 2168 LIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGT-----------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTT--------KSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + +   R + ++ +WAKS+ +F+ L + DQ++LLED W E+ ++   Q+  P++ + ++  S   +           +SE++ L +++ +FR  +LD +EF  LK I+  K           +S  +   I  LQ+ AQL L+ +    Y  QP RFG+ LL +P +RS+   +++EV F
Sbjct:  196 VCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDASTLLAVSGMNSDNTESQKLNKIISEIQALQEVVSRFRQLRLDATEFACLKCIVTFKAGVPPHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSINPSTIEEVFF 375          

HSP 2 Score: 72.0182 bits (175), Expect = 1.526e-12
Identity = 32/49 (65.31%), Postives = 39/49 (79.59%), Query Frame = 2
Query:  260 YRCQAGT-GRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 403
            Y C++G  G C +DK HRNQC+ACRLKKCL + MNKDAVQ+ER PR S+
Sbjct:   61 YVCKSGNQGGCLVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTST 109          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Mouse
Match: Nr2e3 (nuclear receptor subfamily 2, group E, member 3 [Source:MGI Symbol;Acc:MGI:1346317])

HSP 1 Score: 113.235 bits (282), Expect = 2.838e-26
Identity = 53/147 (36.05%), Postives = 88/147 (59.86%), Query Frame = 2
Query: 2174 DFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIM-----RTSSYGTVS----EVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGR 2587
            + + R + +  +WAK+L  F+NL   DQ++LLE+ W E+ ++  +Q+  PL+   ++       SS G ++    E  FL + I +FR   +DP+EF  LK ++L KP T+ L D   +E LQ+ +Q+MLS H+K  + +QP RFG+
Sbjct:  209 ETSARLLFMAVKWAKNLPVFSNLPFRDQVILLEEAWNELFLLGAIQWSLPLDSCPLLAPPEASGSSQGRLALASAETRFLQETISRFRALAVDPTEFACLKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGK 355          

HSP 2 Score: 93.2041 bits (230), Expect = 1.514e-19
Identity = 40/57 (70.18%), Postives = 48/57 (84.21%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQID 430
            YRCQ G G C +DKAHRNQCQACRLKKCL  GMN+DAVQNERQPR+ +Q+ +LD ++
Sbjct:   74 YRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSMAQV-HLDAME 129          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Mouse
Match: Nr2e1 (nuclear receptor subfamily 2, group E, member 1 [Source:MGI Symbol;Acc:MGI:1100526])

HSP 1 Score: 107.071 bits (266), Expect = 2.742e-24
Identity = 58/191 (30.37%), Postives = 102/191 (53.40%), Query Frame = 2
Query: 2132 SPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGT-----------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLK--PT-----TKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            +PM         + +   R + ++ +WAKS+ +F+ L + DQ++LLED W E+ ++   Q+  P++   ++  S   T           +SE++ L +++ +FR  +LD +EF  LK I+  K  PT      +S  +   I  LQ+ AQL L+ +    Y  QP RFG+ LL +P +RS++  +++EV F
Sbjct:  173 TPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNTDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFF 363          

HSP 2 Score: 72.0182 bits (175), Expect = 9.900e-13
Identity = 32/49 (65.31%), Postives = 39/49 (79.59%), Query Frame = 2
Query:  260 YRCQAGT-GRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 403
            Y C++G  G C +DK HRNQC+ACRLKKCL + MNKDAVQ+ER PR S+
Sbjct:   50 YVCKSGNQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTST 98          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Mouse
Match: Nr2f1 (nuclear receptor subfamily 2, group F, member 1 [Source:MGI Symbol;Acc:MGI:1352451])

HSP 1 Score: 88.5817 bits (218), Expect = 7.925e-19
Identity = 49/172 (28.49%), Postives = 87/172 (50.58%), Query Frame = 2
Query: 2168 LIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTS----SYGTVSEVEFLMDLIK-------KFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + +   R +     WA+++  F +L I DQ+ LL   W E+ +++  Q   PL +  ++  +    S  +   V   MD I+       K +   +D +E+  LK I+L       L D   IE LQE +Q  L  + +  Y NQP+RFG+ LL +P++R+V++  ++++ F
Sbjct:   59 ICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFF 230          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Mouse
Match: Nr2f1 (nuclear receptor subfamily 2, group F, member 1 [Source:MGI Symbol;Acc:MGI:1352451])

HSP 1 Score: 88.5817 bits (218), Expect = 7.925e-19
Identity = 49/172 (28.49%), Postives = 87/172 (50.58%), Query Frame = 2
Query: 2168 LIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTS----SYGTVSEVEFLMDLIK-------KFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + +   R +     WA+++  F +L I DQ+ LL   W E+ +++  Q   PL +  ++  +    S  +   V   MD I+       K +   +D +E+  LK I+L       L D   IE LQE +Q  L  + +  Y NQP+RFG+ LL +P++R+V++  ++++ F
Sbjct:   59 ICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFF 230          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Mouse
Match: Rxrg (retinoid X receptor gamma [Source:MGI Symbol;Acc:MGI:98216])

HSP 1 Score: 89.7373 bits (221), Expect = 9.024e-19
Identity = 51/157 (32.48%), Postives = 82/157 (52.23%), Query Frame = 2
Query: 2210 WAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTS---------SYGTVSEVE-FLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            WAK +  F++L + DQ++LL   W E+LI SF      ++  +++ T          S G  S  +  L +L+ K +  Q+D SE   L+ I+L  P  K L +  ++E L+E     L  +TKQ Y  QP RF + LL +P +RS+  + L+ + F
Sbjct:  160 WAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFF 316          

HSP 2 Score: 55.4546 bits (132), Expect = 1.747e-7
Identity = 22/34 (64.71%), Postives = 27/34 (79.41%), Query Frame = 2
Query:  287 CTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQ 388
            C IDK  RN+CQ CR +KCL+MGM ++AVQ ERQ
Sbjct:   58 CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQ 91          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. UniProt/SwissProt
Match: sp|Q9QXZ7|NR2E3_MOUSE (Photoreceptor-specific nuclear receptor OS=Mus musculus OX=10090 GN=Nr2e3 PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.985e-25
Identity = 53/147 (36.05%), Postives = 88/147 (59.86%), Query Frame = 2
Query: 2174 DFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIM-----RTSSYGTVS----EVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGR 2587
            + + R + +  +WAK+L  F+NL   DQ++LLE+ W E+ ++  +Q+  PL+   ++       SS G ++    E  FL + I +FR   +DP+EF  LK ++L KP T+ L D   +E LQ+ +Q+MLS H+K  + +QP RFG+
Sbjct:  209 ETSARLLFMAVKWAKNLPVFSNLPFRDQVILLEEAWNELFLLGAIQWSLPLDSCPLLAPPEASGSSQGRLALASAETRFLQETISRFRALAVDPTEFACLKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGK 355          

HSP 2 Score: 93.2041 bits (230), Expect = 1.059e-18
Identity = 40/57 (70.18%), Postives = 48/57 (84.21%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQID 430
            YRCQ G G C +DKAHRNQCQACRLKKCL  GMN+DAVQNERQPR+ +Q+ +LD ++
Sbjct:   74 YRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSMAQV-HLDAME 129          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. UniProt/SwissProt
Match: sp|Q9Y5X4|NR2E3_HUMAN (Photoreceptor-specific nuclear receptor OS=Homo sapiens OX=9606 GN=NR2E3 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 8.506e-25
Identity = 56/170 (32.94%), Postives = 99/170 (58.24%), Query Frame = 2
Query: 2174 DFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIM---RTSSYGTVS--------EVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + + R + +  +WAK+L  F++L   DQ++LLE+ W E+ ++  +Q+  PL+   ++     S+ G           E   L + I +FR   +DP+EF  +K ++L KP T+ L D   +E LQ+ +Q+MLS H+K  + +QP RFG+ LL +P++R +  + + E+LF
Sbjct:  222 ETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERI-ELLF 390          

