Regulator of G-protein signaling, putative

Overview
NameRegulator of G-protein signaling, putative
Smed IDSMED30030621
Length (bp)1800
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Regulator of G-protein signaling, putative (SMED30030621) t-SNE clustered cells

Violin plots show distribution of expression levels for Regulator of G-protein signaling, putative (SMED30030621) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Regulator of G-protein signaling, putative (SMED30030621) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Regulator of G-protein signaling, putative (SMED30030621) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030621

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30030621SMESG000072045.1 SmedASXL_013156SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30030621SMESG000072045.1 dd_Smed_v4_5311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30030621SMESG000072045.1 dd_Smed_v4_5311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30030621SMESG000072045.1 dd_Smed_v4_5311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30030621SMESG000072045.1 dd_Smed_v4_5311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30030621SMESG000072045.1 dd_Smed_v4_5311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30030621SMESG000072045.1 dd_Smed_v4_5311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30030621SMESG000072045.1 dd_Smed_v6_5311_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30030621SMESG000072045.1 SMED30030621smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Human
Match: RGS6 (regulator of G protein signaling 6 [Source:HGNC Symbol;Acc:HGNC:10002])

HSP 1 Score: 289.656 bits (740), Expect = 9.242e-91
Identity = 168/444 (37.84%), Postives = 253/444 (56.98%), Query Frame = 2
Query:  218 RMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRS---------NSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQG 1492
            ++E +I +MQ   TG +P ++ K FLS IP+ V+G D + WL K LS +D  EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG         R CR  +  P+ +  S +    + +QA Q     L+       +          N+ ++       K  E+LI +      YD  I  ++  N W+++ D   W    IE     + ++V+ W  +FD +L+D  GR +F +FLE EFS+ENLRFW  V   K  P + + +  + I+ EFL   A S IN+DS +   T + +K+  R+TFE+AQ+HIY L+K+DSY RFLRS+ Y   L    + ++ QG
Sbjct:   28 KIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDH-VLTMKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKN-PQKVKKS-VYGVTEESQA-QSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPLITPAEPSNPWISD-DVALW---DIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKPESEQG 462          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Human
Match: RGS6 (regulator of G protein signaling 6 [Source:HGNC Symbol;Acc:HGNC:10002])

HSP 1 Score: 290.041 bits (741), Expect = 9.543e-91
Identity = 168/444 (37.84%), Postives = 253/444 (56.98%), Query Frame = 2
Query:  218 RMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRS---------NSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQG 1492
            ++E +I +MQ   TG +P ++ K FLS IP+ V+G D + WL K LS +D  EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG         R CR  +  P+ +  S +    + +QA Q     L+       +          N+ ++       K  E+LI +      YD  I  ++  N W+++ D   W    IE     + ++V+ W  +FD +L+D  GR +F +FLE EFS+ENLRFW  V   K  P + + +  + I+ EFL   A S IN+DS +   T + +K+  R+TFE+AQ+HIY L+K+DSY RFLRS+ Y   L    + ++ QG
Sbjct:   28 KIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDH-VLTMKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKN-PQKVKKS-VYGVTEESQA-QSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPLITPAEPSNPWISD-DVALW---DIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKPESEQG 462          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Human
Match: RGS6 (regulator of G protein signaling 6 [Source:HGNC Symbol;Acc:HGNC:10002])

HSP 1 Score: 290.041 bits (741), Expect = 1.012e-90
Identity = 168/444 (37.84%), Postives = 253/444 (56.98%), Query Frame = 2
Query:  218 RMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRS---------NSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQG 1492
            ++E +I +MQ   TG +P ++ K FLS IP+ V+G D + WL K LS +D  EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG         R CR  +  P+ +  S +    + +QA Q     L+       +          N+ ++       K  E+LI +      YD  I  ++  N W+++ D   W    IE     + ++V+ W  +FD +L+D  GR +F +FLE EFS+ENLRFW  V   K  P + + +  + I+ EFL   A S IN+DS +   T + +K+  R+TFE+AQ+HIY L+K+DSY RFLRS+ Y   L    + ++ QG
Sbjct:   28 KIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDH-VLTMKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKN-PQKVKKS-VYGVTEESQA-QSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPLITPAEPSNPWISD-DVALW---DIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKPESEQG 462          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Human
Match: RGS6 (regulator of G protein signaling 6 [Source:HGNC Symbol;Acc:HGNC:10002])

HSP 1 Score: 290.041 bits (741), Expect = 1.012e-90
Identity = 168/444 (37.84%), Postives = 253/444 (56.98%), Query Frame = 2
Query:  218 RMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRS---------NSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQG 1492
            ++E +I +MQ   TG +P ++ K FLS IP+ V+G D + WL K LS +D  EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG         R CR  +  P+ +  S +    + +QA Q     L+       +          N+ ++       K  E+LI +      YD  I  ++  N W+++ D   W    IE     + ++V+ W  +FD +L+D  GR +F +FLE EFS+ENLRFW  V   K  P + + +  + I+ EFL   A S IN+DS +   T + +K+  R+TFE+AQ+HIY L+K+DSY RFLRS+ Y   L    + ++ QG
Sbjct:   28 KIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDH-VLTMKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKN-PQKVKKS-VYGVTEESQA-QSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPLITPAEPSNPWISD-DVALW---DIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKPESEQG 462          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Human
Match: RGS6 (regulator of G protein signaling 6 [Source:HGNC Symbol;Acc:HGNC:10002])

HSP 1 Score: 289.656 bits (740), Expect = 1.035e-90
Identity = 168/444 (37.84%), Postives = 253/444 (56.98%), Query Frame = 2
Query:  218 RMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRS---------NSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQG 1492
            ++E +I +MQ   TG +P ++ K FLS IP+ V+G D + WL K LS +D  EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG         R CR  +  P+ +  S +    + +QA Q     L+       +          N+ ++       K  E+LI +      YD  I  ++  N W+++ D   W    IE     + ++V+ W  +FD +L+D  GR +F +FLE EFS+ENLRFW  V   K  P + + +  + I+ EFL   A S IN+DS +   T + +K+  R+TFE+AQ+HIY L+K+DSY RFLRS+ Y   L    + ++ QG
Sbjct:   28 KIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDH-VLTMKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKN-PQKVKKS-VYGVTEESQA-QSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPLITPAEPSNPWISD-DVALW---DIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKPESEQG 462          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Celegans
Match: eat-16 (pep chromosome:WBcel235:I:9722550:9726263:1 gene:WBGene00001145.1 transcript:C16C2.2b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:eat-16)

HSP 1 Score: 209.534 bits (532), Expect = 3.716e-61
Identity = 143/419 (34.13%), Postives = 222/419 (52.98%), Query Frame = 2
Query:  260 GIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEK---ELKNPS--RFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQGGTK 1501
            G   K+ K F   +P A++G   IA + +R + DD +EA+ LA+L  ++GY++P+ ++     KDD   LYR Q PYFW S+      ++YAIYL KR LR  QK+GLEE E  + +RL  +L   W FI  Q+E Q++  KE+KK D+ V +++ERAFW+I +P  G P  +E+      P  +I  K+   Q  QG        C+      +          KA + ++      + +D F+      N W+++  +     +        T K+V+ W  +   L++D  GR   + FLE EFS+EN+RFW  +   K+ P  +I + A+RI  EFL   A +++NVD+RT+  T +   + K+ S  RF F  +++H++TL+  DSY RF+RS  Y   L  A      Q GTK
Sbjct:   18 GAQLKTHKYFRIAVPHAITGQQLIALVLERGAPDDEAEASHLASLLLHHGYMFPVIEHGQ-PFKDD-GTLYRLQRPYFWPSQAELVPDVEYAIYLNKRLLRNEQKHGLEEDEVESFNRLADVLAHMWAFIVQQSELQLKQQKEKKKVDKVVFDSEERAFWKIRKPSRGGPNFLED------PYMKI-EKKIRRQNAQGYR------CLMDRLRFAIKTKPWLKALKASDTMVTWVDQRAEFDPFLHPPQPSNPWISDEASFWNQPTDTSSAEIPTEKRVKRWGLSVQELVKDPIGRQVLETFLESEFSSENIRFWIAIQDLKYAPNEQIYQKAERIREEFLAQGAPAQVNVDNRTLDQTLECISKAKDASQMRFAFYHSEEHVFTLMAKDSYPRFVRSQIYKAVLTAA-----QQHGTK 416          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Celegans
Match: eat-16 (pep chromosome:WBcel235:I:9722721:9726263:1 gene:WBGene00001145.1 transcript:C16C2.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:eat-16)

HSP 1 Score: 209.534 bits (532), Expect = 3.716e-61
Identity = 143/419 (34.13%), Postives = 222/419 (52.98%), Query Frame = 2
Query:  260 GIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEK---ELKNPS--RFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQGGTK 1501
            G   K+ K F   +P A++G   IA + +R + DD +EA+ LA+L  ++GY++P+ ++     KDD   LYR Q PYFW S+      ++YAIYL KR LR  QK+GLEE E  + +RL  +L   W FI  Q+E Q++  KE+KK D+ V +++ERAFW+I +P  G P  +E+      P  +I  K+   Q  QG        C+      +          KA + ++      + +D F+      N W+++  +     +        T K+V+ W  +   L++D  GR   + FLE EFS+EN+RFW  +   K+ P  +I + A+RI  EFL   A +++NVD+RT+  T +   + K+ S  RF F  +++H++TL+  DSY RF+RS  Y   L  A      Q GTK
Sbjct:   18 GAQLKTHKYFRIAVPHAITGQQLIALVLERGAPDDEAEASHLASLLLHHGYMFPVIEHGQ-PFKDD-GTLYRLQRPYFWPSQAELVPDVEYAIYLNKRLLRNEQKHGLEEDEVESFNRLADVLAHMWAFIVQQSELQLKQQKEKKKVDKVVFDSEERAFWKIRKPSRGGPNFLED------PYMKI-EKKIRRQNAQGYR------CLMDRLRFAIKTKPWLKALKASDTMVTWVDQRAEFDPFLHPPQPSNPWISDEASFWNQPTDTSSAEIPTEKRVKRWGLSVQELVKDPIGRQVLETFLESEFSSENIRFWIAIQDLKYAPNEQIYQKAERIREEFLAQGAPAQVNVDNRTLDQTLECISKAKDASQMRFAFYHSEEHVFTLMAKDSYPRFVRSQIYKAVLTAA-----QQHGTK 416          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Celegans
Match: eat-16 (pep chromosome:WBcel235:I:9722550:9726282:1 gene:WBGene00001145.1 transcript:C16C2.2a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:eat-16)

HSP 1 Score: 210.305 bits (534), Expect = 4.498e-61
Identity = 143/419 (34.13%), Postives = 222/419 (52.98%), Query Frame = 2
Query:  260 GIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEK---ELKNPS--RFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQGGTK 1501
            G   K+ K F   +P A++G   IA + +R + DD +EA+ LA+L  ++GY++P+ ++     KDD   LYR Q PYFW S+      ++YAIYL KR LR  QK+GLEE E  + +RL  +L   W FI  Q+E Q++  KE+KK D+ V +++ERAFW+I +P  G P  +E+      P  +I  K+   Q  QG        C+      +          KA + ++      + +D F+      N W+++  +     +        T K+V+ W  +   L++D  GR   + FLE EFS+EN+RFW  +   K+ P  +I + A+RI  EFL   A +++NVD+RT+  T +   + K+ S  RF F  +++H++TL+  DSY RF+RS  Y   L  A      Q GTK
Sbjct:   18 GAQLKTHKYFRIAVPHAITGQQLIALVLERGAPDDEAEASHLASLLLHHGYMFPVIEHGQ-PFKDD-GTLYRLQRPYFWPSQAELVPDVEYAIYLNKRLLRNEQKHGLEEDEVESFNRLADVLAHMWAFIVQQSELQLKQQKEKKKVDKVVFDSEERAFWKIRKPSRGGPNFLED------PYMKI-EKKIRRQNAQGYR------CLMDRLRFAIKTKPWLKALKASDTMVTWVDQRAEFDPFLHPPQPSNPWISDEASFWNQPTDTSSAEIPTEKRVKRWGLSVQELVKDPIGRQVLETFLESEFSSENIRFWIAIQDLKYAPNEQIYQKAERIREEFLAQGAPAQVNVDNRTLDQTLECISKAKDASQMRFAFYHSEEHVFTLMAKDSYPRFVRSQIYKAVLTAA-----QQHGTK 416          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Celegans
Match: eat-16 (pep chromosome:WBcel235:I:9722721:9726282:1 gene:WBGene00001145.1 transcript:C16C2.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:eat-16)

HSP 1 Score: 210.305 bits (534), Expect = 4.498e-61
Identity = 143/419 (34.13%), Postives = 222/419 (52.98%), Query Frame = 2
Query:  260 GIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEK---ELKNPS--RFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQGGTK 1501
            G   K+ K F   +P A++G   IA + +R + DD +EA+ LA+L  ++GY++P+ ++     KDD   LYR Q PYFW S+      ++YAIYL KR LR  QK+GLEE E  + +RL  +L   W FI  Q+E Q++  KE+KK D+ V +++ERAFW+I +P  G P  +E+      P  +I  K+   Q  QG        C+      +          KA + ++      + +D F+      N W+++  +     +        T K+V+ W  +   L++D  GR   + FLE EFS+EN+RFW  +   K+ P  +I + A+RI  EFL   A +++NVD+RT+  T +   + K+ S  RF F  +++H++TL+  DSY RF+RS  Y   L  A      Q GTK
Sbjct:   18 GAQLKTHKYFRIAVPHAITGQQLIALVLERGAPDDEAEASHLASLLLHHGYMFPVIEHGQ-PFKDD-GTLYRLQRPYFWPSQAELVPDVEYAIYLNKRLLRNEQKHGLEEDEVESFNRLADVLAHMWAFIVQQSELQLKQQKEKKKVDKVVFDSEERAFWKIRKPSRGGPNFLED------PYMKI-EKKIRRQNAQGYR------CLMDRLRFAIKTKPWLKALKASDTMVTWVDQRAEFDPFLHPPQPSNPWISDEASFWNQPTDTSSAEIPTEKRVKRWGLSVQELVKDPIGRQVLETFLESEFSSENIRFWIAIQDLKYAPNEQIYQKAERIREEFLAQGAPAQVNVDNRTLDQTLECISKAKDASQMRFAFYHSEEHVFTLMAKDSYPRFVRSQIYKAVLTAA-----QQHGTK 416          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Celegans
Match: egl-10 (Regulator of G-protein signaling egl-10 [Source:UniProtKB/Swiss-Prot;Acc:P49809])