HSP 2 Score: 95.5153 bits (236), Expect = 2.238e-19
Identity = 41/59 (69.49%), Postives = 50/59 (84.75%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQIDPN 436
            YRCQ G G C +DKAHRNQCQACRLKKCL  GMN+DAVQNERQPR+++Q+ +LD ++ N
Sbjct:   81 YRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQV-HLDSMESN 138          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. UniProt/SwissProt
Match: sp|Q9TTF0|NR2E3_BOVIN (Photoreceptor-specific nuclear receptor OS=Bos taurus OX=9913 GN=NR2E3 PE=1 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 1.942e-24
Identity = 57/170 (33.53%), Postives = 102/170 (60.00%), Query Frame = 2
Query: 2174 DFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLE---LTLIMRTSSYGTV--------SEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + + R + +  +WAK+L  F+NL   DQ++LLE+ W E+ ++  +Q+  PL+   L  +   S+ G+         +E   L + I +FR   +DP+EF  +K ++L KP T+ L D   +E LQ+ +Q+MLS H+K  + +Q  RFG+ LL +P++R ++++ + E+LF
Sbjct:  223 ETSARLLFMAVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLGAIQWSLPLDNCPLLALPEASAGGSSQGRLVLASAETRILQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQLVRFGKLLLLLPSLRFISSERV-ELLF 391          

HSP 2 Score: 95.5153 bits (236), Expect = 1.851e-19
Identity = 40/57 (70.18%), Postives = 49/57 (85.96%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQID 430
            YRCQ G G C +DKAHRNQCQACRLKKCL  GMN+DAVQNERQPR+++Q+R +D ++
Sbjct:   73 YRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVR-MDSVE 128          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. UniProt/SwissProt
Match: sp|Q64104|NR2E1_MOUSE (Nuclear receptor subfamily 2 group E member 1 OS=Mus musculus OX=10090 GN=Nr2e1 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.918e-23
Identity = 58/191 (30.37%), Postives = 102/191 (53.40%), Query Frame = 2
Query: 2132 SPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGT-----------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLK--PT-----TKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            +PM         + +   R + ++ +WAKS+ +F+ L + DQ++LLED W E+ ++   Q+  P++   ++  S   T           +SE++ L +++ +FR  +LD +EF  LK I+  K  PT      +S  +   I  LQ+ AQL L+ +    Y  QP RFG+ LL +P +RS++  +++EV F
Sbjct:  173 TPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNTDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFF 363          

HSP 2 Score: 72.0182 bits (175), Expect = 6.925e-12
Identity = 32/49 (65.31%), Postives = 39/49 (79.59%), Query Frame = 2
Query:  260 YRCQAGT-GRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 403
            Y C++G  G C +DK HRNQC+ACRLKKCL + MNKDAVQ+ER PR S+
Sbjct:   50 YVCKSGNQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTST 98          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. UniProt/SwissProt
Match: sp|Q9YGL3|NR2E1_ORYLA (Nuclear receptor subfamily 2 group E member 1 OS=Oryzias latipes OX=8090 GN=nr2e1 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 3.486e-23
Identity = 59/191 (30.89%), Postives = 103/191 (53.93%), Query Frame = 2
Query: 2132 SPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGT-----------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLK--PTTKSLIDRV-----KIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            +PM         + +   R + ++ +WAKS+ +F+ L ++DQ++LLED W E+ ++   Q+  P++ T ++  S   +           ++E++ L +++ +FR  +LD +EF  LK I+  K  PT  S   R       I  LQ+ AQL L+ +    Y  QP RFG+ LL +P +RSV+  +++EV F
Sbjct:  184 TPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLPLSDQLILLEDAWRELFVLGIAQWAIPVDSTTLLAVSGLNSENMEAQRMNKIMAEIQALQEVVTRFRQMRLDATEFACLKCIVTFKAVPTQGSAELRAFRNASAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSVSPSTIEEVFF 374          

HSP 2 Score: 73.1738 bits (178), Expect = 3.670e-12
Identity = 32/49 (65.31%), Postives = 40/49 (81.63%), Query Frame = 2
Query:  260 YRCQAGT-GRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 403
            Y C++G+ G C +DK HRNQC+ACRLKKCL + MNKDAVQ+ER PR S+
Sbjct:   61 YLCKSGSQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTST 109          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. TrEMBL
Match: A0A0L8GS56 (NR LBD domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22028879mg PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 6.062e-28
Identity = 60/167 (35.93%), Postives = 99/167 (59.28%), Query Frame = 2
Query: 2174 DFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTS--------SYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + + R + +  +WAK+L SF NL   DQ++LLE+ W E+ ++  +Q+  PLE + +   S           T+++V  L +++ +F+  Q+DP+EF  LK I+L KP T+ L D  ++E LQ+ AQ+ML  H    +  QP RFGR LL +P +R V+   +++V F
Sbjct:   73 ECSARLLFMAVKWAKNLPSFANLPFRDQVILLEEAWTELFLLCAIQWSLPLETSPLFVVSDPSQIVNGKTSTIADVRILQEILARFKAIQVDPAEFACLKAIVLFKPDTRGLKDPHQVENLQDQAQVMLGQHIHTQHPTQPIRFGRLLLMLPALRYVSPDRIEKVFF 239          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. TrEMBL
Match: A0A3P9ADC5 (Nuclear receptor subfamily 2 group E member 3 OS=Esox lucius OX=8010 GN=NR2E3 PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.681e-27
Identity = 63/189 (33.33%), Postives = 116/189 (61.38%), Query Frame = 2
Query: 2111 KGISQYHSPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLE---------LTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            +  S+YH  +  ++T N  + + + R + ++ +WAK+L  F+NL   DQ++LLE+ W E+ ++  +Q+  PL+         L+  M++ +  T  +V  L ++  +F+   +DP+EF  LK I+L KP T+ L D  ++E LQ+ +Q+ML  H +  YS+QPARFG+ LL +P++R V+++ ++ + F
Sbjct:  224 RASSEYHMSLYPSSTEN--VYETSARLLFMSVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLCAIQWSLPLDSCPLLSLPDLSPTMQSKTSYTSVDVRLLQEVFSRFKALAVDPTEFACLKAIVLFKPETRGLKDPEQVENLQDQSQVMLGQHIRSHYSSQPARFGKLLLLLPSLRFVSSERIELLFF 410          

HSP 2 Score: 104.76 bits (260), Expect = 6.461e-20
Identity = 47/57 (82.46%), Postives = 51/57 (89.47%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQID 430
            YRCQAGTG C +DKAHRNQCQACRLKKCL  GMNKDAVQNERQPR++SQ+R LD ID
Sbjct:   77 YRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNERQPRSTSQVR-LDSID 132          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. TrEMBL
Match: A0A3P8YUE9 (Nuclear receptor subfamily 2 group E member 3 OS=Esox lucius OX=8010 GN=NR2E3 PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.973e-27
Identity = 65/189 (34.39%), Postives = 117/189 (61.90%), Query Frame = 2
Query: 2111 KGISQYHSPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLE---------LTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            +  S+YH  +  ++T N  + + + R + ++ +WAK+L  F+NL   DQ++LLE+ W E+ ++  +Q+  PL+         L+  M++ +  T  +V  L ++  +F+   +DP+EF  LK I+L KP T+ L D  ++E LQ+ +Q+ML  H +  YS+QPARFG+ LL +P++R V+++ + E+LF
Sbjct:  229 RASSEYHMSLYPSSTEN--VYETSARLLFMSVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLCAIQWSLPLDSCPLLSLPDLSPTMQSKTSYTSVDVRLLQEVFSRFKALAVDPTEFACLKAIVLFKPETRGLKDPEQVENLQDQSQVMLGQHIRSHYSSQPARFGKLLLLLPSLRFVSSERI-ELLF 414          

HSP 2 Score: 104.375 bits (259), Expect = 9.064e-20
Identity = 47/57 (82.46%), Postives = 51/57 (89.47%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQID 430
            YRCQAGTG C +DKAHRNQCQACRLKKCL  GMNKDAVQNERQPR++SQ+R LD ID
Sbjct:   82 YRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNERQPRSTSQVR-LDSID 137          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. TrEMBL
Match: A0A0P7XGH9 (Photoreceptor-specific nuclear receptor-like OS=Scleropages formosus OX=113540 GN=Z043_106344 PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.284e-27
Identity = 61/189 (32.28%), Postives = 116/189 (61.38%), Query Frame = 2
Query: 2111 KGISQYHSPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPL---------ELTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            +  S+YH  +   ++  N + + + R + ++ +WAK+L  F+NL   DQ++LLE+ W E+ ++  +Q+  PL         EL+  +++ +  + +++  L ++  +F+   +DP+EF  LK I+L KP T+ L D  ++E LQ+ +Q+ML  H +  YS+QP+RFG+ LL +P++R V ++ + E+LF
Sbjct:  223 RASSEYHMSLYPPSSPEN-VYETSARLLFVSVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLCAIQWSLPLDSCPLLSLPELSPTLQSKTSPSGADLRLLQEMFGRFKALTVDPTEFACLKAIVLFKPETRGLKDPEQVENLQDQSQMMLGQHIRAHYSSQPSRFGKLLLMLPSLRFVGSERI-ELLF 409          