HSP 1 Score: 179.489 bits (454), Expect = 4.790e-49
Identity = 81/185 (43.78%), Postives = 121/185 (65.41%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG 763
            V ++ME L+ QM   + G+P K+ K FLS +P+  +G D I W+ K L   D+S+A  LA+L   +GY++ + D+  L VK+D    YRFQ PYFW S    P+  DYA+YL KR+++ +    LE++E   L +LQKM   KWEF++MQAE Q ++ K+R + +R ++++QERAFW +HRP PG
Sbjct:   23 VYRKMEMLVNQMLDAEAGVPIKTVKSFLSKVPSVFTGQDLIGWIMKNLEMTDLSDALHLAHLIASHGYLFQIDDH-VLTVKND-GTFYRFQTPYFWPSNCWDPENTDYAVYLCKRTMQNKAHLELEDFEAENLAKLQKMFSRKWEFVFMQAEAQYKVDKKRDRQERQILDSQERAFWDVHRPVPG 205          

HSP 2 Score: 126.331 bits (316), Expect = 1.587e-30
Identity = 76/192 (39.58%), Postives = 109/192 (56.77%), Query Frame = 2
Query:  899 NSPVNSSKSGTCKAIENLIMHNCNNSAYDWFI----DRSDTF----NYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNA-TSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDY 1447
            NS ++ +   T K +EN + +      +D  +     ++D F    N W+ N   D W    I   G    +++++W  +F+ LL DS GR   Q+FL+KE+S ENLRFW  V   +   +R +      IY EF+  NA TS +NVD + M  TE  LKNP+R++F+EA DHIY L+KNDSY RFLRS+ Y
Sbjct:  345 NSRLSKNVLRTSKVVENYLAYYEQRRVFDPLLTPPGSQADPFQSQPNPWI-NDTVDFWQHDKI--TGDIQTRRLKLWEDSFEELLADSLGRETLQKFLDKEYSGENLRFWWEVQKLRKCSSRMVPVMVTEIYNEFIDTNAATSPVNVDCKVMEVTEDNLKNPNRWSFDEAADHIYCLMKNDSYQRFLRSEIY 533          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Fly
Match: CG42450 (gene:FBgn0259927 transcript:FBtr0300218)

HSP 1 Score: 317.775 bits (813), Expect = 2.481e-95
Identity = 181/436 (41.51%), Postives = 254/436 (58.26%), Query Frame = 2
Query:  185 MDRQYRNSVVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLAN-----GCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYT-LVKNDSYVRFLRSDDYAMALRHALE 1474
            +++  R     +ME L+ +MQ  + G+P + QK+FL++IP A  G D I WL  RL  ++ SEA  +AN  C +GY +P+ D K+L VKDD S LYRFQ PY+W  +   PD ++YAIYL KRSLR +Q++ LE+YE  AL  L K L  KW+FI MQAEEQVRL KERKK D+ V ++QERA+WR+HRPPPG+   +E   P  +P       RD    K  K  T+ +       +GK      +N ++    +A E+L+ ++   S YD+F+  +   N W+   D   W  ++       T K+V+ WA + + L+ D  G   F  FLEKE+S EN+RFW  VN  +     ++      IY EFL   A  EIN+D +TM +  K LKNPSRFTF+ A +HIY  L+K D Y RF+RS+ Y   L   ++
Sbjct:  205 IEKLSRPMAFDKMEMLVREMQDQEHGVPVRQQKMFLTSIPYAFMGYDLIEWLMDRLQIEE-SEALNIANQLCLHGYFFPVNDSKTLTVKDD-SSLYRFQTPYYWPWQHKAPDNVEYAIYLAKRSLRNKQRHALEDYEAEALASLHKNLKGKWDFISMQAEEQVRLAKERKKGDKIVGDSQERAYWRVHRPPPGQFTPLE---PCPVP------SRDRQGLKPNKKKTVDDMQRDVDYLGKS-----LNRTRMKMSQACESLVCYSETFSEYDFFLQPALPSNPWVTE-DIAFWQLNNTFV-DIPTEKRVKRWAISIEELVSDPTGLQEFTGFLEKEYSHENIRFWIAVNRLRRSAHSQVARKVNEIYEEFLKPGAPCEINIDGKTMESVLKGLKNPSRFTFDSASEHIYMLLLKKDCYPRFIRSEHYKRLLDTGIQ 622          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Fly
Match: CG42450 (gene:FBgn0259927 transcript:FBtr0310343)

HSP 1 Score: 317.39 bits (812), Expect = 5.358e-95
Identity = 181/436 (41.51%), Postives = 254/436 (58.26%), Query Frame = 2
Query:  185 MDRQYRNSVVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLAN-----GCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYT-LVKNDSYVRFLRSDDYAMALRHALE 1474
            +++  R     +ME L+ +MQ  + G+P + QK+FL++IP A  G D I WL  RL  ++ SEA  +AN  C +GY +P+ D K+L VKDD S LYRFQ PY+W  +   PD ++YAIYL KRSLR +Q++ LE+YE  AL  L K L  KW+FI MQAEEQVRL KERKK D+ V ++QERA+WR+HRPPPG+   +E   P  +P       RD    K  K  T+ +       +GK      +N ++    +A E+L+ ++   S YD+F+  +   N W+   D   W  ++       T K+V+ WA + + L+ D  G   F  FLEKE+S EN+RFW  VN  +     ++      IY EFL   A  EIN+D +TM +  K LKNPSRFTF+ A +HIY  L+K D Y RF+RS+ Y   L   ++
Sbjct:  205 IEKLSRPMAFDKMEMLVREMQDQEHGVPVRQQKMFLTSIPYAFMGYDLIEWLMDRLQIEE-SEALNIANQLCLHGYFFPVNDSKTLTVKDD-SSLYRFQTPYYWPWQHKAPDNVEYAIYLAKRSLRNKQRHALEDYEAEALASLHKNLKGKWDFISMQAEEQVRLAKERKKGDKIVGDSQERAYWRVHRPPPGQFTPLE---PCPVP------SRDRQGLKPNKKKTVDDMQRDVDYLGKS-----LNRTRMKMSQACESLVCYSETFSEYDFFLQPALPSNPWVTE-DIAFWQLNNTFV-DIPTEKRVKRWAISIEELVSDPTGLQEFTGFLEKEYSHENIRFWIAVNRLRRSAHSQVARKVNEIYEEFLKPGAPCEINIDGKTMESVLKGLKNPSRFTFDSASEHIYMLLLKKDCYPRFIRSEHYKRLLDTGIQ 622          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Fly
Match: RSG7 (gene:FBgn0024941 transcript:FBtr0074350)

HSP 1 Score: 282.722 bits (722), Expect = 1.664e-86
Identity = 157/430 (36.51%), Postives = 245/430 (56.98%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNS--------------SKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPS---RFTFEEAQDHIYTLVKNDSYVRFLRSDDY 1447
            V K+ME +I +MQ   TG+  ++ K F+S +P+  +GAD +AW+ K    +D++EA   A+L   +GYI+P+ D+ +L VK+D    YRFQ PYFW S   +P+  DYA+YL KR+++ + +  L +YE   L +LQKM   KWEFI+MQAE Q ++ K+R K +R V+++QERAFW +HRP PG  C         +  ++I    D  +A +   S+   G  G   + +PV                      KA E L+ +    + +D+FI   +  N W  +  T+ W   + +      V++V+ WA +   LL D+ GR +F +FLEKE+S ENL+FW +V   K  P  +I+E+ ++I+ EFL   A   +NVDS+++    + + +PS   R+ F+ A  H+Y L+K+DSY R+LRSD Y
Sbjct:  216 VYKKMEAIIEKMQAESTGVAVRTVKAFMSKVPSVFTGADLVAWILKNFDVEDVTEALHFAHLLSSHGYIFPIDDH-ALTVKND-GTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKTRLELADYEAENLAKLQKMFSRKWEFIFMQAESQSKVAKKRDKLERKVLDSQERAFWDVHRPMPG--C---------VNTTEI----DIKKAYRRGGSSHGTGSAGASLAKNPVEQLTRIIALRKQKLERRTIKVSKAAEALVAYYDQYNEFDYFITSPELPNPWQTD-STEMW--DTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKALPQSEIKEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMY 625          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Fly
Match: RSG7 (gene:FBgn0024941 transcript:FBtr0307538)

HSP 1 Score: 282.722 bits (722), Expect = 1.664e-86
Identity = 157/430 (36.51%), Postives = 245/430 (56.98%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNS--------------SKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPS---RFTFEEAQDHIYTLVKNDSYVRFLRSDDY 1447
            V K+ME +I +MQ   TG+  ++ K F+S +P+  +GAD +AW+ K    +D++EA   A+L   +GYI+P+ D+ +L VK+D    YRFQ PYFW S   +P+  DYA+YL KR+++ + +  L +YE   L +LQKM   KWEFI+MQAE Q ++ K+R K +R V+++QERAFW +HRP PG  C         +  ++I    D  +A +   S+   G  G   + +PV                      KA E L+ +    + +D+FI   +  N W  +  T+ W   + +      V++V+ WA +   LL D+ GR +F +FLEKE+S ENL+FW +V   K  P  +I+E+ ++I+ EFL   A   +NVDS+++    + + +PS   R+ F+ A  H+Y L+K+DSY R+LRSD Y
Sbjct:  216 VYKKMEAIIEKMQAESTGVAVRTVKAFMSKVPSVFTGADLVAWILKNFDVEDVTEALHFAHLLSSHGYIFPIDDH-ALTVKND-GTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKTRLELADYEAENLAKLQKMFSRKWEFIFMQAESQSKVAKKRDKLERKVLDSQERAFWDVHRPMPG--C---------VNTTEI----DIKKAYRRGGSSHGTGSAGASLAKNPVEQLTRIIALRKQKLERRTIKVSKAAEALVAYYDQYNEFDYFITSPELPNPWQTD-STEMW--DTEKNSKEVPVRRVKRWAFSLRELLNDAIGREQFTKFLEKEYSGENLKFWESVQEMKALPQSEIKEAIQKIWQEFLAPEAPCPVNVDSKSVELAREAVNSPSGPNRWCFDVAASHVYHLMKSDSYSRYLRSDMY 625          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Fly
Match: Dhit (gene:FBgn0028743 transcript:FBtr0301142)

HSP 1 Score: 93.9745 bits (232), Expect = 5.535e-21
Identity = 52/146 (35.62%), Postives = 81/146 (55.48%), Query Frame = 2
Query: 1067 EGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFW-ATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQGGTK 1501
            +G   T++++R W  +FD L++ + GR  FQ FL  EFS EN+ FW A  +  K      +EE A+ IY +++   +  E+++DSR      + +  P+  TF+EAQ  IYTL+  DSY RFL S  +      A  + N+  G+K
Sbjct:  127 DGEQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL---AQLQDNSNAGSK 269          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Zebrafish
Match: rgs7a (regulator of G protein signaling 7a [Source:ZFIN;Acc:ZDB-GENE-040718-276])

HSP 1 Score: 297.745 bits (761), Expect = 3.107e-94
Identity = 167/444 (37.61%), Postives = 247/444 (55.63%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNS----SKSGT----------------------CKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALR 1462
            V ++ME +I +MQ    GIP ++ K FLS IP+  SG+D + WL K L  +D  EA  L  L   +GY +P++D+  L +KDD    YRFQ PYFW S   +P+  DYA+YL KR+++ + +  L +YE  +L RLQ+    KWEFI+MQAE Q ++ K+R K +R ++++QERAFW +HRP PG  C         +  +++  K+ +      K+     G     RS+SP ++    +K  T                       K  E+L+ +    S YD F+   D  N W+++ DT  W   + +E G +   +VR W    D +L+D  GR +F +FLE EFS+ENLRFW  V   K  P R++    + I+ EFL   A S INVDS++   T + +K+P R+ FE+AQ+HIY L+K+DSY RF+RS  Y   L+
Sbjct:   23 VYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLLKNLCIEDQVEALHLGTLMAAHGYFFPISDH-VLTLKDD-GTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPG--C---------VNTTEVDIKKSSRMKNPHKTRKSVYGLQNDIRSHSPTHTPAPEAKQPTEEELQEQIKFWQAQLDRHRLKMSKVAESLLSYAEQYSDYDPFLSTPDPSNPWMSD-DTTLWEMEASKEPGQT---RVRRWGFGIDEVLKDPVGREQFLKFLESEFSSENLRFWLAVQELKRRPIREVPTRVQEIWEEFLAAGAPSAINVDSKSYDKTTQNVKDPGRYAFEDAQEHIYKLMKSDSYSRFIRSCAYQELLQ 449          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Zebrafish
Match: rgs7a (regulator of G protein signaling 7a [Source:ZFIN;Acc:ZDB-GENE-040718-276])

HSP 1 Score: 297.745 bits (761), Expect = 3.107e-94
Identity = 167/444 (37.61%), Postives = 247/444 (55.63%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNS----SKSGT----------------------CKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALR 1462
            V ++ME +I +MQ    GIP ++ K FLS IP+  SG+D + WL K L  +D  EA  L  L   +GY +P++D+  L +KDD    YRFQ PYFW S   +P+  DYA+YL KR+++ + +  L +YE  +L RLQ+    KWEFI+MQAE Q ++ K+R K +R ++++QERAFW +HRP PG  C         +  +++  K+ +      K+     G     RS+SP ++    +K  T                       K  E+L+ +    S YD F+   D  N W+++ DT  W   + +E G +   +VR W    D +L+D  GR +F +FLE EFS+ENLRFW  V   K  P R++    + I+ EFL   A S INVDS++   T + +K+P R+ FE+AQ+HIY L+K+DSY RF+RS  Y   L+
Sbjct:   23 VYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLLKNLCIEDQVEALHLGTLMAAHGYFFPISDH-VLTLKDD-GTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPG--C---------VNTTEVDIKKSSRMKNPHKTRKSVYGLQNDIRSHSPTHTPAPEAKQPTEEELQEQIKFWQAQLDRHRLKMSKVAESLLSYAEQYSDYDPFLSTPDPSNPWMSD-DTTLWEMEASKEPGQT---RVRRWGFGIDEVLKDPVGREQFLKFLESEFSSENLRFWLAVQELKRRPIREVPTRVQEIWEEFLAAGAPSAINVDSKSYDKTTQNVKDPGRYAFEDAQEHIYKLMKSDSYSRFIRSCAYQELLQ 449          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Zebrafish
Match: rgs7a (regulator of G protein signaling 7a [Source:ZFIN;Acc:ZDB-GENE-040718-276])

HSP 1 Score: 297.745 bits (761), Expect = 3.107e-94
Identity = 167/444 (37.61%), Postives = 247/444 (55.63%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNS----SKSGT----------------------CKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALR 1462
            V ++ME +I +MQ    GIP ++ K FLS IP+  SG+D + WL K L  +D  EA  L  L   +GY +P++D+  L +KDD    YRFQ PYFW S   +P+  DYA+YL KR+++ + +  L +YE  +L RLQ+    KWEFI+MQAE Q ++ K+R K +R ++++QERAFW +HRP PG  C         +  +++  K+ +      K+     G     RS+SP ++    +K  T                       K  E+L+ +    S YD F+   D  N W+++ DT  W   + +E G +   +VR W    D +L+D  GR +F +FLE EFS+ENLRFW  V   K  P R++    + I+ EFL   A S INVDS++   T + +K+P R+ FE+AQ+HIY L+K+DSY RF+RS  Y   L+
Sbjct:   23 VYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLLKNLCIEDQVEALHLGTLMAAHGYFFPISDH-VLTLKDD-GTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPG--C---------VNTTEVDIKKSSRMKNPHKTRKSVYGLQNDIRSHSPTHTPAPEAKQPTEEELQEQIKFWQAQLDRHRLKMSKVAESLLSYAEQYSDYDPFLSTPDPSNPWMSD-DTTLWEMEASKEPGQT---RVRRWGFGIDEVLKDPVGREQFLKFLESEFSSENLRFWLAVQELKRRPIREVPTRVQEIWEEFLAAGAPSAINVDSKSYDKTTQNVKDPGRYAFEDAQEHIYKLMKSDSYSRFIRSCAYQELLQ 449          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Zebrafish
Match: rgs7a (regulator of G protein signaling 7a [Source:ZFIN;Acc:ZDB-GENE-040718-276])

HSP 1 Score: 298.13 bits (762), Expect = 3.469e-94
Identity = 167/444 (37.61%), Postives = 247/444 (55.63%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNS----SKSGT----------------------CKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALR 1462
            V ++ME +I +MQ    GIP ++ K FLS IP+  SG+D + WL K L  +D  EA  L  L   +GY +P++D+  L +KDD    YRFQ PYFW S   +P+  DYA+YL KR+++ + +  L +YE  +L RLQ+    KWEFI+MQAE Q ++ K+R K +R ++++QERAFW +HRP PG  C         +  +++  K+ +      K+     G     RS+SP ++    +K  T                       K  E+L+ +    S YD F+   D  N W+++ DT  W   + +E G +   +VR W    D +L+D  GR +F +FLE EFS+ENLRFW  V   K  P R++    + I+ EFL   A S INVDS++   T + +K+P R+ FE+AQ+HIY L+K+DSY RF+RS  Y   L+
Sbjct:   23 VYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLLKNLCIEDQVEALHLGTLMAAHGYFFPISDH-VLTLKDD-GTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPG--C---------VNTTEVDIKKSSRMKNPHKTRKSVYGLQNDIRSHSPTHTPAPEAKQPTEEELQEQIKFWQAQLDRHRLKMSKVAESLLSYAEQYSDYDPFLSTPDPSNPWMSD-DTTLWEMEASKEPGQT---RVRRWGFGIDEVLKDPVGREQFLKFLESEFSSENLRFWLAVQELKRRPIREVPTRVQEIWEEFLAAGAPSAINVDSKSYDKTTQNVKDPGRYAFEDAQEHIYKLMKSDSYSRFIRSCAYQELLQ 449          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Zebrafish
Match: rgs6 (regulator of G protein signaling 6 [Source:ZFIN;Acc:ZDB-GENE-030131-31])

HSP 1 Score: 285.419 bits (729), Expect = 4.134e-89
Identity = 162/446 (36.32%), Postives = 253/446 (56.73%), Query Frame = 2
Query:  215 KRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG----------------RPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQGGTKT 1504
            +++E +I ++Q    G+P ++ K FL+ IP  V+G+D + W+ K L+ +D +EA  + +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG                 P RV++ +   +  +Q  S      A+Q    T  +        N+ ++       K  E L+ +      YD F+   +  N W+++ D   W    +E     + ++V+ W  + D  L+D  GR +F +FLE EFS+ENL FW  V   K  P +++   A+ I+ EFL   A + IN+DS +   T + LK+P R++FE+AQDHIY L+K+DSY RFLRS+ Y   L  A +K  T+ G +T
Sbjct:   27 RKIEDIITRLQDEAEGVPVRTVKSFLTKIPNVVTGSDIVQWMMKNLNMEDPAEAIHVGSLIAAQGYIFPISDH-VLTLKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKTRLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQRVKKSVYGVVDDTQTQSPVHTP-AQQSSKDTKEDVEKEILFLNTQLDRHCMKMSKVAETLMSYTEQYLDYDPFVAVPEPSNPWISD-DATFW---ELEASKDPSQQRVKKWGFSLDEALKDPVGREQFLKFLESEFSSENLLFWLAVQDLKCRPLQEVASRAQEIWQEFLAEGAPNAINLDSHSYERTSQNLKDPGRYSFEDAQDHIYKLMKSDSYPRFLRSNAY-QDLLLARKKPETEQGRRT 464          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Xenopus
Match: RGS6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:100486845])

HSP 1 Score: 290.812 bits (743), Expect = 3.587e-91
Identity = 166/449 (36.97%), Postives = 253/449 (56.35%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSST-LANGCIGKYRS----------NSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQG 1492
            V +++E +I +MQ    G +P ++ K FLS IP+ V+GAD + WL K L+ +D +EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QER FW +HRP PG         R CR  +  P+ +  S      D+    Q +S   +A+  I K             N  ++       K  ++ I      + YD F+   +  N W+++  T       +E     + ++V+ W  + D +L+D  GR +F +FLE EFS+ENLRFW  V   K  P  ++ +  + I+ EFL   A S IN+DS +   T + +K+P R+TFE+AQ+HIY L+K+DSY RFLRS+ Y   L    + +N QG
Sbjct:   24 VYRKIEDIITRMQDDKAGGVPIRTVKSFLSKIPSVVTGADIVQWLVKNLNIEDPAEAIHLGSLIAAQGYIFPISDH-VLTLKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERGFWDVHRPVPGCVNTTEMDIRKCRRMKN-PQKVKKSVYGVSEDS----QSQSPVHMASHVIRKTTKDDLRKQINFLNVQIDRHCLKMSKVADSFIAFTEQYTEYDPFLTPPEPSNPWISDDTT----FLDLENSKEPSQQRVKRWGFSLDEVLKDPVGREQFLRFLESEFSSENLRFWVVVQDLKKQPLHEVPKRVEEIWQEFLAPGAQSAINLDSHSFEKTSQNVKDPGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLMKKKTENEQG 461          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Xenopus
Match: RGS6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:100486845])

HSP 1 Score: 286.574 bits (732), Expect = 1.101e-89
Identity = 162/434 (37.33%), Postives = 247/434 (56.91%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSST-LANGCIGKYRS----------NSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDY 1447
            V +++E +I +MQ    G +P ++ K FLS IP+ V+GAD + WL K L+ +D +EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QER FW +HRP PG         R CR  +  P+ +  S      D+    Q +S   +A+  I K             N  ++       K  ++ I      + YD F+   +  N W+++  T       +E     + ++V+ W  + D +L+D  GR +F +FLE EFS+ENLRFW  V   K  P  ++ +  + I+ EFL   A S IN+DS +   T + +K+P R+TFE+AQ+HIY L+K+DSY RFLRS+ Y
Sbjct:   24 VYRKIEDIITRMQDDKAGGVPIRTVKSFLSKIPSVVTGADIVQWLVKNLNIEDPAEAIHLGSLIAAQGYIFPISDH-VLTLKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERGFWDVHRPVPGCVNTTEMDIRKCRRMKN-PQKVKKSVYGVSEDS----QSQSPVHMASHVIRKTTKDDLRKQINFLNVQIDRHCLKMSKVADSFIAFTEQYTEYDPFLTPPEPSNPWISDDTT----FLDLENSKEPSQQRVKRWGFSLDEVLKDPVGREQFLRFLESEFSSENLRFWVVVQDLKKQPLHEVPKRVEEIWQEFLAPGAQSAINLDSHSFEKTSQNVKDPGRYTFEDAQEHIYKLMKSDSYARFLRSNAY 446          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Xenopus
Match: RGS6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:100486845])

HSP 1 Score: 280.796 bits (717), Expect = 1.025e-87
Identity = 156/410 (38.05%), Postives = 232/410 (56.59%), Query Frame = 2
Query:  260 GIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSP----------VNSSKSGTC----KAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDY 1447
            G+P ++ K FLS IP+ V+GAD + WL K L+ +D +EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QER FW +HRP PG     E  + +         +R     K  K +TL N  I       P          +N      C    K  ++ I      + YD F+   +  N W+++  T       +E     + ++V+ W  + D +L+D  GR +F +FLE EFS+ENLRFW  V   K  P  ++ +  + I+ EFL   A S IN+DS +   T + +K+P R+TFE+AQ+HIY L+K+DSY RFLRS+ Y
Sbjct:    8 GVPIRTVKSFLSKIPSVVTGADIVQWLVKNLNIEDPAEAIHLGSLIAAQGYIFPISDH-VLTLKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERGFWDVHRPVPGCVNTTEMDIRK--------CRRMKNPQKVKKVTTLGNLAIVPALLILPFFPFILQINFLNVQIDRHCLKMSKVADSFIAFTEQYTEYDPFLTPPEPSNPWISDDTT----FLDLENSKEPSQQRVKRWGFSLDEVLKDPVGREQFLRFLESEFSSENLRFWVVVQDLKKQPLHEVPKRVEEIWQEFLAPGAQSAINLDSHSFEKTSQNVKDPGRYTFEDAQEHIYKLMKSDSYARFLRSNAY 403          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Xenopus
Match: RGS6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:100486845])

HSP 1 Score: 282.337 bits (721), Expect = 1.272e-87
Identity = 161/430 (37.44%), Postives = 244/430 (56.74%), Query Frame = 2
Query:  221 MEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSST-LANGCIGKYRS----------NSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDY 1447
            +E +I +MQ    G +P ++ K FLS IP+ V+GAD + WL K L+ +D +EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QER FW +HRP PG         R CR  +  P+ +  S      D+    Q +S   +A+  I K             N  ++       K  ++ I      + YD F+   +  N W+++  T       +E     + ++V+ W  + D +L+D  GR +F +FLE EFS+ENLRFW  V   K  P  ++ +  + I+ EFL   A S IN+DS +   T + +K+P R+TFE+AQ+HIY L+K+DSY RFLRS+ Y
Sbjct:    2 IEDIITRMQDDKAGGVPIRTVKSFLSKIPSVVTGADIVQWLVKNLNIEDPAEAIHLGSLIAAQGYIFPISDH-VLTLKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERGFWDVHRPVPGCVNTTEMDIRKCRRMKN-PQKVKKSVYGVSEDS----QSQSPVHMASHVIRKTTKDDLRKQINFLNVQIDRHCLKMSKVADSFIAFTEQYTEYDPFLTPPEPSNPWISDDTT----FLDLENSKEPSQQRVKRWGFSLDEVLKDPVGREQFLRFLESEFSSENLRFWVVVQDLKKQPLHEVPKRVEEIWQEFLAPGAQSAINLDSHSFEKTSQNVKDPGRYTFEDAQEHIYKLMKSDSYARFLRSNAY 420          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Xenopus
Match: RGS6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:100486845])

HSP 1 Score: 280.796 bits (717), Expect = 1.622e-87
Identity = 157/416 (37.74%), Postives = 237/416 (56.97%), Query Frame = 2
Query:  260 GIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSST-LANGCIGKYRS----------NSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDY 1447
            G+P ++ K FLS IP+ V+GAD + WL K L+ +D +EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QER FW +HRP PG         R CR  +  P+ +  S      D+    Q +S   +A+  I K             N  ++       K  ++ I      + YD F+   +  N W+++  T       +E     + ++V+ W  + D +L+D  GR +F +FLE EFS+ENLRFW  V   K  P  ++ +  + I+ EFL   A S IN+DS +   T + +K+P R+TFE+AQ+HIY L+K+DSY RFLRS+ Y
Sbjct:    8 GVPIRTVKSFLSKIPSVVTGADIVQWLVKNLNIEDPAEAIHLGSLIAAQGYIFPISDH-VLTLKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERGFWDVHRPVPGCVNTTEMDIRKCRRMKN-PQKVKKSVYGVSEDS----QSQSPVHMASHVIRKTTKDDLRKQINFLNVQIDRHCLKMSKVADSFIAFTEQYTEYDPFLTPPEPSNPWISDDTT----FLDLENSKEPSQQRVKRWGFSLDEVLKDPVGREQFLRFLESEFSSENLRFWVVVQDLKKQPLHEVPKRVEEIWQEFLAPGAQSAINLDSHSFEKTSQNVKDPGRYTFEDAQEHIYKLMKSDSYARFLRSNAY 412          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Mouse
Match: Rgs6 (regulator of G-protein signaling 6 [Source:MGI Symbol;Acc:MGI:1354730])

HSP 1 Score: 293.508 bits (750), Expect = 3.381e-92
Identity = 171/453 (37.75%), Postives = 251/453 (55.41%), Query Frame = 2
Query:  218 RMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCR------------------VEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQG 1492
            ++E +I +MQ   TG +P ++ K FLS IP+ V+G D + WL K LS +D  EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG         R CR                   +   P +IP   I   R   +    K  T  N  I ++              K  E+LI +      YD FI  ++  N W+++ D   W    IE     + ++V+ W  +FD +L+D  GR +F +FLE EFS+ENLRFW +V   K  P + + +  + I+ EFL   A S IN+DS +   T + +K+  R+TFE+AQ+HIY L+K+DSY RFLRS+ Y   L    + ++ QG
Sbjct:   28 KIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDH-VLTMKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTDETQSQSPVHIPSQPI---RKTTKDDIRKQITFLNAQIDRHCLK---------MSKVAESLIAYTEQYVEYDPFITPAEPSNPWISD-DITLW---DIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLSVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKPESEQG 462          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Mouse
Match: Rgs6 (regulator of G-protein signaling 6 [Source:MGI Symbol;Acc:MGI:1354730])