HSP 2 Score: 103.605 bits (257), Expect = 1.379e-19
Identity = 48/68 (70.59%), Postives = 56/68 (82.35%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQIDPNMN--HVTVT 457
            YRCQAGTG C +DKAHRNQCQACRLKKCL  GMNKDAVQNERQPR+++Q+R LD ID + +  H+  T
Sbjct:   82 YRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNERQPRSTAQVR-LDAIDVDTDKEHLATT 148          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. TrEMBL
Match: A0A433U0Z1 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_004783 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.232e-27
Identity = 62/172 (36.05%), Postives = 100/172 (58.14%), Query Frame = 2
Query: 2168 LIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLE----------LTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLFG 2653
            L + + R + +  +WAK+L SF NL   DQ+VLLE+ W E+ ++  +Q+  P+E          L  ++  S     S++  L D++ +F+  Q+DP+EF  LK I+L K   +SL D  ++E LQ+ AQ+ML  H +  +  QP RFGR LL +PT+R V +  ++ + FG
Sbjct:  169 LYECSARLLFMAVKWAKNLPSFANLPFRDQVVLLEEAWSELFLLCAIQWSMPMEACPLFAIPDHLPPVVTASKISPFSDMRILQDVMGRFKAVQVDPAEFACLKAIVLFKSDARSLKDPHQVESLQDQAQVMLGQHIRGQHPTQPFRFGRLLLVLPTLRYVPSDRIERLFFG 340          

HSP 2 Score: 110.923 bits (276), Expect = 2.274e-22
Identity = 49/68 (72.06%), Postives = 57/68 (83.82%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQIDPNMNHVTVTAN 463
            YRCQAGTG C +DKAHRNQCQACRLKKC+ MGMNKDAVQNERQPRN++Q+R  DQI+  + H  V +N
Sbjct:   22 YRCQAGTGMCNVDKAHRNQCQACRLKKCIQMGMNKDAVQNERQPRNTAQVRE-DQIETELEHPLVPSN 88          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Cavefish
Match: nr2e3 (nuclear receptor subfamily 2 group E member 3 [Source:NCBI gene;Acc:103047484])

HSP 1 Score: 106.301 bits (264), Expect = 7.626e-24
Identity = 60/186 (32.26%), Postives = 114/186 (61.29%), Query Frame = 2
Query: 2132 SPMLSTT--THNNP--LIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLE---------LTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            SP  +T+  +++ P  + + + R + ++ +WAK+L  F++L   DQ++LLE+ W E+ ++  +Q+  PL+         L+   ++ S  + S++  L ++  +F+  Q+DP+EF  LK I+L KP  + L D  ++E LQ+ +Q+ML+ H    Y++Q ARFGR LL +P++  V+++ + E+LF
Sbjct:  223 SPECNTSLYSYSGPESVYETSARLLFMSVKWAKNLPVFSHLPFRDQVILLEEAWSELFLLCAIQWSLPLDSCPLLSLPDLSPPSQSKSSPSASDLRLLQEVFSRFKALQVDPTEFACLKAIVLFKPEARGLKDPEQVENLQDQSQVMLAQHIHTLYASQAARFGRLLLLLPSLHFVSSERI-ELLF 407          

HSP 2 Score: 102.449 bits (254), Expect = 1.284e-22
Identity = 47/68 (69.12%), Postives = 55/68 (80.88%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIR--NLDQIDPNMNHVTVT 457
            YRCQAGTG C +DKAHRNQCQACRLKKCL  GMNKDAVQNERQPR+++Q+R  +LD +D    H+  T
Sbjct:   80 YRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNERQPRSTAQVRLDSLD-VDTEKEHLATT 146          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Cavefish
Match: nr2e1 (nuclear receptor subfamily 2 group E member 1 [Source:NCBI gene;Acc:103026242])

HSP 1 Score: 98.2117 bits (243), Expect = 2.321e-21
Identity = 54/179 (30.17%), Postives = 95/179 (53.07%), Query Frame = 2
Query: 2168 LIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGT-----------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLK--PT-----TKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + +   R + ++ +WAKS+ +F+ L + DQ++LLE+ W E+ ++   Q+  P++   ++  S               + E++ L +++  FR  +LD +EF  LK I+  K  PT      +S  +   I  LQ+ AQL L+ +    Y  QP RFG+ LL +P +RSV   +++EV F
Sbjct:  197 VCESAARLLFMSIKWAKSVPAFSTLPLPDQLILLEEAWRELFVLGIAQWAIPVDSNTLLAVSGMTAENTESQRLNKLMEEIQALQEVVTHFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNASAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSVGPSTIEEVFF 375          

HSP 2 Score: 74.7146 bits (182), Expect = 1.300e-13
Identity = 33/49 (67.35%), Postives = 40/49 (81.63%), Query Frame = 2
Query:  260 YRCQAGT-GRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 403
            Y C++GT G C +DK HRNQC+ACRLKKCL + MNKDAVQ+ER PR S+
Sbjct:   61 YVCKSGTQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTST 109          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Cavefish
Match: rxrab (retinoic acid receptor RXR-alpha-B [Source:NCBI gene;Acc:103046247])

HSP 1 Score: 91.2781 bits (225), Expect = 7.601e-19
Identity = 50/157 (31.85%), Postives = 83/157 (52.87%), Query Frame = 2
Query: 2210 WAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIM-------RTSSYGTVSEVEF---LMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            WAK +  F++L + DQ++LL   W E+LI SF      ++  +++       R S++       F   L +L+ K R  Q+D SE   L+ I+L  P +K L +  ++E L+E     L  + KQ Y +QP RF + LL +P +RS+  + L+ + F
Sbjct:  285 WAKRIPHFSDLPLDDQVILLRAGWNELLIASFSHRSISVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKSELGCLRAIVLFNPDSKGLSNPAEVEALRERVYASLEAYCKQKYPDQPGRFAKLLLRLPALRSIGLKCLEHLFF 441          

HSP 2 Score: 52.373 bits (124), Expect = 1.774e-6
Identity = 21/34 (61.76%), Postives = 25/34 (73.53%), Query Frame = 2
Query:  287 CTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQ 388
            C IDK  RN+CQ CR +KCL  GM ++AVQ ERQ
Sbjct:  177 CLIDKRQRNRCQYCRYQKCLATGMKREAVQEERQ 210          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Cavefish
Match: rxrab (retinoic acid receptor RXR-alpha-B [Source:NCBI gene;Acc:103046247])

HSP 1 Score: 91.2781 bits (225), Expect = 1.161e-18
Identity = 50/157 (31.85%), Postives = 83/157 (52.87%), Query Frame = 2
Query: 2210 WAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIM-------RTSSYGTVSEVEF---LMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            WAK +  F++L + DQ++LL   W E+LI SF      ++  +++       R S++       F   L +L+ K R  Q+D SE   L+ I+L  P +K L +  ++E L+E     L  + KQ Y +QP RF + LL +P +RS+  + L+ + F
Sbjct:  321 WAKRIPHFSDLPLDDQVILLRAGWNELLIASFSHRSISVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKSELGCLRAIVLFNPDSKGLSNPAEVEALRERVYASLEAYCKQKYPDQPGRFAKLLLRLPALRSIGLKCLEHLFF 477          

HSP 2 Score: 51.9878 bits (123), Expect = 2.225e-6
Identity = 21/34 (61.76%), Postives = 25/34 (73.53%), Query Frame = 2
Query:  287 CTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQ 388
            C IDK  RN+CQ CR +KCL  GM ++AVQ ERQ
Sbjct:  213 CLIDKRQRNRCQYCRYQKCLATGMKREAVQEERQ 246          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Cavefish
Match: nr5a5 (steroidogenic factor 1-like [Source:NCBI gene;Acc:103046980])

HSP 1 Score: 91.2781 bits (225), Expect = 1.321e-18
Identity = 54/161 (33.54%), Postives = 84/161 (52.17%), Query Frame = 2
Query: 2210 WAKSLNSFNNLDIADQIVLLEDVWFEMLIISFL--QFCFP------------LELTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            WA++   F  L + DQ+VLL+  W E+L++  L  Q  +             +E++ ++  +     S V    DL+ K R  QLD  EFV LK ++L  P  KS+ DR ++E  QE     L  HT Q Y  Q  +FG+ LL +P +RS++ Q ++E L+
Sbjct:  351 WARNCALFKELKVEDQMVLLQSCWSELLVLDHLYRQVAYGKDGSVYLVTGQQIEVSTVLSQAGPTLSSLVSRAQDLVSKLRALQLDRQEFVCLKYLVLFNPDVKSVQDRQQVERTQERVNRALMGHTLQSYPGQSDKFGQLLLRLPEVRSISLQ-VEEYLY 510          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Sea Lamprey
Match: nr2e3 (nuclear receptor subfamily 2, group E, member 3 [Source:ZFIN;Acc:ZDB-GENE-041114-63])

HSP 1 Score: 97.8265 bits (242), Expect = 9.764e-22
Identity = 47/159 (29.56%), Postives = 80/159 (50.31%), Query Frame = 2
Query: 2192 IIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCF------------------PLELTLIMRTS---------SYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGR 2587
            + +  +WAK+L +F+ L   DQ++LLE+ W E+ ++   Q+                    P    L    S         ++G   ++  L D+ ++FR   +DP+EF  LK ++L KP    L D  ++E LQ+ +Q+ML+ H +  Y +QPARFG+
Sbjct:  231 LFMAIKWAKNLPAFSALPFRDQVILLEEAWSELFLLCSAQWALHSDGSRAFQGAAAAAAASPCPCPLGAAGSPEGSCPLQAAHGGAVDLRLLRDMTERFRDLTVDPTEFACLKAVVLFKPEASGLKDGDQVESLQDQSQVMLNQHCRALYPSQPARFGK 389          

HSP 2 Score: 97.8265 bits (242), Expect = 1.099e-21
Identity = 42/54 (77.78%), Postives = 48/54 (88.89%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLD 421
            YRCQA TG CT+DKAHRNQCQACRL+KCL  GMNKDAVQNERQPR+++Q+R  D
Sbjct:   85 YRCQASTGLCTVDKAHRNQCQACRLRKCLHAGMNKDAVQNERQPRSTAQVRPGD 138          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Sea Lamprey
Match: nr2f1b (nuclear receptor subfamily 2, group F, member 1b [Source:NCBI gene;Acc:393564])

HSP 1 Score: 90.1225 bits (222), Expect = 9.831e-20
Identity = 50/172 (29.07%), Postives = 87/172 (50.58%), Query Frame = 2
Query: 2168 LIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTS----SYGTVSEVEFLMDLIK-------KFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + +   R +     WA+++  F +L I DQ+ LL  VW E+ +++  Q   PL +  ++  +    S  +   V   MD I+       K +   +D +E+  LK I+L       L D   IE LQE +Q  L  + +  Y NQP RFG+ LL +P++R+V++  ++++ F
Sbjct:  128 ICELAARLLFSAVEWARNIPFFPDLQITDQVALLRLVWSELFVLNAAQCAMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFSTDACGLSDAAHIENLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFF 299          

HSP 2 Score: 48.1358 bits (113), Expect = 5.493e-6
Identity = 21/37 (56.76%), Postives = 26/37 (70.27%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDA 370
            Y C+A    C ID+ HRNQCQ CRLKKCL +GM ++ 
Sbjct:    9 YTCRANRN-CPIDQHHRNQCQYCRLKKCLKVGMRREG 44          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Sea Lamprey
Match: rxrgb (retinoid X receptor, gamma b [Source:NCBI gene;Acc:436617])

HSP 1 Score: 59.6918 bits (143), Expect = 5.949e-10
Identity = 46/179 (25.70%), Postives = 80/179 (44.69%), Query Frame = 2
Query: 2150 TTHNNPLIDF---TFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTS-----SYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIIL----LKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            T+ N+P+ +      + +     W+K +  F+ L + DQ++LL   W E+LI SF      +   +++ T      S    + V  + D     R   L   +   +K ++L    L    K L     +E L+E     L  + KQ Y +QP RF + LL +P +RS+  + L+ + F
Sbjct:   63 TSPNDPVTNICQAADKQLFTLVEWSKRVPHFSELPLDDQVILLRAGWNELLIASFSHRSIGVSDGILLATGLHVHRSSAHSAGVGSIFDRWAPERPRSLRCVKTGEIKVVLLATHPLVLHAKGLSSPSDVEALREKVYASLESYCKQKYPDQPGRFAKLLLRLPALRSIGLKCLEHLFF 241          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002705.1 (pep scaffold:Pmarinus_7.0:GL501128:21434:36771:-1 gene:ENSPMAG00000002463.1 transcript:ENSPMAT00000002705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 1.003e-9
Identity = 38/146 (26.03%), Postives = 70/146 (47.95%), Query Frame = 2
Query: 2228 SFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTS--SYGTVSEVEFLMD-------LIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQ 2638
             F+ L + DQ+ LL+  W E+L++       P E  L+          +S +  L+D       L++K++  +L+  EFV LK I L+   +  + D   ++ LQ+     L       ++  P R G+ L+ +P +R  AT+++Q
Sbjct:    1 GFSALSLGDQMSLLQSAWMEVLLLGVAFRSLPYEDELVYAEDFVMDEELSRLAGLLDLNSAVLQLVRKYKALKLEREEFVALKAIALVNSDSMHIEDVEGVQKLQDVLHEALQELQGSQHAEDPRRAGKLLMTLPLLRQTATRAVQ 146          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Sea Lamprey
Match: nr2c2 (nuclear receptor subfamily 2, group C, member 2 [Source:ZFIN;Acc:ZDB-GENE-080403-8])

HSP 1 Score: 55.4546 bits (132), Expect = 2.602e-8
Identity = 36/148 (24.32%), Postives = 63/148 (42.57%), Query Frame = 2
Query: 2186 RHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRT----------SSYGTVSEVEFLMDLIKKFRGF-------QLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPAR 2578
            R + ++  WA+S+ +F  L       L+   W E+  +   Q    + L+ I+                T   V+ +M+ I K + F        +DP E+ +LK IIL  P    L++  +I+  QE A + L  +  + Y + P R
Sbjct:  132 RLLFLSMHWARSIPAFQALGQEGNTGLVRACWNELFTLGLAQCAQVMNLSTILTAIVNHLQASLQQDKLTTERVKVVMEHIWKLQEFCNSMSKLNVDPYEYAYLKAIILFSPDHPGLVNTAQIDRFQEKAHVELHEYMSKSYPDDPHR 279          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Nematostella
Match: EDO43049 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZU0])

HSP 1 Score: 114.775 bits (286), Expect = 1.300e-27
Identity = 77/247 (31.17%), Postives = 126/247 (51.01%), Query Frame = 2
Query: 2003 STENPFLPGSNRAHQDVNYSS--QFETLN--QFFKQKIEWKGISQYHSPMLSTTTHNNPLI------------DFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELT--LIMRTSSYG-----TVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLFGVSAKIDI 2674
            ST+ P      +A +D NY S   F+T+N   F     E    +   SP    +T N P I            D   R +  + R+A+++  F  L   DQI+LLE+ W E+ ++    +  PLE+   L +    +G       SE++ L +L+ + R FQ+D +E   LK I+L +P TK L D  +++ +Q+H QL+L+HHT   +   P+RFG+ LL +  + S+A + +++VLF  +   DI
Sbjct:  102 STQTPL---HQQATEDSNYPSGTDFDTINPSNFSSTISESSHSA---SPYEELSTPNRPTISYVQQVSSKNIQDAATRLLSASIRFARNVPCFTRLPFRDQIILLEEGWKELFLLDAAYWALPLEIASLLAVTGGCHGDSYRHKASEIKLLQELLARLRSFQMDLNELACLKAIVLFRPETKGLKDSDQVDKIQDHIQLLLAHHTMTKHPTHPSRFGKLLLSISPLHSLAEKPIEDVLFRKTDDKDI 342          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Nematostella
Match: EDO38322 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD88])