HSP 1 Score: 293.508 bits (750), Expect = 3.381e-92
Identity = 171/453 (37.75%), Postives = 251/453 (55.41%), Query Frame = 2
Query:  218 RMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCR------------------VEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQG 1492
            ++E +I +MQ   TG +P ++ K FLS IP+ V+G D + WL K LS +D  EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG         R CR                   +   P +IP   I   R   +    K  T  N  I ++              K  E+LI +      YD FI  ++  N W+++ D   W    IE     + ++V+ W  +FD +L+D  GR +F +FLE EFS+ENLRFW +V   K  P + + +  + I+ EFL   A S IN+DS +   T + +K+  R+TFE+AQ+HIY L+K+DSY RFLRS+ Y   L    + ++ QG
Sbjct:   28 KIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDH-VLTMKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTDETQSQSPVHIPSQPI---RKTTKDDIRKQITFLNAQIDRHCLK---------MSKVAESLIAYTEQYVEYDPFITPAEPSNPWISD-DITLW---DIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLSVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKPESEQG 462          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Mouse
Match: Rgs6 (regulator of G-protein signaling 6 [Source:MGI Symbol;Acc:MGI:1354730])

HSP 1 Score: 292.738 bits (748), Expect = 6.992e-92
Identity = 172/456 (37.72%), Postives = 252/456 (55.26%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCR------------------VEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQG 1492
            V  ++E +I +MQ   TG +P ++ K FLS IP+ V+G D + WL K LS +D  EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG         R CR                   +   P +IP   I   R   +    K  T  N  I ++              K  E+LI +      YD FI  ++  N W+++ D   W    IE     + ++V+ W  +FD +L+D  GR +F +FLE EFS+ENLRFW +V   K  P + + +  + I+ EFL   A S IN+DS +   T + +K+  R+TFE+AQ+HIY L+K+DSY RFLRS+ Y   L    + ++ QG
Sbjct:   25 VYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDH-VLTMKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTDETQSQSPVHIPSQPI---RKTTKDDIRKQITFLNAQIDRHCLK---------MSKVAESLIAYTEQYVEYDPFITPAEPSNPWISD-DITLW---DIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLSVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKPESEQG 462          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Mouse
Match: Rgs6 (regulator of G-protein signaling 6 [Source:MGI Symbol;Acc:MGI:1354730])

HSP 1 Score: 293.123 bits (749), Expect = 7.477e-92
Identity = 172/456 (37.72%), Postives = 252/456 (55.26%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCR------------------VEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQG 1492
            V  ++E +I +MQ   TG +P ++ K FLS IP+ V+G D + WL K LS +D  EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG         R CR                   +   P +IP   I   R   +    K  T  N  I ++              K  E+LI +      YD FI  ++  N W+++ D   W    IE     + ++V+ W  +FD +L+D  GR +F +FLE EFS+ENLRFW +V   K  P + + +  + I+ EFL   A S IN+DS +   T + +K+  R+TFE+AQ+HIY L+K+DSY RFLRS+ Y   L    + ++ QG
Sbjct:   25 VYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDH-VLTMKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTDETQSQSPVHIPSQPI---RKTTKDDIRKQITFLNAQIDRHCLK---------MSKVAESLIAYTEQYVEYDPFITPAEPSNPWISD-DITLW---DIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLSVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKPESEQG 462          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Mouse
Match: Rgs6 (regulator of G-protein signaling 6 [Source:MGI Symbol;Acc:MGI:1354730])

HSP 1 Score: 293.123 bits (749), Expect = 7.487e-92
Identity = 172/456 (37.72%), Postives = 252/456 (55.26%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCR------------------VEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQG 1492
            V  ++E +I +MQ   TG +P ++ K FLS IP+ V+G D + WL K LS +D  EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG         R CR                   +   P +IP   I   R   +    K  T  N  I ++              K  E+LI +      YD FI  ++  N W+++ D   W    IE     + ++V+ W  +FD +L+D  GR +F +FLE EFS+ENLRFW +V   K  P + + +  + I+ EFL   A S IN+DS +   T + +K+  R+TFE+AQ+HIY L+K+DSY RFLRS+ Y   L    + ++ QG
Sbjct:   25 VYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDH-VLTMKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTDETQSQSPVHIPSQPI---RKTTKDDIRKQITFLNAQIDRHCLK---------MSKVAESLIAYTEQYVEYDPFITPAEPSNPWISD-DITLW---DIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLSVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKPESEQG 462          
BLAST of Regulator of G-protein signaling, putative vs. UniProt/SwissProt
Match: sp|Q9Z2H2|RGS6_MOUSE (Regulator of G-protein signaling 6 OS=Mus musculus OX=10090 GN=Rgs6 PE=1 SV=2)

HSP 1 Score: 291.582 bits (745), Expect = 7.787e-91
Identity = 168/438 (38.36%), Postives = 245/438 (55.94%), Query Frame = 2
Query:  218 RMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCR------------------VEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDY 1447
            ++E +I +MQ   TG +P ++ K FLS IP+ V+G D + WL K LS +D  EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG         R CR                   +   P +IP   I   R   +    K  T  N  I ++              K  E+LI +      YD FI  ++  N W+++ D   W    IE     + ++V+ W  +FD +L+D  GR +F +FLE EFS+ENLRFW +V   K  P + + +  + I+ EFL   A S IN+DS +   T + +K+  R+TFE+AQ+HIY L+K+DSY RFLRS+ Y
Sbjct:   28 KIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDH-VLTMKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTDETQSQSPVHIPSQPI---RKTTKDDIRKQITFLNAQIDRHCLK---------MSKVAESLIAYTEQYVEYDPFITPAEPSNPWISD-DITLW---DIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLSVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY 447          
BLAST of Regulator of G-protein signaling, putative vs. UniProt/SwissProt
Match: sp|P49758|RGS6_HUMAN (Regulator of G-protein signaling 6 OS=Homo sapiens OX=9606 GN=RGS6 PE=1 SV=5)

HSP 1 Score: 288.5 bits (737), Expect = 1.268e-89
Identity = 165/429 (38.46%), Postives = 247/429 (57.58%), Query Frame = 2
Query:  218 RMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRS---------NSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDY 1447
            ++E +I +MQ   TG +P ++ K FLS IP+ V+G D + WL K LS +D  EA  L +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG         R CR  +  P+ +  S +    + +QA Q     L+       +          N+ ++       K  E+LI +      YD  I  ++  N W+++ D   W    IE     + ++V+ W  +FD +L+D  GR +F +FLE EFS+ENLRFW  V   K  P + + +  + I+ EFL   A S IN+DS +   T + +K+  R+TFE+AQ+HIY L+K+DSY RFLRS+ Y
Sbjct:   28 KIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDH-VLTMKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKN-PQKVKKS-VYGVTEESQA-QSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPLITPAEPSNPWISD-DVALW---DIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY 447          
BLAST of Regulator of G-protein signaling, putative vs. UniProt/SwissProt
Match: sp|O46470|RGS7_BOVIN (Regulator of G-protein signaling 7 OS=Bos taurus OX=9913 GN=RGS7 PE=1 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 3.376e-89
Identity = 162/444 (36.49%), Postives = 243/444 (54.73%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSP--------------------------VNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALR 1462
            V ++ME +I +MQ    GIP ++ K FLS IP+  SG+D + WL K L+ +D  EA  L  L   +GY +P++D+  L +KDD    YRFQ PYFW S   +P+  DYA+YL KR+++ + +  L +YE  +L RLQ+    KWEFI+MQAE Q ++ K+R K +R ++++QERAFW +HRP PG  C         +  +++  K+ +      K+     G     RS+SP                          ++  +    K  ++L+ +      YD F+   D  N WL++ DT  W    +E     + ++V+ W    D  L+D  GR +F +FLE EFS+ENLRFW  V   K  P R++    + I+ EFL   A S IN+DS++   T + +K P R+TFE+AQ+HIY L+K+DSY RF+RS  Y   L+
Sbjct:   23 VYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDH-VLTLKDD-GTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPG--C---------VNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYDPFLAPPDPSNPWLSD-DTTFW---ELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQ 449          
BLAST of Regulator of G-protein signaling, putative vs. UniProt/SwissProt
Match: sp|O54829|RGS7_MOUSE (Regulator of G-protein signaling 7 OS=Mus musculus OX=10090 GN=Rgs7 PE=1 SV=2)

HSP 1 Score: 286.574 bits (732), Expect = 6.963e-89
Identity = 162/444 (36.49%), Postives = 243/444 (54.73%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSP--------------------------VNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALR 1462
            V ++ME +I +MQ    GIP ++ K FLS IP+  SG+D + WL K L+ +D  EA  L  L   +GY +P++D+  L +KDD    YRFQ PYFW S   +P+  DYA+YL KR+++ + +  L +YE  +L RLQ+    KWEFI+MQAE Q ++ K+R K +R ++++QERAFW +HRP PG  C         +  +++  K+ +      K+     G     RS+SP                          ++  +    K  ++L+ +      YD F+   D  N WL++ DT  W    +E     + ++V+ W    D  L+D  GR +F +FLE EFS+ENLRFW  V   K  P R++    + I+ EFL   A S IN+DS++   T + +K P R+TFE+AQ+HIY L+K+DSY RF+RS  Y   L+
Sbjct:   23 VYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDH-VLTLKDD-GTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPG--C---------VNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELHQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYDPFLVPPDPSNPWLSD-DTTFW---ELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKRRPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQ 449          
BLAST of Regulator of G-protein signaling, putative vs. UniProt/SwissProt
Match: sp|P49803|RGS7_RAT (Regulator of G-protein signaling 7 OS=Rattus norvegicus OX=10116 GN=Rgs7 PE=1 SV=2)