HSP 1 Score: 100.523 bits (249), Expect = 7.451e-23
Identity = 56/184 (30.43%), Postives = 106/184 (57.61%), Query Frame = 2
Query: 2132 SPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSY-----------GTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            SP+  ++   + L +   R + ++ +WA+++ SF NL   DQ+VLLE+ W E+ I+  +Q+  PLE+  ++  +              T++++  L ++  +FR  Q+  +EF  LK I+L KP  + L D  ++E  Q+ AQ+ML  + K+ ++ Q  RFG+ LL +P++R V  ++++E+ F
Sbjct:  139 SPLFCSSP--DALFESAARLLFMSVKWARNIPSFVNLPFRDQVVLLEEGWRELFIMGAIQWNLPLEVAPLLAAAGMHVDNTPAEKIVATMADIRKLQEIGSRFRALQVCEAEFACLKAIVLFKPDLRDLRDPQQVECYQDQAQIMLGDYIKRQFAGQQVRFGKLLLMLPSLRLVRNKTIEELFF 320          

HSP 2 Score: 64.3142 bits (155), Expect = 6.511e-11
Identity = 31/50 (62.00%), Postives = 38/50 (76.00%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQI 409
            Y C+ G G CT+DK  RNQCQACR KKCL + MN+ AVQ ERQP NS+++
Sbjct:   43 YTCK-GNGGCTVDKKRRNQCQACRFKKCLEVKMNRFAVQQERQP-NSTRV 90          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Nematostella
Match: EDO38323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD90])

HSP 1 Score: 97.8265 bits (242), Expect = 6.558e-22
Identity = 62/197 (31.47%), Postives = 106/197 (53.81%), Query Frame = 2
Query: 2102 IEWKGI---SQYHSPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSY-----------GTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            +E+K I   S    PM  ++  +  + +   + + ++ +WA+++ SF +L   DQ++LLE+ W E+ ++   Q+  PLE+  I+  S               ++ V  L + + KF+ F +D +EF  LK I+L KP    L D  +IE  Q+ AQLML  + +  Y  Q ARFGR LL +P +R V+  +++E+ F
Sbjct:  143 LEYKPIRLQSDMSVPMYYSSPES--VCEAAAKLLFMSVKWARNIPSFMSLPFRDQVILLEEGWRELFLLGASQWSMPLEIAPILAASGMHVDNTPPEKIVDVMATVRTLQEAVNKFKAFGVDSTEFACLKAIVLFKPAACGLKDPEQIETTQDQAQLMLGEYIRSTYPTQVARFGRLLLLLPALRRVSALAIEELFF 337          

HSP 2 Score: 69.707 bits (169), Expect = 1.387e-12
Identity = 31/50 (62.00%), Postives = 39/50 (78.00%), Query Frame = 2
Query:  260 YRCQA--GTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 403
            Y C+A  G G C +DK HRNQC++CRLKKC  + MNKDAVQ+ER PR+S+
Sbjct:   42 YTCRATNGKGNCPVDKIHRNQCRSCRLKKCFDVSMNKDAVQHERGPRSST 91          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Nematostella
Match: EDO32715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUB6])

HSP 1 Score: 91.2781 bits (225), Expect = 6.331e-20
Identity = 47/190 (24.74%), Postives = 100/190 (52.63%), Query Frame = 2
Query: 2135 PMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSS-----------YGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPT-------TKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            P    T   + + +   + + ++  WA+++ +F +L   DQ +LLE+ W E+ ++S  QF  PL++  ++  +               ++++  L +++ +F+  Q+D +E+  LK I+L KP         + L     +E LQ+ AQ ML  + +  Y +Q  RFG+ LL +P++++V+ + ++++ F
Sbjct:  118 PTGYQTAPQDSIYESAVQLLYMSVTWARNIPTFLDLPFRDQAILLEEGWSELFVLSSAQFSLPLDMGPLLSAAGLQVDKAPTDRIVAGMADIRLLQNIVTRFKRLQIDSTEYACLKAIVLFKPVLPFFPVNLRGLRAPQLVERLQDQAQSMLGEYCRSQYPDQQVRFGKLLLMLPSLKTVSPKMIEDLFF 307          

HSP 2 Score: 65.855 bits (159), Expect = 1.671e-11
Identity = 32/50 (64.00%), Postives = 38/50 (76.00%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQI 409
            Y C+   G+C +D A RNQCQACRLKKC  + MNKDAVQ+ER PR S+QI
Sbjct:   35 YHCKE-LGKCVVDVARRNQCQACRLKKCFEVQMNKDAVQHERAPR-SAQI 82          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Nematostella
Match: EDO37645 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF49])

HSP 1 Score: 82.4185 bits (202), Expect = 1.191e-16
Identity = 42/151 (27.81%), Postives = 72/151 (47.68%), Query Frame = 2
Query: 2168 LIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGT-----------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGR 2587
            + +   R +     WA+++  F +L + DQ+ LL  VW E+ +++  Q   PL++  ++ T+   +           +  +    + ++K R   +D +EF  LK I+L       L D   IE LQE  Q  L  +T+  Y NQP RFG+
Sbjct:  164 ICELAARLLFSAVEWARNIPFFPDLAVTDQVALLRLVWSELFVLNAAQCPMPLQVAPLLATAGIHSNHMSPDRMVSFMDNIRIFQEQVEKLRNLHVDAAEFACLKAIVLFTSDASGLTDPQYIESLQEKTQCALEEYTRNQYPNQPTRFGK 314          

HSP 2 Score: 56.9954 bits (136), Expect = 1.847e-8
Identity = 27/52 (51.92%), Postives = 34/52 (65.38%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRN 415
            Y C+A    C ID+ HRNQCQ CRLKKCL +GM ++AVQ  R P   +  +N
Sbjct:   62 YTCRASRD-CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRIPAAQTPTQN 112          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Medaka
Match: ENSORLT00000036756.1 (photoreceptor-specific nuclear receptor-like [Source:NCBI gene;Acc:101157353])

HSP 1 Score: 118.242 bits (295), Expect = 1.217e-28
Identity = 60/189 (31.75%), Postives = 111/189 (58.73%), Query Frame = 2
Query: 2111 KGISQYHSPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLE---------LTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            +  S+YH  +  +++ N  + + + R + ++ +WAK+L  F+NL   DQ++LLE+ W E+ ++  +Q+  PL+         L   M+  +  T  ++  L +   +F+   +DP+EF  LK I+L KP T+ L D  ++E LQ+ +Q+ML  H +  Y +QPARFG+ LL +P++R V ++ ++ + F
Sbjct:  112 RASSEYHMALYPSSSEN--VYETSARLLFMSVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLCAIQWSLPLDSCPLLSLPDLCPGMQGKTSYTGLDLRLLQEAFSRFKALAVDPTEFACLKAIVLFKPETRGLKDPEQVENLQDQSQVMLGQHIRSHYPSQPARFGKLLLLLPSLRFVNSERIELLFF 298          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Medaka
Match: NR2E3 (photoreceptor-specific nuclear receptor-like [Source:NCBI gene;Acc:101156874])

HSP 1 Score: 119.013 bits (297), Expect = 5.293e-28
Identity = 62/189 (32.80%), Postives = 112/189 (59.26%), Query Frame = 2
Query: 2111 KGISQYHSPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLE---------LTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            +  S+YH  +  +++ N  + + + R + ++ +WAK+L  F+NL   DQ++LLE+ W E+ ++  +Q+  PL+         L   M+  +  T  ++  L +   +F+   +DP+EF  LK I+L KP T+ L D  ++E LQ+ +Q+ML  H +  Y +QPARFG+ LL +P++R V ++ + E+LF
Sbjct:  225 RASSEYHMALYPSSSEN--VYETSARLLFMSVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLCAIQWSLPLDSCPLLSLPDLCPGMQGKTSYTGLDLRLLQEAFSRFKALAVDPTEFACLKAIVLFKPETRGLKDPEQVENLQDQSQVMLGQHIRSHYPSQPARFGKLLLLLPSLRFVNSERI-ELLF 410          

HSP 2 Score: 105.916 bits (263), Expect = 9.774e-24
Identity = 49/68 (72.06%), Postives = 55/68 (80.88%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQI--DPNMNHVTVT 457
            YRCQAGTG C +DKAHRNQCQACRLKKCL  GMNKDAVQNERQPR+++Q+R LD I  DP   H+  T
Sbjct:   80 YRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNERQPRSTAQVR-LDSIDVDPEKEHLATT 146          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Medaka
Match: nr2e1 (nuclear receptor subfamily 2 group E member 1 [Source:NCBI gene;Acc:100049530])

HSP 1 Score: 106.686 bits (265), Expect = 2.801e-24
Identity = 59/191 (30.89%), Postives = 103/191 (53.93%), Query Frame = 2
Query: 2132 SPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGT-----------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLK--PTTKSLIDRV-----KIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            +PM         + +   R + ++ +WAKS+ +F+ L ++DQ++LLED W E+ ++   Q+  P++ T ++  S   +           ++E++ L +++ +FR  +LD +EF  LK I+  K  PT  S   R       I  LQ+ AQL L+ +    Y  QP RFG+ LL +P +RSV+  +++EV F
Sbjct:  161 TPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLPLSDQLILLEDAWRELFVLGIAQWAIPVDSTTLLAVSGLNSENMEAQRMNKIMTEIQALQEVVTRFRQMRLDATEFACLKCIVTFKAVPTQGSAELRAFRNASAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSVSPSTIEEVFF 351          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Medaka
Match: nr2e1 (nuclear receptor subfamily 2 group E member 1 [Source:NCBI gene;Acc:100049530])

HSP 1 Score: 106.301 bits (264), Expect = 4.898e-24
Identity = 59/191 (30.89%), Postives = 103/191 (53.93%), Query Frame = 2
Query: 2132 SPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGT-----------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLK--PTTKSLIDRV-----KIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            +PM         + +   R + ++ +WAKS+ +F+ L ++DQ++LLED W E+ ++   Q+  P++ T ++  S   +           ++E++ L +++ +FR  +LD +EF  LK I+  K  PT  S   R       I  LQ+ AQL L+ +    Y  QP RFG+ LL +P +RSV+  +++EV F
Sbjct:  184 TPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLPLSDQLILLEDAWRELFVLGIAQWAIPVDSTTLLAVSGLNSENMEAQRMNKIMTEIQALQEVVTRFRQMRLDATEFACLKCIVTFKAVPTQGSAELRAFRNASAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSVSPSTIEEVFF 374          

HSP 2 Score: 73.1738 bits (178), Expect = 4.094e-13
Identity = 32/49 (65.31%), Postives = 40/49 (81.63%), Query Frame = 2
Query:  260 YRCQAGT-GRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 403
            Y C++G+ G C +DK HRNQC+ACRLKKCL + MNKDAVQ+ER PR S+
Sbjct:   61 YLCKSGSQGGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTST 109          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Medaka
Match: nr2e3 (photoreceptor-specific nuclear receptor [Source:NCBI gene;Acc:101164305])

HSP 1 Score: 105.145 bits (261), Expect = 7.802e-24
Identity = 52/166 (31.33%), Postives = 94/166 (56.63%), Query Frame = 2
Query: 2180 TFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPL---------ELTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLF 2650
            + R + ++ +W K+L  F +L   DQ++LLE+ W EM ++  +Q+  P+         EL+   +       S+++ L ++  +F+   +DP+EF  LK I+L KP  +SL D  ++E LQ+ +Q++L  H    Y NQ  RFGR LL +P++  V++  + ++ F
Sbjct:  188 SARLLFMSVKWTKNLPIFAHLPFRDQVILLEESWSEMFLLCVIQWSLPMDSCPLLSLPELSPKQQAKVSPPTSDLQILEEVFNRFKALTVDPTEFACLKAIVLFKPEARSLKDPEQVENLQDQSQVLLGQHIYSAYPNQSTRFGRMLLLLPSLHFVSSAKIGQLFF 353          

HSP 2 Score: 98.2117 bits (243), Expect = 1.918e-21
Identity = 41/50 (82.00%), Postives = 46/50 (92.00%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQI 409
            YRCQAGTGRC +DKAHRNQCQACRLKKCL  GMNKDAVQNERQPR+++ +
Sbjct:   62 YRCQAGTGRCPVDKAHRNQCQACRLKKCLQSGMNKDAVQNERQPRSTAHV 111          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Planmine SMEST
Match: SMESG000078919.1 (SMESG000078919.1)

HSP 1 Score: 448.743 bits (1153), Expect = 1.647e-152
Identity = 227/268 (84.70%), Postives = 230/268 (85.82%), Query Frame = 2
Query: 1895 MLEWFCITGSYWNNSNDGFNINDQNKPFDQPLNISTSTENPFLPGSNRAHQDVNYSSQFETLNQFFKQKIEWKGISQYHSPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLFGVSAKIDIKNFITQFI 2698
            MLEWFCITGSYWNNSNDGFNINDQNKPFDQPLNISTSTENPFLPGSNRAHQD                        ++H              +FTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLFGVSAKIDIKNFITQFI
Sbjct:    1 MLEWFCITGSYWNNSNDGFNINDQNKPFDQPLNISTSTENPFLPGSNRAHQD------------------------EFH--------------NFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLFGVSAKIDIKNFITQFI 230          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Planmine SMEST
Match: SMESG000078919.1 (SMESG000078919.1)

HSP 1 Score: 434.876 bits (1117), Expect = 3.700e-142
Identity = 219/260 (84.23%), Postives = 222/260 (85.38%), Query Frame = 2
Query: 1919 GSYWNNSNDGFNINDQNKPFDQPLNISTSTENPFLPGSNRAHQDVNYSSQFETLNQFFKQKIEWKGISQYHSPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLFGVSAKIDIKNFITQFI 2698
            GSYWNNSNDGFNINDQNKPFDQPLNISTSTENPFLPGSNRAHQD                        ++H              +FTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLFGVSAKIDIKNFITQFI
Sbjct:  340 GSYWNNSNDGFNINDQNKPFDQPLNISTSTENPFLPGSNRAHQD------------------------EFH--------------NFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLFGVSAKIDIKNFITQFI 561          

HSP 2 Score: 397.127 bits (1019), Expect = 1.170e-127
Identity = 189/189 (100.00%), Postives = 189/189 (100.00%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQIDPNMNHVTVTANIQSLEDHQKARHIEMDIKEEKRNIIYENFGHSDDSEKRVIFPSISNGSLICEKNSLSKSTEPILSNGGYSIDNSASHSPYVSNLPFFSTQFMKPSKIFTSLFNSLMFMPPFSRSGPSVGNG 826
            YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQIDPNMNHVTVTANIQSLEDHQKARHIEMDIKEEKRNIIYENFGHSDDSEKRVIFPSISNGSLICEKNSLSKSTEPILSNGGYSIDNSASHSPYVSNLPFFSTQFMKPSKIFTSLFNSLMFMPPFSRSGPSVGNG
Sbjct:  152 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQIDPNMNHVTVTANIQSLEDHQKARHIEMDIKEEKRNIIYENFGHSDDSEKRVIFPSISNGSLICEKNSLSKSTEPILSNGGYSIDNSASHSPYVSNLPFFSTQFMKPSKIFTSLFNSLMFMPPFSRSGPSVGNG 340          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Planmine SMEST
Match: SMESG000078919.1 (SMESG000078919.1)

HSP 1 Score: 434.491 bits (1116), Expect = 4.681e-142
Identity = 219/260 (84.23%), Postives = 222/260 (85.38%), Query Frame = 2
Query: 1919 GSYWNNSNDGFNINDQNKPFDQPLNISTSTENPFLPGSNRAHQDVNYSSQFETLNQFFKQKIEWKGISQYHSPMLSTTTHNNPLIDFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLFGVSAKIDIKNFITQFI 2698
            GSYWNNSNDGFNINDQNKPFDQPLNISTSTENPFLPGSNRAHQD                        ++H              +FTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLFGVSAKIDIKNFITQFI
Sbjct:  339 GSYWNNSNDGFNINDQNKPFDQPLNISTSTENPFLPGSNRAHQD------------------------EFH--------------NFTFRHIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLFGVSAKIDIKNFITQFI 560          

HSP 2 Score: 397.127 bits (1019), Expect = 1.262e-127
Identity = 189/189 (100.00%), Postives = 189/189 (100.00%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQIDPNMNHVTVTANIQSLEDHQKARHIEMDIKEEKRNIIYENFGHSDDSEKRVIFPSISNGSLICEKNSLSKSTEPILSNGGYSIDNSASHSPYVSNLPFFSTQFMKPSKIFTSLFNSLMFMPPFSRSGPSVGNG 826
            YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQIDPNMNHVTVTANIQSLEDHQKARHIEMDIKEEKRNIIYENFGHSDDSEKRVIFPSISNGSLICEKNSLSKSTEPILSNGGYSIDNSASHSPYVSNLPFFSTQFMKPSKIFTSLFNSLMFMPPFSRSGPSVGNG
Sbjct:  151 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQIRNLDQIDPNMNHVTVTANIQSLEDHQKARHIEMDIKEEKRNIIYENFGHSDDSEKRVIFPSISNGSLICEKNSLSKSTEPILSNGGYSIDNSASHSPYVSNLPFFSTQFMKPSKIFTSLFNSLMFMPPFSRSGPSVGNG 339          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Planmine SMEST
Match: SMESG000056421.1 (SMESG000056421.1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.438e-18
Identity = 55/182 (30.22%), Postives = 96/182 (52.75%), Query Frame = 2
Query: 2189 HIIINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLEL-----TLIMRTSSYGT------VSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEVLFG-VSAKIDIKNFITQFI 2698
            H +I  +W+KS+  F +L I DQI LL+  W E+ +++      PL L     ++ ++ +  G       +  +  + D I+K + FQ+D +EF  LK ++L     + L D V +E +QE  Q  L  + K  Y NQ  RFG+ LL +P ++S+ +  ++E+LF  +     + N I ++I
Sbjct:  264 HGVI--QWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKEYI 443          

HSP 2 Score: 58.5362 bits (140), Expect = 1.619e-8
Identity = 28/49 (57.14%), Postives = 32/49 (65.31%), Query Frame = 2
Query:  260 YRCQAGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSSQ 406
            Y C+ G   C ID  HRNQCQ CR +KCL MGM K+AVQ  R P+ SS 
Sbjct:  146 YSCR-GNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSH 193          
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Planmine SMEST
Match: SMESG000078464.1 (SMESG000078464.1)

HSP 1 Score: 80.1073 bits (196), Expect = 4.259e-15
Identity = 50/162 (30.86%), Postives = 86/162 (53.09%), Query Frame = 2
Query: 2204 FRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCF-----PLELTL-------IMRTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDRVKIELLQEHAQLMLSHHTKQFYSNQ-PARFGRHLLCVPTIRSVATQSLQEVLF 2650
             RW++ L  F  +D  DQI+L+++ W ++LI   L  C+     P E+ L       +      G    V F++ + +K + F+LD  EF  LK ++L++P  K+L    ++   QE    +L  +T Q Y N+ P +F   ++C+P IRS A+ S++E+L 
Sbjct:  528 VRWSRLLPEFAAIDTDDQIMLVQNCWADLLI---LDCCYRSLGDPREIHLTSGKCINLEAACELGAKEIVAFILQMTQKLKRFKLDIREFACLKVLLLMQPDLKNLKAEGRVRTFQETVSQLLLDYTTQNYENEIPNKFYDLIMCIPEIRS-ASFSVKEMLI 685          
The following BLAST results are available for this feature:
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NR2E35.988e-2632.94nuclear receptor subfamily 2 group E member 3 [Sou... [more]
NR2E31.771e-2532.94nuclear receptor subfamily 2 group E member 3 [Sou... [more]
NR2E11.961e-2329.84nuclear receptor subfamily 2 group E member 1 [Sou... [more]
NR2E12.825e-2329.84nuclear receptor subfamily 2 group E member 1 [Sou... [more]
NR2E32.375e-2232.19nuclear receptor subfamily 2 group E member 3 [Sou... [more]
back to top
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fax-15.815e-2377.59Nuclear hormone receptor FAX-1 [Source:UniProtKB/... [more]
fax-17.853e-2377.59Nuclear hormone receptor FAX-1 [Source:UniProtKB/... [more]
nhr-678.552e-1475.61Nuclear hormone receptor family member nhr-67 [So... [more]
nhr-2393.170e-955.56Nuclear Hormone Receptor family [Source:UniProtKB... [more]
nhr-1113.629e-962.50Nuclear hormone receptor family member nhr-111 [S... [more]
back to top
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hr512.676e-2388.24gene:FBgn0034012 transcript:FBtr0114456[more]
dsf7.897e-2131.95gene:FBgn0015381 transcript:FBtr0333245[more]
dsf7.897e-2131.95gene:FBgn0015381 transcript:FBtr0079145[more]
svp2.804e-1929.65gene:FBgn0003651 transcript:FBtr0082562[more]
svp1.193e-1829.65gene:FBgn0003651 transcript:FBtr0082564[more]
back to top
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr2e34.774e-2532.53nuclear receptor subfamily 2, group E, member 3 [S... [more]
nr2e35.060e-2532.53nuclear receptor subfamily 2, group E, member 3 [S... [more]
nr2e12.678e-2430.89nuclear receptor subfamily 2, group E, member 1 [S... [more]
rxrgb5.207e-1924.55retinoid X receptor, gamma b [Source:NCBI gene;Acc... [more]
rxrgb5.921e-1924.55retinoid X receptor, gamma b [Source:NCBI gene;Acc... [more]
back to top
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr2e32.066e-2733.52nuclear receptor subfamily 2 group E member 3 [Sou... [more]
nr2e32.948e-2733.73nuclear receptor subfamily 2 group E member 3 [Sou... [more]
NR2E15.935e-2329.44nuclear receptor subfamily 2 group E member 1 [Sou... [more]
NR2E17.004e-2329.61nuclear receptor subfamily 2 group E member 1 [Sou... [more]
NR2E17.321e-2329.44nuclear receptor subfamily 2 group E member 1 [Sou... [more]
back to top
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nr2e32.838e-2636.05nuclear receptor subfamily 2, group E, member 3 [S... [more]
Nr2e12.742e-2430.37nuclear receptor subfamily 2, group E, member 1 [S... [more]
Nr2f17.925e-1928.49nuclear receptor subfamily 2, group F, member 1 [S... [more]
Nr2f17.925e-1928.49nuclear receptor subfamily 2, group F, member 1 [S... [more]
Rxrg9.024e-1932.48retinoid X receptor gamma [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QXZ7|NR2E3_MOUSE1.985e-2536.05Photoreceptor-specific nuclear receptor OS=Mus mus... [more]
sp|Q9Y5X4|NR2E3_HUMAN8.506e-2532.94Photoreceptor-specific nuclear receptor OS=Homo sa... [more]
sp|Q9TTF0|NR2E3_BOVIN1.942e-2433.53Photoreceptor-specific nuclear receptor OS=Bos tau... [more]
sp|Q64104|NR2E1_MOUSE1.918e-2330.37Nuclear receptor subfamily 2 group E member 1 OS=M... [more]
sp|Q9YGL3|NR2E1_ORYLA3.486e-2330.89Nuclear receptor subfamily 2 group E member 1 OS=O... [more]
back to top
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8GS566.062e-2835.93NR LBD domain-containing protein OS=Octopus bimacu... [more]
A0A3P9ADC51.681e-2733.33Nuclear receptor subfamily 2 group E member 3 OS=E... [more]
A0A3P8YUE91.973e-2734.39Nuclear receptor subfamily 2 group E member 3 OS=E... [more]
A0A0P7XGH92.284e-2732.28Photoreceptor-specific nuclear receptor-like OS=Sc... [more]
A0A433U0Z13.232e-2736.05Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
back to top
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr2e37.626e-2432.26nuclear receptor subfamily 2 group E member 3 [Sou... [more]
nr2e12.321e-2130.17nuclear receptor subfamily 2 group E member 1 [Sou... [more]
rxrab7.601e-1931.85retinoic acid receptor RXR-alpha-B [Source:NCBI ge... [more]
rxrab1.161e-1831.85retinoic acid receptor RXR-alpha-B [Source:NCBI ge... [more]
nr5a51.321e-1833.54steroidogenic factor 1-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr2e39.764e-2229.56nuclear receptor subfamily 2, group E, member 3 [S... [more]
nr2f1b9.831e-2029.07nuclear receptor subfamily 2, group F, member 1b [... [more]
rxrgb5.949e-1025.70retinoid X receptor, gamma b [Source:NCBI gene;Acc... [more]
ENSPMAT00000002705.11.003e-926.03pep scaffold:Pmarinus_7.0:GL501128:21434:36771:-1 ... [more]
nr2c22.602e-824.32nuclear receptor subfamily 2, group C, member 2 [S... [more]
back to top
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO430491.300e-2731.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383227.451e-2330.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383236.558e-2231.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327156.331e-2024.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376451.191e-1627.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000036756.11.217e-2831.75photoreceptor-specific nuclear receptor-like [Sour... [more]
NR2E35.293e-2832.80photoreceptor-specific nuclear receptor-like [Sour... [more]
nr2e12.801e-2430.89nuclear receptor subfamily 2 group E member 1 [Sou... [more]
nr2e14.898e-2430.89nuclear receptor subfamily 2 group E member 1 [Sou... [more]
nr2e37.802e-2431.33photoreceptor-specific nuclear receptor [Source:NC... [more]
back to top
BLAST of Nuclear receptor subfamily 2 group E member 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078919.11.647e-15284.70SMESG000078919.1[more]
SMESG000078919.13.700e-14284.23SMESG000078919.1[more]
SMESG000078919.14.681e-14284.23SMESG000078919.1[more]
SMESG000056421.13.438e-1830.22SMESG000056421.1[more]
SMESG000078464.14.259e-1530.86SMESG000078464.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030630 ID=SMED30030630|Name=Nuclear receptor subfamily 2 group E member 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2752bp
TACGCCGAAATATACGGTAATTATGAGGATTTGTATATTATTGGCGTTAA
AGTTTATGAAGTCACTTTTATATCATTATGCTTTTATGTACTTTACGTCT
TTGAATGTTATATATAATTGTGAATAAATCTGAAAATATTAATTACATTT
TTTATTGAATTATCTTCAATTTATTTTAGTTAGCTTTCTTTTTAAAAGAA
ATTTAAGTTTTTAGTCACTTTGAATTTGTTCATTATATATTTATTATATA
TGGAATTAATATAGATGTCAAGCTGGAACTGGAAGGTGTACCATCGACAA
GGCTCACCGAAACCAATGTCAAGCATGTCGCCTGAAAAAATGCCTATTAA
TGGGAATGAATAAAGATGCAGTACAAAATGAAAGGCAACCAAGAAATAGT
TCTCAAATTCGGAATCTTGATCAAATTGACCCTAATATGAATCATGTTAC
TGTAACTGCAAATATTCAGTCTTTGGAGGATCATCAAAAGGCTCGCCATA
TTGAAATGGATATTAAAGAAGAAAAACGAAATATAATCTATGAAAATTTT
GGTCACTCTGATGACAGCGAAAAACGTGTTATCTTTCCAAGCATCTCCAA
TGGATCATTAATTTGTGAAAAGAACTCATTGAGTAAATCAACCGAACCAA
TCCTTTCCAATGGGGGTTATTCAATAGATAATTCTGCGTCTCATTCTCCG
TATGTATCAAATTTGCCATTTTTCTCTACCCAGTTTATGAAACCATCGAA
GATATTTACATCTCTTTTCAATTCATTAATGTTCATGCCACCTTTTTCAA
GATCAGGCCCTTCAGTTGGCAACGGTAAGAAATTGTCAAGTAATATCTAT
ATTGACATTTAAAGTTAATTAAATATTCAATTACCGAAACTTAAGAGCCC
CTTCATACAAGTTCCTTTAAAATTCTTGGTTTTTATTATTAAGAGAATGT
AGGGGACAATATCAAGAAAAATGCTTGAGAAAATAAATCAAAACGAATAT
TAAGGAAGATGCTGTGTCATTTATATTAATTTATAACACTCTCAAAGCAC
TCTCAACCACAAAATAACAAAACAACTTTGTTCTAATCATCTATAATGCG
TAAAATTTTCATTTTTTCTTAAAACTTTTAATATTTTTTGCATATAATTC
TCAAATAACATTTTGTTTTTGAAAATTATTTCATCGTCCAAATTTAATAA
ATACTTCTTTTCGATTTCATTTCTAATTCTTATTCACAAAGATGAGGAAT
CCAACTAGAACATACATTAAAAATAAATAACTCAAAATATTAGAATTTCC
ACTAGCTCCTATTTATTTTCAATGAGTGAAAGGAAATATTTGAACGATAG
TAAAAGCTTTTTCAATGTTCCTTCGAATTGATTAATTATTTTTAAATGAT
GAAAATCTACCTTGTTTTGTTGCAGACTCAAATTTAATAATTTCCATTGA
GACATGTCATGAAATACTTTTATTTTGATAGTCATCAAATTATGGTAAAT
AATAAACATCTGTATTCAGAATCCGTTGAATTTAACTACTTTCTTCCTTG
TCTTGAGAAGCTTAGTAGAAAAGATCCTCGTACCGACCTTATATATAATG
CAAAATTTACGCAGCCACTCAAGGCTTATCAGTTGAAAGTATGACATTAT
TGATCGTTATAATAATAAAATGTGGATAAATTTTTCTCATATTCATATCA
TAAAATATCATTTTAAATTATTCCATATTTCAATTTATCCGAAAATATTT
TTGTTGATAAGGTCAAACAAATTATTTTATTAAATAAAATCAAGACTGGG
AATACATGGTTGTCAAGTTGCAACCATAGCTTGGAAGATTGAATATAAAT
TCTCTTTATATTGAAAATATTTTTGGTTGAGAATATAAGTGTTTATGCTT
GAATGGTTTTGTATTACAGGTTCTTATTGGAACAATTCTAACGATGGATT
CAATATAAATGATCAGAATAAACCCTTTGATCAACCTTTAAATATTTCAA
CATCTACTGAAAATCCGTTTCTACCTGGAAGCAATAGAGCTCATCAAGAT
GTCAATTATTCATCTCAATTTGAAACATTAAATCAATTTTTCAAACAAAA
AATTGAATGGAAAGGAATTTCACAGTATCATTCTCCTATGTTATCTACAA
CGACTCATAATAACCCTTTGATAGATTTTACGTTTCGGCACATTATAATA
AATTTTCGTTGGGCTAAAAGTCTAAATTCGTTCAACAATCTAGATATTGC
AGATCAAATAGTTCTGTTGGAAGATGTTTGGTTTGAGATGCTTATTATTA
GTTTCCTACAATTTTGCTTTCCACTTGAATTGACATTGATCATGAGAACT
TCGAGCTATGGCACTGTATCAGAAGTGGAATTTCTAATGGACTTAATTAA
GAAATTTAGAGGATTTCAGTTGGATCCAAGTGAATTTGTTTTTCTGAAAA
CAATAATACTTCTGAAACCTACAACGAAATCACTCATTGATAGAGTAAAA
ATTGAGTTGCTGCAAGAACATGCACAATTAATGCTATCACACCACACTAA
ACAGTTTTATTCAAATCAACCAGCAAGATTTGGTCGACATTTATTGTGCG
TCCCAACAATAAGATCTGTTGCTACACAATCCTTACAAGAAGTGCTTTTT
GGAGTTTCGGCTAAAATCGACATAAAAAACTTCATTACACAATTTATAAA
TAATCTCAAAAATTGACGAAATTATTTATTAAATGATTACTCTATTCTTA
AT
back to top