HSP 1 Score: 286.189 bits (731), Expect = 1.070e-88
Identity = 162/444 (36.49%), Postives = 243/444 (54.73%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSP--------------------------VNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALR 1462
            V ++ME +I +MQ    GIP ++ K FLS IP+  SG+D + WL K L+ +D  EA  L  L   +GY +P++D+  L +KDD    YRFQ PYFW S   +P+  DYA+YL KR+++ + +  L +YE  +L RLQ+    KWEFI+MQAE Q ++ K+R K +R ++++QERAFW +HRP PG  C         +  +++  K+ +      K+     G     RS+SP                          ++  +    K  ++L+ +      YD F+   D  N WL++ DT  W    +E     + ++V+ W    D  L+D  GR +F +FLE EFS+ENLRFW  V   K  P R++    + I+ EFL   A S IN+DS++   T + +K P R+TFE+AQ+HIY L+K+DSY RF+RS  Y   L+
Sbjct:   23 VYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDH-VLTLKDD-GTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPG--C---------VNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELHRQIKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYDPFLVPPDPSNPWLSD-DTTFW---ELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQ 449          
BLAST of Regulator of G-protein signaling, putative vs. TrEMBL
Match: A0A5K3ENU1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 1.209e-138
Identity = 227/474 (47.89%), Postives = 295/474 (62.24%), Query Frame = 2
Query:  212 VKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQ-----------ILSKRDAA-QAKQGKSSTLANGCIGKYRSNSPVNSS--KSGTCKAIENLIMHNCNNSAYDWFID------RSDTFNYWLANPDT-DQWPAS---------------------SIEEGG-------FSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNT 1486
            +++ME LI  MQ  +TGI FKSQK+FL+TIPAAVSG + I+W+   L  +D  EA+ +AN+   YGY+YPLTDYKS +VKDDP+  YRFQAPY+W+SK  KPD MDYAIYLVKR+LR R KY LE+YE  AL RLQ ML  KWEFI MQA +Q+RL K+++K+D+ V+ AQERAFWR+H PPP R    +EGLPRN  +++           IL  RD   Q +   S  LA     + +     + S  +    K+ EN+++   N S+YDWF+        + +   WL+ P + +Q P                       SI   G       + TV QVR+WAT+FD LL D  G   F+ FLEKEFS+ENLRFW TVNA++F P   +  + KRI+ EFL  NA SEIN+D  T AAT + +KNPS F F EA+ HIY L+K+DSYVRFLRSDDY+  LR  L  Q++
Sbjct:   19 IRKMEDLIEAMQETETGINFKSQKVFLTTIPAAVSGDNLISWIENHLRIEDSQEASHIANVLLLYGYVYPLTDYKSSLVKDDPTAFYRFQAPYYWISKTPKPDPMDYAIYLVKRTLRKRPKYALEDYEQSALHRLQNMLAQKWEFICMQAADQMRLYKDKRKSDQIVLEAQERAFWRVHHPPPSRLSCFKEGLPRNGLVNRRSLSWRRAHVNILLNRDRMFQHRPSDSCLLARQQQCRQQPPPLQSHSHLRISNKKSTENILLFTANRSSYDWFLSDLHSSSSTMSATAWLSQPGSIEQSPCQPLVTLPTCDSLLTSFPLGSRLSISSSGTVTESTPYPTVNQVRLWATSFDNLLWDPKGCQAFKAFLEKEFSSENLRFWLTVNAYQFTPISNLRAAGKRIFDEFLAPNAPSEINIDCTTRAATAEAVKNPSWFVFLEAKQHIYKLMKSDSYVRFLRSDDYSAVLRVVLANQHS 492          
BLAST of Regulator of G-protein signaling, putative vs. TrEMBL
Match: A0A158QF08 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS8163 PE=4 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 2.559e-133
Identity = 226/495 (45.66%), Postives = 297/495 (60.00%), Query Frame = 2
Query:  212 VKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLS-QILSKRDAAQA-------KQGKSSTLANGCIGKYRSNSPVNSSKS----GTCKAIENLIMHNCNNSAYDWFIDRSDT----------FNYWLANPD--------------------------------------TDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQGGTKTRRLF 1516
            +K++E++I  MQ  +TGI FKSQK+FL+TIPAAV+G D I+W+    S D   EA  +A L   YGY+YPLTDY+S +VKDDP+  YRFQAPY+W+SK+ KPD++DYAIYLVKR+L  RQK+GLE+YE  AL RLQ  L  KWEFI MQA +Q+RL K+++K+D+ V+ AQERAFWR+HRPPP R C  EE LPRN  L+ + LS R A  +           S   A+      R  +P     S       K++E+L++   N S+YDWF++               + WL +P                                       TD     SI    F TV QVR+WAT+FD LL D +G   F+ FLEKEFS+ENLRFW +VNA++F P   ++ S +RIY EFL  NA SEIN+D  T A T + +KNP+RF F EA+  IY L+K+DSYVRFLRSDDY+  LR  L ++++      RR F
Sbjct:    7 IKKIERMIEAMQESETGIIFKSQKVFLTTIPAAVTGDDLISWIENYFSIDHPQEAAHIALLLLLYGYVYPLTDYRSNIVKDDPTAFYRFQAPYYWISKIPKPDSIDYAIYLVKRTLCKRQKHGLEDYEQTALHRLQNALSHKWEFICMQAADQMRLFKDKRKSDQIVLEAQERAFWRVHRPPPSRICCFEERLPRNGLLTRKPLSWRRAHSSFLLHRGHNCSNSPPFAHTLPPNLRKPTPQVLPHSHLRLSNKKSVESLLLFTANRSSYDWFVNNCSAGPGSTTSSFTSSPWLNHPSSFEVSPCIPLVCLPTCDSLLLSTPIGSCLSTTALAETHTDVLDNPSIP---FPTVNQVRLWATSFDNLLWDPNGCQAFKAFLEKEFSSENLRFWLSVNAYQFSPIYNLKASGQRIYEEFLAPNAPSEINIDCITRANTAEAVKNPTRFVFVEAKQQIYKLMKSDSYVRFLRSDDYSAVLRLVLTREHSYQQHSNRRSF 498          
BLAST of Regulator of G-protein signaling, putative vs. TrEMBL
Match: A0A158QHJ5 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7528 PE=4 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 1.237e-124
Identity = 209/480 (43.54%), Postives = 282/480 (58.75%), Query Frame = 2
Query:  212 VKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDR----------SDTFNYWLANPDTDQW--------------------------------PASSIEEG---GFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQGGTKTRRLF 1516
            + ++E++I  MQ  DTGI FK+QK+FL+T+PAAV+G D I+W+      D   EA+ +A L   YGY+YPLTDYKS +VKDDP+  YRFQAPY+W+SK++KPD++DYAIYLVKR L  RQK+ LEE+E  AL+RLQ  L  KW+FI MQA +Q+RL K+++K+D+ VI AQERAFWR+HR            LP N+       ++   Q        L+N                    K++E+L++   N S+YDWF++           S T + WL +P   +                                 P + I +     F T+ QVR+WAT+FD LL D +G   F+ FLEKEFS+ENLRFW +VNA++F P   +++S +RIY EFL  NA SEIN+D  T A T + LKNP+RF F EA+  IY L+K+DSYVRFLRSDDY+  LR  L  Q+       RR F
Sbjct:    7 INKIERMIEAMQESDTGINFKTQKVFLTTVPAAVTGDDLISWIENYFGIDHPQEASHIALLLLLYGYVYPLTDYKSNIVKDDPTSFYRFQAPYYWISKISKPDSIDYAIYLVKRILFKRQKHSLEEHEQTALNRLQNALSHKWDFICMQAADQMRLFKDKRKSDQIVIEAQERAFWRVHRHNCSNAPLSTHTLPPNL-------RKPTPQTLPHSHLRLSNK-------------------KSVESLLLFTTNRSSYDWFVNNCSAGLGVATSSFTSSPWLNHPSNFEVSPCAALVCLPTCDSLLLSTPIGSCLSTCAITEPHTDILDNPSIPFPTINQVRIWATSFDNLLWDPNGCQSFKAFLEKEFSSENLRFWLSVNAYQFSPIHNLKDSGQRIYEEFLAPNAPSEINIDCATRANTVEALKNPTRFVFAEAKQQIYKLMKSDSYVRFLRSDDYSAVLRLVLTSQHVYQQHSNRRSF 460          
BLAST of Regulator of G-protein signaling, putative vs. TrEMBL
Match: A0A0R3UGM3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6394 PE=4 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 1.478e-120
Identity = 218/548 (39.78%), Postives = 290/548 (52.92%), Query Frame = 2
Query:  176 FSTMDRQYRNSVVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQ------------------ERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSS--KSGTCKAIENLIMHNCNNSAYDWFID------RSDTFNYWLANPD-------------------------------------TDQWPASSIEEGGFS-----------------------TVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELK-------------------------NPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNT 1486
            F+ + +   +  +++ME LI  MQ  +TGI FKSQK+FL+TIPAAVSG + I+W+   L  +D  EA+ +AN+   YGY+YPLTDYKS +VKDDP+  YRFQAPY+W+SK  KPD MDYAIYLVKR+LR R KY LE+YE  AL RLQ ML  KWEFI MQA +Q+RL K+++K+D+ V+ AQ                  ERAFWR+H PPP R    +EGLP               Q +   S  LA     + +     + S  +    K+ EN+++   N S+YDWF+        + +   WL+ P                                      T+  P  ++ +  F+                       + K VR+WAT+FD LL D  G   F+ FLEKEFS+ENLRFW TVNA++F P   +  + KRI+ EFL  NA SEIN+D  T AAT + +K                         NPS F F EA+ HIY L+K+DSYVRFLRSDDY+  LR  L  Q++
Sbjct:    7 FAELKQVETHDEIRKMEDLIEAMQETETGINFKSQKVFLTTIPAAVSGDNLISWIENHLRIEDSQEASHIANVLLLYGYVYPLTDYKSSLVKDDPTAFYRFQAPYYWISKTPKPDPMDYAIYLVKRTLRKRPKYALEDYEQSALHRLQNMLAQKWEFICMQAADQMRLYKDKRKSDQIVLEAQVGAFVDIDMSTNFLANCIERAFWRVHHPPPSRLSCFKEGLP--------------LQHRPSDSCLLARQQQCRQQPPPLQSHSHLRISNKKSTENILLFTANRSSYDWFLSDLHSSSSTMSATAWLSQPGSIEQSPCQPLVTLPTCDSLLTSFPLGSRLSISSSGTVTESTPYPTVNQATFTSNGPCFSSTLSFKSNAGVVHVYISAKLVRLWATSFDNLLWDPKGCQAFKAFLEKEFSSENLRFWLTVNAYQFTPISNLRAAGKRIFDEFLAPNAPSEINIDCTTRAATAEAVKVIGLVYFLWGGNPHSDPAFLPNQHTNPSWFVFLEAKQHIYKLMKSDSYVRFLRSDDYSAVLRVVLANQHS 540          
BLAST of Regulator of G-protein signaling, putative vs. TrEMBL
Match: V4CNQ9 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_110451 PE=4 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 4.999e-113
Identity = 189/422 (44.79%), Postives = 269/422 (63.74%), Query Frame = 2
Query:  218 RMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSD--DMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKN--PSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHAL 1471
            +M+ LI +MQ+  TG+P K QK FLSTIP+  +G D + WL KRL+ D  D +EA  +ANL C +GY +P+ + K +VVK+D S LYRFQ PY+W S+  +P+ + YAI+L KRS+R +QK+GLE+YE  AL +LQKMLCDKW+FI  QA+EQV L KER++TD+ ++++QERAFW++HRPPPG+   VE+G  RN   SQ+        A++ K+  L    +  +R  + +N  +  T  AIE+ +         D FI      N W+   DT  +  +S +     T ++++ W+ +F  LL D  G   F+ FL+KE+S EN+RFWA     KF P   I    +RIY EFL + ++ E+N+DS+TM + +   K+  PSRFTFE A++HIYTL+K DSY RFLRSD Y   L +AL
Sbjct:    8 QMDALIQEMQNATTGVPIKCQKTFLSTIPSVFTGFDVVNWLKKRLNIDENDSNEAAHIANLLCKFGYFFPVYESKVIVVKEDTS-LYRFQCPYYWPSQAVEPNNVAYAIHLAKRSMRNKQKHGLEDYEQTALTKLQKMLCDKWKFICDQAQEQVSLAKERRRTDKAILDSQERAFWKVHRPPPGQTKYVEDGPKRNFQPSQM-------AARKRKNRDLLQKEVIHWR--NAINRCRMKTSTAIESYLSRLEQFEDNDPFIAGVQPSNPWITE-DTTYFDMNS-DTIEIPTEQRIKKWSVSFHELLSDPIGLQEFENFLKKEYSQENIRFWAACEQLKFCPVSDIPSRVERIYEEFLTSGSSHEVNIDSKTMESVQINRKSAKPSRFTFEAAKEHIYTLMKKDSYPRFLRSDHYKTLLSNAL 417          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Cavefish
Match: rgs6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:103032052])

HSP 1 Score: 291.582 bits (745), Expect = 1.316e-91
Identity = 163/444 (36.71%), Postives = 250/444 (56.31%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCRVEEGLPRNIPLSQILSKRDA-------AQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQG 1492
            V +++E ++ ++Q    G+P ++ K F+S IP+ V+G D + WL K LS +D +EA  + +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG         R CR  +  P+ +  S      D         Q++Q +  T  +        N+ ++       K  E L+ +      YD F+   +  N W+ + D   W    +E     + ++VR W  + +  L+D  G+ +F +FLE EFS+ENLRFW  V   K  P + +   A+ I+ EFL   A S IN+DS +   T + LK+P R++FE+AQDHIY L+K+DSY RFLRS  Y   L    + ++ QG
Sbjct:   25 VYRKIEDIVTRIQDETEGVPIRTVKSFMSKIPSVVTGTDIVQWLMKNLSIEDPAEALHIGSLIAAQGYIFPISDH-VLTLKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKTRLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRMKN-PQRVKKSVYGVAEDTQTQSPVHTQSQQSRKDTKEDVEKEILFLNTQLDRHCMKMSKVAETLMSYTEQYLEYDPFVCTPEPSNPWVGD-DCTFW---ELEASKDPSQQRVRKWGFSLEEALKDPVGQDQFLKFLESEFSSENLRFWLAVQDLKRRPLQDVPARAQEIWQEFLAEGAPSSINLDSHSFERTSQNLKDPGRYSFEDAQDHIYKLMKSDSYTRFLRSSAYQDLLLARKKPESEQG 461          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Cavefish
Match: rgs7a (regulator of G protein signaling 7a [Source:ZFIN;Acc:ZDB-GENE-040718-276])

HSP 1 Score: 283.878 bits (725), Expect = 2.502e-89
Identity = 160/420 (38.10%), Postives = 236/420 (56.19%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPD--TDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALR 1462
            V ++ME LI +MQ    GIP ++ K FLS IP+  SG+D + WL K L+ +D  EA  +  L   +GY +P++D+  L +KDD    YRFQ PYFW S   +P+  DYA+YL KR+++ + +  L +YE  +L RLQ+    KWEFI+MQAE Q ++ K+R K +R ++++QERAFW +HRP PG  C         +  +++  K+ +      K+  + N  +    S S  N  ++  CK I   +   C        I +S        NP   TD     ++E     T  +V+ W    D +L+D  GR +F +FLE EFS+ENLRFW  V   K  P R++    + I+ EFL   A S INVDS++   T + +K+P R+ FE+AQ+HIY L+K+DSY RF+RS  Y   L+
Sbjct:   23 VYRKMEDLIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLVKNLNIEDQVEALHMGTLMAAHGYFFPISDH-VLTLKDD-GTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPG--C---------VNTTEVDIKKSSRMKNPHKTRKVQN-TLSVSPSLSQCNLHQT-QCKFISKAVQSLC--------ISKSPI------NPQIITDCTTVVALEHLREPTQSRVKRWGFGMDEVLKDPAGREQFLKFLESEFSSENLRFWLAVQELKRRPIREVPTRVQEIWQEFLAPGAPSAINVDSKSYDKTTQNVKDPGRYAFEDAQEHIYKLMKSDSYSRFIRSSAYQELLQ 413          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Cavefish
Match: rgs7b (regulator of G protein signaling 7b [Source:ZFIN;Acc:ZDB-GENE-130531-78])

HSP 1 Score: 266.159 bits (679), Expect = 1.079e-82
Identity = 154/428 (35.98%), Postives = 227/428 (53.04%), Query Frame = 2
Query:  221 MEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQ--------------ILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALR 1462
            ME +I +MQ    GIP ++ K FLS IP+  SG+D + W+ K LS DD  EA  L  L   +GY +P+ D+  L +KDD    YRFQ PYFW S   +P+  DY   +            + E    +L RLQ+    KWEFI+MQAE Q ++ K+R K +R ++++QERAFW +HRP PG     E  + ++  + Q              ++S    A+A + + +      +      + ++  +    K  ++L+        YD      D  N W+++ D   W    +E       ++VR W   FD +L+D  GR +F +FLE EFS+ENLRFW  V   K  P R++    + I+ EFL   A S INVDS++ A T K +K+P R+TFE+AQ+HIY L+K+DSY RF+RS  Y   L+
Sbjct:    1 MEDIIARMQEEKNGIPIRTVKSFLSKIPSVFSGSDIVQWMMKNLSIDDQVEALHLGTLMAAHGYFFPIADH-VLTLKDD-GTFYRFQTPYFWPSNCWEPENTDYVCCV-----------SMCE----SLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEADIKKSSRMKQPHKTRKVNVGLMMNVVSSLCRAEAPKKECNKYCLFILQIQYWQAQLDRHRLKMSKVADSLLSFTEQYMEYDAIFTSPDPSNPWISD-DNTLW---ELEASKEPVQQRVRRWGFGFDEVLKDPVGREQFLKFLESEFSSENLRFWLAVQELKKQPIREVPSRVQEIWLEFLAPGAPSAINVDSKSYAKTTKNIKDPGRYTFEDAQEHIYKLMKSDSYSRFIRSSAYQELLQ 407          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Cavefish
Match: rgs6 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:103032052])

HSP 1 Score: 263.077 bits (671), Expect = 1.187e-81
Identity = 155/409 (37.90%), Postives = 229/409 (55.99%), Query Frame = 2
Query:  290 LSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNS----SKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQGGTKT 1504
            +S IP+ V+G D + WL K LS +D +EA  + +L    GYI+P++D+  L +KDD    YRFQAPYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV++ +++ KT+R ++++QERAFW +HRP PG  C        N     I   R     ++ K S    G     ++ SPV++    S+  T + +E  I+          F++            D      S + E    + ++VR W  + +  L+D  G+ +F +FLE EFS+ENLRFW  V   K  P + +   A+ I+ EFL   A S IN+DS +   T + LK+P R++FE+AQDHIY L+K+DSY RFLRS  Y   L  A +K  ++ G +T
Sbjct:    1 MSKIPSVVTGTDIVQWLMKNLSIEDPAEALHIGSLIAAQGYIFPISDH-VLTLKDD-GTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKTRLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPG--C-------VNTTEMDIRKCRRMKNPQRVKKSVY--GVAEDTQTQSPVHTQSQQSRKDTKEDVEKEIL----------FLN---------TQLDRHCMKMSKVAETKDPSQQRVRKWGFSLEEALKDPVGQDQFLKFLESEFSSENLRFWLAVQDLKRRPLQDVPARAQEIWQEFLAEGAPSSINLDSHSFERTSQNLKDPGRYSFEDAQDHIYKLMKSDSYTRFLRSSAY-QDLLLARKKPESEQGRRT 376          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Cavefish
Match: rgs11 (regulator of G-protein signaling 11-like [Source:NCBI gene;Acc:103038541])