protein sequence of SMED30030630-orf-1

>SMED30030630-orf-1 ID=SMED30030630-orf-1|Name=SMED30030630-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=274bp
MLEWFCITGSYWNNSNDGFNINDQNKPFDQPLNISTSTENPFLPGSNRAH
QDVNYSSQFETLNQFFKQKIEWKGISQYHSPMLSTTTHNNPLIDFTFRHI
IINFRWAKSLNSFNNLDIADQIVLLEDVWFEMLIISFLQFCFPLELTLIM
RTSSYGTVSEVEFLMDLIKKFRGFQLDPSEFVFLKTIILLKPTTKSLIDR
VKIELLQEHAQLMLSHHTKQFYSNQPARFGRHLLCVPTIRSVATQSLQEV
LFGVSAKIDIKNFITQFINNLKN*
back to top

protein sequence of SMED30030630-orf-2

>SMED30030630-orf-2 ID=SMED30030630-orf-2|Name=SMED30030630-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=171bp
MGMNKDAVQNERQPRNSSQIRNLDQIDPNMNHVTVTANIQSLEDHQKARH
IEMDIKEEKRNIIYENFGHSDDSEKRVIFPSISNGSLICEKNSLSKSTEP
ILSNGGYSIDNSASHSPYVSNLPFFSTQFMKPSKIFTSLFNSLMFMPPFS
RSGPSVGNGKKLSSNIYIDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
Vocabulary: INTERPRO
TermDefinition
IPR001628Znf_hrmn_rcpt
IPR000536Nucl_hrmn_rcpt_lig-bd
IPR001723Nuclear_hrmn_rcpt
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0043401steroid hormone mediated signaling pathway
GO:0006351transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0003707steroid hormone receptor activity
GO:0003677DNA binding
GO:0046872metal ion binding