HSP 1 Score: 259.61 bits (662), Expect = 1.721e-79
Identity = 153/426 (35.92%), Postives = 230/426 (53.99%), Query Frame = 2
Query:  212 VKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQ 1489
            + +ME++I  MQ PD GI  ++Q+L ++ IP A++G D + WL ++ S  +  EA    N    YGYIYPL + ++L +K D +  YRFQ PY+W+S       +DYAIYL ++++R + +  L EYE    + L K +   W+F+ MQA EQ+R  K+R+K+DR V+  QE+AFW I+RPPPG    +EEG  R          R+ A  +   +       I   R +   N  KS  C  +E+ + +      +D  +      N W+ + D   W  ++ E     T  +V  W  +F  LL D  G+     +LEKEFSAENL FW      + G   KI E    +Y +FL   A+  +N+DS+TM  T + +K+P RF  ++AQ HIY L+K DSY R+L+S+ Y   L  A+  Q T+
Sbjct:   19 LTKMERVIVSMQDPDMGIKMRNQRLLITVIPHAMTGRDIVDWLIQKYSITE-EEALHTGNFLVKYGYIYPLKEPRNLCLKQDETP-YRFQTPYYWISTRWPASELDYAIYLARKNIRKQGE--LIEYEKECYNALHKRINHTWDFVVMQAREQLRASKQRRKSDRIVLECQEQAFWLINRPPPGVMDILEEGPER----------RNGANTRVQLNVEFYKKEIEHNRKSLGRNRIKSSIC--LESFVKYCEQYQDHDPIMQGCLPSNPWITD-DIMYWNMNA-EMVPMPTKLRVERWTFSFMELLNDPLGKKELLTYLEKEFSAENLLFWQACEEVRHGEASKIAEKVDEVYKQFLAPGASRWVNIDSKTMEKTLQGIKHPHRFVMDDAQMHIYFLMKKDSYPRYLKSELYKNLLARAVVPQETK 426          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Sea Lamprey
Match: RGS7 (regulator of G protein signaling 7 [Source:HGNC Symbol;Acc:HGNC:10003])

HSP 1 Score: 289.271 bits (739), Expect = 1.323e-91
Identity = 159/432 (36.81%), Postives = 241/432 (55.79%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG----------RPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRS-----NSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMAL 1459
             +K ME  + +MQ  D G+P ++ K F++ IP+  +GAD I WL K LS +D +EA  L +L   +GY +P++++  L +KDD    YRFQ PYFW S   +P+ MDYA+YL KR+L+ + +  L +YE  +L RLQ+    KWEFI MQ+E Q ++ ++R+K ++ +  +QERAFW +HRP PG          + CR+ +       +  +  +                  + + R      N+ +N     T K  E+LI ++     YD F+  ++  N W ++ D   W   S +E    + +QVR W  +FD +L D  G+ RF +FL+ EFS+ENL FW  V   K  P R++ E  +RI+ EFL   A + IN+DS +   T + +  P R+TFE+AQ+HIY L+K+DSY RFLRS  Y   L
Sbjct:   27 TLKPMEDTVKRMQEEDVGVPVRTVKGFMTKIPSVFTGADIIQWLMKNLSIEDQAEALHLGSLIAAHGYFFPISEH-VLTLKDD-GTFYRFQTPYFWPSNCWEPENMDYAVYLCKRTLQNKSRSELADYEAESLARLQQAFARKWEFIVMQSEAQAKIDRKREKVEKKITESQERAFWDVHRPVPGCVNTTEVDMKKSCRIRDPHRTRKSVYGLQDECTGGSPPPTPPPDAKKPTMDELRRRVEFLNTQLNWHCMKTSKVAESLIGYSEQYMEYDAFLTPTEPSNPWQSD-DPTFWDMESSKE---PSQQQVRRWGFSFDEVLHDPAGQDRFLRFLQSEFSSENLEFWQAVQELKRRPLREVPEHVQRIWEEFLAPGALNSINLDSHSFERTAQNICEPCRYTFEDAQEHIYKLMKSDSYGRFLRSPIYQEVL 452          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Sea Lamprey
Match: rgs9a (regulator of G protein signaling 9a [Source:ZFIN;Acc:ZDB-GENE-060929-92])

HSP 1 Score: 233.417 bits (594), Expect = 6.174e-71
Identity = 148/424 (34.91%), Postives = 214/424 (50.47%), Query Frame = 2
Query:  221 MEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGR-------PCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHAL 1471
            +E L+ +MQ   TG+P  ++ L    IP A  G +   W+ + + +      N L NL   YGY+YP+     L     PS LY FQ PYFW  +  +   ++YA++LVK+++    +  L EYE     +L +    KW+F+ +QA+EQ+R  KER+K DR V+ +QE+A+WR+ RPPPG        P +    L R+    QI+  R A    + K S    G I      +P++   SG             NN    W    S+   YW+ N    + P             +V  WA +F  L++D  GR  FQ+FL KEFS ENL FW       +G   K+ E  +++YT+FL   A   IN+D+ TMA T + LK+P R+  E AQ HIY L+K DSY R+L+SD Y   L  A+
Sbjct:   23 VECLVCRMQDKQTGVPLLTRHLITFAIPNASIGYNIADWMLRDMKTTQEETYN-LCNLLVKYGYLYPVHPAAHLGFH--PSKLYHFQTPYFWPDRHREASDVEYAVHLVKKNVLSNGQ--LAEYEKVQYHQLFRSEHHKWDFVIIQAQEQIRTLKERRKGDRAVLASQEQAYWRVARPPPGLDNDALNGPVKHTMALHRD----QIVYGRKALGRARLKPSVSLEGLIKYSEQFTPLDPLLSGCLP----------NNP---WM---SNATTYWVLNATMVEVPLRL----------RVERWAFSFQELIQDLRGRKEFQEFLCKEFSGENLSFWEACEDLLYGDCTKLHEKVEQVYTDFLAPWAKRCINIDAETMAVTLEGLKSPHRYVLEAAQAHIYMLMKKDSYPRYLKSDLYKTMLAGAI 411          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Sea Lamprey
Match: RGS7 (regulator of G protein signaling 7 [Source:HGNC Symbol;Acc:HGNC:10003])

HSP 1 Score: 176.792 bits (447), Expect = 3.304e-52
Identity = 79/182 (43.41%), Postives = 121/182 (66.48%), Query Frame = 2
Query:  218 RMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG 763
            +ME+++ +MQ   +G+P ++ K FLS IP+  +GAD + WL K L  DD  +A  +  L   +GY +P++D+  L++KDD    YRFQ P+FW S    P+  DYA+YL KR+++ + +  L +YE  +L RLQ+    KWEFI+MQAE Q ++ K+R K +R ++++QERAFW +HRP PG
Sbjct:    1 QMEEIVTRMQDDKSGVPIRTVKSFLSKIPSVFTGADIVQWLTKNLIIDDQDKALHVGTLMAAHGYFFPISDH-VLMLKDD-GTFYRFQTPFFWPSNCWDPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPG 180          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Sea Lamprey
Match: RGS7 (regulator of G protein signaling 7 [Source:HGNC Symbol;Acc:HGNC:10003])

HSP 1 Score: 141.739 bits (356), Expect = 4.675e-40
Identity = 67/147 (45.58%), Postives = 97/147 (65.99%), Query Frame = 2
Query:  314 SGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRP 754
            +G D + WL K L++ D +EA  L      +GY +P++D+  L +KDD   LYRFQ PYFW S    P+  DYA+YL KR+++ + +  L +YE  +L RLQ+    KWEFI+MQAE Q R+ ++R+K +R V+ +QERAFW +HRP
Sbjct:    1 AGTDIVQWLMKNLNTQDQAEALHLGTQMAAHGYFFPISDH-VLALKDD-GALYRFQNPYFWPSNCWDPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFDRKWEFIFMQAEAQARVDRKREKLERKVMESQERAFWDVHRP 145          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004542.1 (pep scaffold:Pmarinus_7.0:GL477606:163651:168067:1 gene:ENSPMAG00000004144.1 transcript:ENSPMAT00000004542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 8.783e-33
Identity = 59/125 (47.20%), Postives = 83/125 (66.40%), Query Frame = 2
Query: 1088 KQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALR 1462
            ++V+ W    D  L+DS GR +F +FLE EFS+ENLRFW  V   K  P R++ E  + I+ EFL + A S IN+DS++   T + +K P R+TFE+AQ+HIY L+K+DS+ RFLRS  Y   L+
Sbjct:    8 QRVKRWGFGIDEALKDSVGRDQFLRFLESEFSSENLRFWLAVQDLKCRPMREVPERVQEIWREFLASGAPSAINLDSKSYDKTLQNVKEPGRYTFEDAQEHIYKLMKSDSFARFLRSSAYQELLQ 132          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Nematostella
Match: EDO34351 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN2])

HSP 1 Score: 296.59 bits (758), Expect = 4.709e-95
Identity = 164/422 (38.86%), Postives = 252/422 (59.72%), Query Frame = 2
Query:  221 MEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTV--KQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQ 1480
            MEK+I +MQ    G+P ++ K F+S IP+ ++G++ + W+   L  +D  E   LA+L   YGY++ +TD+  L+VKDD S  YRFQ PYFWLS   +P+ +DYA+YL KR+++ + +  L++YE   L +LQ+ L  KW+FIYMQAE Q ++ K+R K +R ++++QERAFW +HRPPPG  C         + +++I    D  +A + + S  +   + + R    ++  +  T +A E++I      + +D FI   +  N W+ + D   W     ++   + V  K+V+ WA +   LL+D  GR  F +FLEKEFSAENL FW      K  P +++ E A+ IYTE+L  ++TS INVD +T    E  L+ P R+ F+ AQDHI+ L+K+DSY RFLRS+ Y   L+    KQ
Sbjct:    1 MEKIIQRMQDERKGVPIRTVKSFMSKIPSVLTGSELVDWMMDNLMIEDRGEGVHLASLLAAYGYVFSITDH-HLMVKDDSS-YYRFQTPYFWLSNNWEPENIDYAVYLCKRTMQNKSRLELDDYEAENLAKLQRTLSRKWDFIYMQAEAQAKVDKKRDKMERQILDSQERAFWNVHRPPPG--C---------VSVTEI----DIKKACKVEMSPNSKRKVQELREQ--LHRRRMKTSQASESIINRYEQYAEFDAFIMYPEPSNPWITD-DITFWE----QDCSITIVPQKRVKRWAFSLSELLKDPLGRKYFTRFLEKEFSAENLAFWLACERLKATPIKQVPEKAQEIYTEYLSEHSTSPINVDCKTHEEVEMNLEKPGRYMFDAAQDHIFQLMKSDSYSRFLRSELYKELLKAPSYKQ 398          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Nematostella
Match: EDO32804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU35])

HSP 1 Score: 87.0409 bits (214), Expect = 4.666e-20
Identity = 41/123 (33.33%), Postives = 75/123 (60.98%), Query Frame = 2
Query: 1082 TVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIE-ESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDY 1447
            T+ +++ W  +F  LL   +G  +FQ+FL  ++  ENL FW  V  ++    R+   + A+ IY +++   + +EI++D++  A  +K + +P + TF+ AQDHIYTL+ +D + RF++S  Y
Sbjct:   35 TIDEMKNWKHDFHALLSSKYGVNQFQEFLRSQYGEENLCFWLAVEDYRRLEDRESRRDMARMIYEDYVSTLSPTEISLDAKIRATVDKSMSDPDQNTFDPAQDHIYTLMYHDCFPRFIKSKHY 157          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Nematostella
Match: EDO43126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZM8])

HSP 1 Score: 90.8929 bits (224), Expect = 5.503e-19
Identity = 47/124 (37.90%), Postives = 68/124 (54.84%), Query Frame = 2
Query: 1091 QVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHK-FGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMAL 1459
            +V  WA  FD L+ D  G   F++FL+KEFS EN+ FW      +     +K++ +A  I+   L  NA   +N+DS  +   E+ L NP+   +   Q  +YTL+K DSY RFL+SD Y   L
Sbjct:  650 RVSRWALGFDKLMDDQAGLHCFEEFLKKEFSEENIVFWIACEEFRSISDPKKLKSAASTIFETHLSPNALMPVNIDSSAVKVAEEHLLNPTNHMYRVPQQQVYTLMKFDSYPRFLKSDLYRQCL 773          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Nematostella
Match: EDO37370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFZ6])

HSP 1 Score: 75.8702 bits (185), Expect = 3.337e-16
Identity = 37/121 (30.58%), Postives = 66/121 (54.55%), Query Frame = 2
Query: 1088 KQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVN-AHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDY 1447
            +++  W  +F+ LL   +G   F +FL+ E+S ENL FW  V    K      ++  A+ IY +++   +  E+++D +T    + E+  P++ TF +AQ H+Y ++  D Y RFL S  +
Sbjct:   28 EEINEWGRSFERLLSSKNGIRVFHEFLKSEYSEENLLFWLAVERLKKETEPASVKNLAQTIYNDYVSTESPKEVSIDHKTRQVIDDEISQPTKETFSKAQQHVYYVMYQDCYPRFLSSSTF 148          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Medaka
Match: rgs7b (regulator of G protein signaling 7 [Source:NCBI gene;Acc:101165338])

HSP 1 Score: 295.434 bits (755), Expect = 1.865e-93
Identity = 164/444 (36.94%), Postives = 247/444 (55.63%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNS----SKSGT----------------------CKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALR 1462
            V ++ME++I +MQ    GIP ++ K FL+ IP+  SG++ + WL K L  +D  EA  L  L   +GY +P++D+  L +KDD    YRFQ PYFW S   +P+  DYA+YL KR+++ + +  L +YE  +L RLQ+    KWEFI+MQAE Q ++ K+R K +R ++++QERAFW +HRP PG  C         +  +++  K+ +      K+     G     R++SP ++    +K  T                       K  E+L+ +      YD F+   D  N W+++ DT  W   + +E G   VK+   WA   D +L+D  GR +F +FLE EFS+ENLRFW  V   K  P R++    + I+ EFL   A S INVDS++   T + +K+P R+ FE+AQ+HIY L+K+DSY RF+RS  Y   L+
Sbjct:   23 VYRKMEEVIARMQDEKNGIPIRTVKSFLTKIPSVFSGSEIVQWLIKNLEIEDPVEALHLGTLMAAHGYFFPISDH-VLTLKDD-GTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPG--C---------VNTTEVDIKKSSRMKNPHKTRKSVYGLQNDIRTHSPTHTPAPEAKQPTEEELQQQITFWQLQLDRHRLKMSKVAESLVGYTEQYFEYDPFLTPPDPSNPWISD-DTTLWELEASKEPGQQRVKR---WAFGIDEVLKDPVGREQFLKFLESEFSSENLRFWLAVQEVKKRPIREVPTRVQEIWQEFLAPGAPSAINVDSKSYGKTTQNIKDPGRYAFEDAQEHIYKLMKSDSYSRFIRSSAYQELLQ 449          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Medaka
Match: rgs7b (regulator of G protein signaling 7 [Source:NCBI gene;Acc:101165338])

HSP 1 Score: 292.738 bits (748), Expect = 1.207e-92
Identity = 162/420 (38.57%), Postives = 241/420 (57.38%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPP--GRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALR 1462
            V ++ME++I +MQ    GIP ++ K FL+ IP+  SG++ + WL K L  +D  EA  L  L   +GY +P++D+  L +KDD    YRFQ PYFW S   +P+  DYA+YL KR+++ + +  L +YE  +L RLQ+    KWEFI+MQAE Q ++ K+R K +R ++++QERAFW +HRP    G    +    P + P         A +AKQ     L    I  ++    ++  +    K  E+L+ +      YD F+   D  N W+++ DT  W   + +E G   VK+   WA   D +L+D  GR +F +FLE EFS+ENLRFW  V   K  P R++    + I+ EFL   A S INVDS++   T + +K+P R+ FE+AQ+HIY L+K+DSY RF+RS  Y   L+
Sbjct:   23 VYRKMEEVIARMQDEKNGIPIRTVKSFLTKIPSVFSGSEIVQWLIKNLEIEDPVEALHLGTLMAAHGYFFPISDH-VLTLKDD-GTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVSVYGLQNDIRTHSPTHTP---------APEAKQPTEEELQQQ-ITFWQLQ--LDRHRLKMSKVAESLVGYTEQYFEYDPFLTPPDPSNPWISD-DTTLWELEASKEPGQQRVKR---WAFGIDEVLKDPVGREQFLKFLESEFSSENLRFWLAVQEVKKRPIREVPTRVQEIWQEFLAPGAPSAINVDSKSYGKTTQNIKDPGRYAFEDAQEHIYKLMKSDSYSRFIRSSAYQELLQ 424          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Medaka
Match: rgs9b (regulator of G protein signaling 9 [Source:NCBI gene;Acc:101158822])

HSP 1 Score: 291.197 bits (744), Expect = 1.282e-89
Identity = 171/425 (40.24%), Postives = 241/425 (56.71%), Query Frame = 2
Query:  200 RNSVVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNI-PLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHAL 1471
            R + +K+ EK++ +MQ P TG+  + Q+L ++TIP A++G D IAWLA RL  D   EA  L ++    GYIYPL D+K L++K D S LYRFQ PYFW +++   +  DYAIYL KR++R  +K  LE +E    +RL K +  KW+FI MQA+EQ R  KERKK DR V + QERA+W +HRPPPG    ++ GL R   P ++     D  +    +        I + R  S V         +I  L+ +    + +D F+ RS   N WL + DT  W   ++      T  +V  W  NF  LL D  GR  F+ FL+KEFS ENL FW +    K+G    ++E A++IY  FL   A   IN+D +TM  T K LK+P R+  + AQ HIY L+K DSY R+L+S  +   ++ A+
Sbjct:   17 RMACLKKAEKMLLEMQDPCTGVKSQPQRLVITTIPHAITGEDIIAWLADRLQID-TQEAKNLGSMLVALGYIYPLQDHKRLLIKPDAS-LYRFQTPYFWPTQLWPVEDTDYAIYLAKRNIR--KKGILELHEQEQYNRLHKWMNHKWDFIVMQAKEQYRAAKERKKPDRVVFDCQERAYWVVHRPPPGTVSAMDYGLERQADPNAEETKTPDHYE----RIMIFTQQSIMRPRVKSSV---------SIGALVKYCATYTGHDPFLSRSLPSNPWLTD-DTTFW-NLNMPNVEIPTKMRVERWTFNFSELLADPRGRDDFRLFLKKEFSGENLAFWESCEDLKWGTAATMKEKAEQIYKTFLARGAPRWINIDGKTMEITVKGLKHPHRYVLDAAQTHIYMLMKKDSYGRYLKSPVFKDTVKKAI 422          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Medaka
Match: rgs9b (regulator of G protein signaling 9 [Source:NCBI gene;Acc:101158822])

HSP 1 Score: 290.812 bits (743), Expect = 1.923e-89
Identity = 171/425 (40.24%), Postives = 241/425 (56.71%), Query Frame = 2
Query:  200 RNSVVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNI-PLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHAL 1471
            R + +K+ EK++ +MQ P TG+  + Q+L ++TIP A++G D IAWLA RL  D   EA  L ++    GYIYPL D+K L++K D S LYRFQ PYFW +++   +  DYAIYL KR++R  +K  LE +E    +RL K +  KW+FI MQA+EQ R  KERKK DR V + QERA+W +HRPPPG    ++ GL R   P ++     D  +    +        I + R  S V         +I  L+ +    + +D F+ RS   N WL + DT  W   ++      T  +V  W  NF  LL D  GR  F+ FL+KEFS ENL FW +    K+G    ++E A++IY  FL   A   IN+D +TM  T K LK+P R+  + AQ HIY L+K DSY R+L+S  +   ++ A+
Sbjct:   17 RMACLKKAEKMLLEMQDPCTGVKSQPQRLVITTIPHAITGEDIIAWLADRLQID-TQEAKNLGSMLVALGYIYPLQDHKRLLIKPDAS-LYRFQTPYFWPTQLWPVEDTDYAIYLAKRNIR--KKGILELHEQEQYNRLHKWMNHKWDFIVMQAKEQYRAAKERKKPDRVVFDCQERAYWVVHRPPPGTVSAMDYGLERQADPNAEETKTPDHYE----RIMIFTQQSIMRPRVKSSV---------SIGALVKYCATYTGHDPFLSRSLPSNPWLTD-DTTFW-NLNMPNVEIPTKMRVERWTFNFSELLADPRGRDDFRLFLKKEFSGENLAFWESCEDLKWGTAATMKEKAEQIYKTFLARGAPRWINIDGKTMEITVKGLKHPHRYVLDAAQTHIYMLMKKDSYGRYLKSPVFKDTVKKAI 422          
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Medaka
Match: ENSORLT00000020998.2 (regulator of G-protein signaling 6 [Source:NCBI gene;Acc:101168163])

HSP 1 Score: 286.189 bits (731), Expect = 2.240e-89
Identity = 167/458 (36.46%), Postives = 256/458 (55.90%), Query Frame = 2
Query:  209 VVKRMEKLIGQMQHPDTG-IPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPG---------RPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSP-----------VNSSKSGTC----KAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYA-MALRHALEKQNTQGGTKT 1504
            V +++E +I ++Q    G +  ++ K FLS IP+ VSGAD + WL K LS +D +EA  L +L   +GYI+P++D+  L +KDD   LYRFQ+PYFW S   +P+  DYAIYL KR+++ + +  L +YE   L RLQ+    KWEFI+MQAE QV+L +++ K +R ++++QERAFW +HRP PG         R CR E+  P  +       K+          + L+   I    +  P           +N      C    K  ++L+ +      YD  +   +  N W+++ DT  W    +E     + ++VR W  + +  L+D  GR +F +FLE EFS+ENLRFW  V   K  P R++   A+ I+ EFL   A S IN+DS +   T + LK+P R+++E+AQ+HI+ L+K+DSY RFLRS+ Y  + L    +  +T+ G +T
Sbjct:   25 VYRKIEDIITRIQDEKAGGVAIRTVKSFLSKIPSVVSGADIVQWLIKNLSIEDPAEAIHLGSLIAAHGYIFPISDH-VLTLKDD-GTLYRFQSPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKLDRKKDKAERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRREKN-PHRV-------KKSVYGVADDSQNQLSPVHISSQPARKPTKEDVQKEITFLNIQLDRHCMKVSKVADSLMSYTDQFVEYDPLVSSVEPSNPWISD-DTTFW---DLEASREPSQQRVRKWGFSLEEALKDPAGRDQFLKFLESEFSSENLRFWLAVQDLKRRPFREVPSRAQEIWQEFLAEGAPSAINLDSHSYERTSQNLKDPGRYSYEDAQEHIFKLMKSDSYARFLRSNIYQDLLLARKKQPADTEQGRRT 468          
BLAST of Regulator of G-protein signaling, putative vs. Planmine SMEST
Match: SMESG000072045.1 (SMESG000072045.1)

HSP 1 Score: 994.956 bits (2571), Expect = 0.000e+0
Identity = 496/497 (99.80%), Postives = 496/497 (99.80%), Query Frame = 2
Query:  185 MDRQYRNSVVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQGGTKTRRLFKXXXXXXXXXXXXXXXXXXXXXINQTEDSGNLNQPNKSPAKANAVAPWDDPEP 1675
            MDRQYRNSVVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGP RKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQGGTKTRRLFKTLAPTTQPTAKPTTQKPPETTINQTEDSGNLNQPNKSPAKANAVAPWDDPEP
Sbjct:    1 MDRQYRNSVVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEEGLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTCKAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPMRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQGGTKTRRLFKTLAPTTQPTAKPTTQKPPETTINQTEDSGNLNQPNKSPAKANAVAPWDDPEP 497          
BLAST of Regulator of G-protein signaling, putative vs. Planmine SMEST
Match: SMESG000072831.1 (SMESG000072831.1)

HSP 1 Score: 162.155 bits (409), Expect = 2.102e-42
Identity = 70/185 (37.84%), Postives = 120/185 (64.86%), Query Frame = 2
Query:  215 KRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRP 769
            +++E +I +MQ+ DTG+  ++ K  +ST+P+  +G D + W+ K L ++++ EA  + ++    GY++P+TD+ SL +K+D   LYRFQ P  + SK  + D ++YA+YL KR+++ +Q+  L ++E   L  LQ     KWEFIY+QAE + ++ K+R K +R V+ +QE+ FW  +RP  G P
Sbjct:  103 RKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDH-SLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAP 286          

HSP 2 Score: 102.449 bits (254), Expect = 1.356e-22
Identity = 51/125 (40.80%), Postives = 74/125 (59.20%), Query Frame = 2
Query: 1088 KQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKEL-----KNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDY 1447
            ++V+ W+     LL+D  GR   Q++LEKEFSAENL+FW      K  P R +    + IY +FL  +A   +NVDS+   +    +      NP RF FEEA++HI+ L+ +DSY R+LRS+ Y
Sbjct:  472 RRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIY 596          
BLAST of Regulator of G-protein signaling, putative vs. Planmine SMEST
Match: SMESG000072831.1 (SMESG000072831.1)

HSP 1 Score: 161.77 bits (408), Expect = 2.207e-42
Identity = 70/185 (37.84%), Postives = 120/185 (64.86%), Query Frame = 2
Query:  215 KRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIAWLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQAPYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCDKWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRP 769
            +++E +I +MQ+ DTG+  ++ K  +ST+P+  +G D + W+ K L ++++ EA  + ++    GY++P+TD+ SL +K+D   LYRFQ P  + SK  + D ++YA+YL KR+++ +Q+  L ++E   L  LQ     KWEFIY+QAE + ++ K+R K +R V+ +QE+ FW  +RP  G P
Sbjct:   96 RKIESIIERMQNEDTGVQIRTVKSLMSTVPSVFTGVDLVTWIIKHLGAEEVMEAIHVGSMIASMGYLFPITDH-SLQMKNDAHSLYRFQTPCLYPSKCCEVDNIEYAVYLCKRTMQNKQRLELADFEAERLATLQSFYWHKWEFIYLQAEAEAKVDKKRDKVERLVLESQEKGFWDSNRPIAGAP 279          

HSP 2 Score: 102.449 bits (254), Expect = 1.306e-22
Identity = 51/125 (40.80%), Postives = 74/125 (59.20%), Query Frame = 2
Query: 1088 KQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKEL-----KNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDY 1447
            ++V+ W+     LL+D  GR   Q++LEKEFSAENL+FW      K  P R +    + IY +FL  +A   +NVDS+   +    +      NP RF FEEA++HI+ L+ +DSY R+LRS+ Y
Sbjct:  465 RRVKKWSFTIQELLKDPAGREEIQKWLEKEFSAENLKFWEACQELKGAPLRDLNRRIEAIYNQFLSPSALEPLNVDSKVAESVANRVANSSTSNPDRFCFEEAEEHIFKLMTSDSYYRYLRSNIY 589          
BLAST of Regulator of G-protein signaling, putative vs. Planmine SMEST
Match: SMESG000011723.1 (SMESG000011723.1)

HSP 1 Score: 115.931 bits (289), Expect = 3.741e-27
Identity = 56/140 (40.00%), Postives = 89/140 (63.57%), Query Frame = 2
Query: 1073 GFSTVKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGPT-RKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQ 1489
            G S+++Q++ W+ +F+CLL D +G   F +FL  EFS EN+ FW     ++   T +K++  A++IY +F+G  A  E+N+DS+T   TE +++NP+  TF++AQ  I  L++ DSY RFLRS+ Y   +R   E Q  Q
Sbjct:  290 GKSSIEQIKKWSNSFECLLHDKYGLALFHEFLRSEFSDENIEFWIACEEYRTITTNKKLQSRAEKIYNDFVGVQAAREVNLDSKTRQQTEIDIRNPNPHTFDQAQKRIQALMEKDSYQRFLRSELYGKLVRACEEYQINQ 429          
BLAST of Regulator of G-protein signaling, putative vs. Planmine SMEST
Match: SMESG000027589.1 (SMESG000027589.1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.041e-22
Identity = 49/128 (38.28%), Postives = 76/128 (59.38%), Query Frame = 2
Query: 1091 QVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHK-FGPTRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQDHIYTLVKNDSYVRFLRSDDYAMALRHAL 1471
            Q++ W  + + LL D +G   F  FL+ E+S ENL FW    ++K     +K+ + A++IY++ L   A  E+N+DS+T   T   L  PS+ TF+ AQ  I+ L++ DSY RFLRSD Y +  R ++
Sbjct:  205 QIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESM 332          
The following BLAST results are available for this feature:
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGS69.242e-9137.84regulator of G protein signaling 6 [Source:HGNC Sy... [more]
RGS69.543e-9137.84regulator of G protein signaling 6 [Source:HGNC Sy... [more]
RGS61.012e-9037.84regulator of G protein signaling 6 [Source:HGNC Sy... [more]
RGS61.012e-9037.84regulator of G protein signaling 6 [Source:HGNC Sy... [more]
RGS61.035e-9037.84regulator of G protein signaling 6 [Source:HGNC Sy... [more]
back to top
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eat-163.716e-6134.13pep chromosome:WBcel235:I:9722550:9726263:1 gene:W... [more]
eat-163.716e-6134.13pep chromosome:WBcel235:I:9722721:9726263:1 gene:W... [more]
eat-164.498e-6134.13pep chromosome:WBcel235:I:9722550:9726282:1 gene:W... [more]
eat-164.498e-6134.13pep chromosome:WBcel235:I:9722721:9726282:1 gene:W... [more]
egl-104.790e-4943.78Regulator of G-protein signaling egl-10 [Source:U... [more]
back to top
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG424502.481e-9541.51gene:FBgn0259927 transcript:FBtr0300218[more]
CG424505.358e-9541.51gene:FBgn0259927 transcript:FBtr0310343[more]
RSG71.664e-8636.51gene:FBgn0024941 transcript:FBtr0074350[more]
RSG71.664e-8636.51gene:FBgn0024941 transcript:FBtr0307538[more]
Dhit5.535e-2135.62gene:FBgn0028743 transcript:FBtr0301142[more]
back to top
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs7a3.107e-9437.61regulator of G protein signaling 7a [Source:ZFIN;A... [more]
rgs7a3.107e-9437.61regulator of G protein signaling 7a [Source:ZFIN;A... [more]
rgs7a3.107e-9437.61regulator of G protein signaling 7a [Source:ZFIN;A... [more]
rgs7a3.469e-9437.61regulator of G protein signaling 7a [Source:ZFIN;A... [more]
rgs64.134e-8936.32regulator of G protein signaling 6 [Source:ZFIN;Ac... [more]
back to top
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGS63.587e-9136.97regulator of G-protein signaling 6 [Source:NCBI ge... [more]
RGS61.101e-8937.33regulator of G-protein signaling 6 [Source:NCBI ge... [more]
RGS61.025e-8738.05regulator of G-protein signaling 6 [Source:NCBI ge... [more]
RGS61.272e-8737.44regulator of G-protein signaling 6 [Source:NCBI ge... [more]
RGS61.622e-8737.74regulator of G-protein signaling 6 [Source:NCBI ge... [more]
back to top
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rgs63.381e-9237.75regulator of G-protein signaling 6 [Source:MGI Sym... [more]
Rgs63.381e-9237.75regulator of G-protein signaling 6 [Source:MGI Sym... [more]
Rgs66.992e-9237.72regulator of G-protein signaling 6 [Source:MGI Sym... [more]
Rgs67.477e-9237.72regulator of G-protein signaling 6 [Source:MGI Sym... [more]
Rgs67.487e-9237.72regulator of G-protein signaling 6 [Source:MGI Sym... [more]
back to top
BLAST of Regulator of G-protein signaling, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z2H2|RGS6_MOUSE7.787e-9138.36Regulator of G-protein signaling 6 OS=Mus musculus... [more]
sp|P49758|RGS6_HUMAN1.268e-8938.46Regulator of G-protein signaling 6 OS=Homo sapiens... [more]
sp|O46470|RGS7_BOVIN3.376e-8936.49Regulator of G-protein signaling 7 OS=Bos taurus O... [more]
sp|O54829|RGS7_MOUSE6.963e-8936.49Regulator of G-protein signaling 7 OS=Mus musculus... [more]
sp|P49803|RGS7_RAT1.070e-8836.49Regulator of G-protein signaling 7 OS=Rattus norve... [more]
back to top
BLAST of Regulator of G-protein signaling, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3ENU11.209e-13847.89Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A158QF082.559e-13345.66Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A158QHJ51.237e-12443.54Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0R3UGM31.478e-12039.78Uncharacterized protein OS=Mesocestoides corti OX=... [more]
V4CNQ94.999e-11344.79Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs61.316e-9136.71regulator of G-protein signaling 6 [Source:NCBI ge... [more]
rgs7a2.502e-8938.10regulator of G protein signaling 7a [Source:ZFIN;A... [more]
rgs7b1.079e-8235.98regulator of G protein signaling 7b [Source:ZFIN;A... [more]
rgs61.187e-8137.90regulator of G-protein signaling 6 [Source:NCBI ge... [more]
rgs111.721e-7935.92regulator of G-protein signaling 11-like [Source:N... [more]
back to top
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGS71.323e-9136.81regulator of G protein signaling 7 [Source:HGNC Sy... [more]
rgs9a6.174e-7134.91regulator of G protein signaling 9a [Source:ZFIN;A... [more]
RGS73.304e-5243.41regulator of G protein signaling 7 [Source:HGNC Sy... [more]
RGS74.675e-4045.58regulator of G protein signaling 7 [Source:HGNC Sy... [more]
ENSPMAT00000004542.18.783e-3347.20pep scaffold:Pmarinus_7.0:GL477606:163651:168067:1... [more]
back to top
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO343514.709e-9538.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328044.666e-2033.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431265.503e-1937.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373703.337e-1630.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Regulator of G-protein signaling, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs7b1.865e-9336.94regulator of G protein signaling 7 [Source:NCBI ge... [more]
rgs7b1.207e-9238.57regulator of G protein signaling 7 [Source:NCBI ge... [more]
rgs9b1.282e-8940.24regulator of G protein signaling 9 [Source:NCBI ge... [more]
rgs9b1.923e-8940.24regulator of G protein signaling 9 [Source:NCBI ge... [more]
ENSORLT00000020998.22.240e-8936.46regulator of G-protein signaling 6 [Source:NCBI ge... [more]
back to top
BLAST of Regulator of G-protein signaling, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072045.10.000e+099.80SMESG000072045.1[more]
SMESG000072831.12.102e-4237.84SMESG000072831.1[more]
SMESG000072831.12.207e-4237.84SMESG000072831.1[more]
SMESG000011723.13.741e-2740.00SMESG000011723.1[more]
SMESG000027589.12.041e-2238.28SMESG000027589.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030621 ID=SMED30030621|Name=Regulator of G-protein signaling, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=1800bp
AATTTGTTTTGAATGATAAAATCATATTATTTTCTGTAAATATTTTTTTG
ACAATTTCTTGACATTGAATAAGATATTCATTTCTCTAAACTGCGATTAA
GATTAATTGGAAATTTGAAAATTTTCCATCGAATTACTGATAACGTTTGG
CAACCGAATGCATTGAATTAGCGCTTTCTCTACAATGGACAGGCAATATC
GAAATAGCGTCGTGAAGCGCATGGAAAAATTAATTGGGCAAATGCAGCAT
CCTGATACCGGGATTCCATTCAAATCCCAGAAACTGTTTCTCAGCACGAT
TCCTGCAGCCGTTTCCGGAGCAGATTTCATCGCTTGGTTGGCGAAACGAT
TGTCCAGTGATGACATGAGCGAAGCAAACATGCTAGCAAATCTGTTTTGT
TACTATGGATATATTTATCCTCTGACCGACTACAAGTCGCTGGTGGTGAA
GGATGACCCGTCGGTGCTCTACAGGTTCCAGGCCCCGTATTTTTGGCTGT
CAAAGGTTAATAAACCTGACGCAATGGATTACGCTATATACTTGGTGAAA
CGGAGCCTTAGAGGGCGACAAAAGTACGGCCTGGAAGAATATGAGCATGG
AGCTCTTGACAGGTTGCAAAAAATGTTATGTGACAAATGGGAATTTATTT
ACATGCAAGCCGAGGAACAAGTAAGATTGGGGAAAGAGCGTAAAAAAACA
GACCGAACAGTTATAAATGCTCAAGAGCGAGCATTTTGGAGAATTCACCG
CCCACCGCCTGGTAGACCTTGTCGAGTGGAGGAAGGTCTACCAAGAAACA
TTCCATTGTCTCAAATCTTATCCAAGAGAGATGCTGCCCAAGCGAAACAA
GGAAAATCTTCAACATTGGCAAATGGATGCATCGGAAAATATAGATCAAA
TAGCCCAGTAAATTCCTCGAAATCCGGTACCTGCAAGGCCATCGAGAATT
TGATAATGCATAACTGCAATAACTCAGCATATGATTGGTTCATTGACCGG
TCTGATACGTTTAATTATTGGTTGGCCAATCCTGACACGGATCAGTGGCC
AGCTTCGTCTATTGAAGAAGGTGGATTTTCGACTGTCAAACAGGTAAGAA
TGTGGGCCACTAATTTCGATTGCTTGTTGCGAGATTCACATGGAAGAATC
CGATTTCAACAGTTCTTGGAGAAAGAATTCAGTGCCGAGAATTTGAGATT
CTGGGCCACCGTCAATGCCCACAAATTTGGGCCCACGAGGAAAATTGAAG
AAAGTGCAAAACGTATTTACACAGAATTCCTCGGTAACAATGCCACCAGT
GAGATCAATGTAGACAGCAGGACAATGGCAGCCACGGAAAAAGAATTAAA
AAATCCCTCAAGATTCACATTTGAAGAGGCACAAGACCATATTTATACGC
TGGTGAAGAATGATTCCTATGTTAGATTTCTGCGATCGGATGACTACGCC
ATGGCGCTGAGACATGCGCTTGAGAAACAAAACACTCAAGGGGGGACTAA
GACTCGTCGACTATTCAAAACTCTCGCTCCTACCACACAACCTACAGCAA
AACCAACCACACAAAAGCCACCAGAGACAACAATCAACCAAACAGAGGAT
TCTGGAAACCTAAACCAACCAAACAAGTCTCCAGCAAAAGCAAACGCAGT
GGCACCATGGGATGATCCAGAACCTTGATTTTATTTTCCATTATTCTAAT
AGTCATTCAATGTGCACTGTAGTATTAGTGATGCTTTATATCTATACATA
TGGGTGATATTTGTGTCCCATTTATTCTCACATAGATGATGGATGGAGTT
back to top

protein sequence of SMED30030621-orf-1

>SMED30030621-orf-1 ID=SMED30030621-orf-1|Name=SMED30030621-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=498bp
MDRQYRNSVVKRMEKLIGQMQHPDTGIPFKSQKLFLSTIPAAVSGADFIA
WLAKRLSSDDMSEANMLANLFCYYGYIYPLTDYKSLVVKDDPSVLYRFQA
PYFWLSKVNKPDAMDYAIYLVKRSLRGRQKYGLEEYEHGALDRLQKMLCD
KWEFIYMQAEEQVRLGKERKKTDRTVINAQERAFWRIHRPPPGRPCRVEE
GLPRNIPLSQILSKRDAAQAKQGKSSTLANGCIGKYRSNSPVNSSKSGTC
KAIENLIMHNCNNSAYDWFIDRSDTFNYWLANPDTDQWPASSIEEGGFST
VKQVRMWATNFDCLLRDSHGRIRFQQFLEKEFSAENLRFWATVNAHKFGP
TRKIEESAKRIYTEFLGNNATSEINVDSRTMAATEKELKNPSRFTFEEAQ
DHIYTLVKNDSYVRFLRSDDYAMALRHALEKQNTQGGTKTRRLFKTLAPT
TQPTAKPTTQKPPETTINQTEDSGNLNQPNKSPAKANAVAPWDDPEP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR040759RGS_DHEX
IPR036390WH_DNA-bd_sf
IPR036305RGS_sf
IPR016137RGS
IPR000591DEP_dom
IPR024066RGS_subdom1/3
IPR011991WHTH_DNA-bd_dom
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0004871signal transducer activity
Vocabulary: cellular component
TermDefinition
GO:0005834heterotrimeric G-protein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016137RGS domainPRINTSPR01301RGSPROTEINcoord: 329..347
score: 45.77
coord: 357..380
score: 39.4
coord: 307..328
score: 42.59
coord: 399..418
score: 58.04
IPR016137RGS domainSMARTSM00315RGS_3coord: 310..425
e-value: 2.4E-31
score: 120.1
IPR016137RGS domainPFAMPF00615RGScoord: 311..421
e-value: 2.3E-27
score: 95.6
IPR016137RGS domainPROSITEPS50132RGScoord: 310..425
score: 29.693
IPR000591DEP domainSMARTSM00049DEP_3coord: 23..100
e-value: 1.6E-15
score: 67.5
IPR000591DEP domainPFAMPF00610DEPcoord: 26..98
e-value: 1.3E-10
score: 41.1
IPR000591DEP domainPROSITEPS50186DEPcoord: 23..100
score: 14.422
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 1..105
e-value: 1.3E-28
score: 101.0
NoneNo IPR availableGENE3DG3DSA:1.10.167.10coord: 337..410
e-value: 4.1E-27
score: 96.3
NoneNo IPR availableGENE3DG3DSA:1.10.1240.60coord: 106..207
e-value: 3.8E-38
score: 131.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 446..484
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 446..497
NoneNo IPR availablePANTHERPTHR45746:SF5coord: 3..477
NoneNo IPR availablePANTHERPTHR45746FAMILY NOT NAMEDcoord: 3..477
NoneNo IPR availableCDDcd04450DEP_RGS7-likecoord: 15..104
e-value: 3.15179E-27
score: 102.754
IPR024066RGS, subdomain 1/3GENE3DG3DSA:1.10.196.10coord: 300..336
e-value: 1.4E-11
score: 46.1
IPR040759Regulator of G-protein signalling, DHEX domainPFAMPF18148RGS_DHEXcoord: 101..200
e-value: 7.2E-39
score: 131.9
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 5..106
IPR036305RGS domain superfamilySUPERFAMILYSSF48097Regulator of G-protein signaling, RGScoord: 297..422