Amidophosphoribosyltransferase

Overview
NameAmidophosphoribosyltransferase
Smed IDSMED30030613
Length (bp)1790
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Amidophosphoribosyltransferase (SMED30030613) t-SNE clustered cells

Violin plots show distribution of expression levels for Amidophosphoribosyltransferase (SMED30030613) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Amidophosphoribosyltransferase (SMED30030613) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Amidophosphoribosyltransferase (SMED30030613) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30030613

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30030613SMESG000003663.1 SMESG000003648.1 SMESG000003647.1 SmedASXL_005865SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30030613SMESG000003663.1 SMESG000003648.1 SMESG000003647.1 dd_Smed_v4_5319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30030613SMESG000003663.1 SMESG000003648.1 SMESG000003647.1 dd_Smed_v4_5319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30030613SMESG000003663.1 SMESG000003648.1 SMESG000003647.1 dd_Smed_v4_5319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30030613SMESG000003663.1 SMESG000003648.1 SMESG000003647.1 dd_Smed_v6_5319_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30030613SMESG000003663.1 SMESG000003648.1 SMESG000003647.1 OX_Smed_1.0.01263ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30030613SMESG000003663.1 SMESG000003648.1 SMESG000003647.1 dd_Smed_v4_5319_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30030613SMESG000003663.1 SMESG000003648.1 SMESG000003647.1 dd_Smed_v4_5319_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Amidophosphoribosyltransferase vs. Ensembl Human
Match: PPAT (phosphoribosyl pyrophosphate amidotransferase [Source:HGNC Symbol;Acc:HGNC:9238])

HSP 1 Score: 143.665 bits (361), Expect = 3.792e-36
Identity = 114/402 (28.36%), Postives = 181/402 (45.02%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLIL----QQATEEKSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNE------------IDFSDVTSIRYLRLEVLSNIISKNIEG------------KEVGN-------IGHCFHCFGGSH 1583
            G   VA +G  +N + L   +L     +   S  E++  L+     Q+  +   W   IK+++   P  YS++IM ++ IY  RD YG +PL +G L  ++     D+   +         V++S+S     I A Y R+VLPGEI+EIS + +++L I  R  G+  + C  EYV  + P+ + EDQ+V  V Y+ GQ LA  +    D V ++P  +      +A    LP  E            +  +  +  L V K      +N  GK+I LV DS +  +     I LLK+SG KE+H+R   PPI   C  GI++ + E             ++    S+ YL +E L + + + I+             +E GN        GHC  C  G +
Sbjct:  115 GKIAVAHNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVS-----DINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKY 511          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Celegans
Match: ppat-1 (Amidophosphoribosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q22134])

HSP 1 Score: 102.834 bits (255), Expect = 5.837e-23
Identity = 91/390 (23.33%), Postives = 168/390 (43.08%), Query Frame = 3
Query:  525 LGSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLILQ------QATEEKSWPGIIKDILSTFPG---GYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDA-TSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAFYH--------------MSVSAEMAMLNVYKENVIGKKIALVVDS-PXXXXXXXXXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNE------------IDFSDVTSIRYLRLEVLSNIISKNIEGKEVGNIGHCFHCFGGSH 1583
            +G+  +A +G  ++      ++L +   +   +  E++A +I +      +    +    I +++  T       YS+++M  +R+Y  RD +G +PL +G +   N         G P         +AS        NA    +V PGEI+E+S  G+KS+   +++  +   ++C  EYV  +  +  +E Q VQ V  + G+++A       D V ++P  S +   G+A  S +      +               M  +A      V K+ + G++I LV DS      +   + +L+ +G KE+HLR   PP+   C  GI++ + +              F    S+RYL ++ L + + K IE     + GHC  C  G +
Sbjct:  103 MGTVAIAHNGELVDAKQKRKEVLHEGVGLSTDTDSELIAQMIAKAIALNVKCKYGQEMGDITRELAVTMSALNMSYSLLVMTFDRLYAIRDPFGNRPLCVGTVYSKN---------GNP------EAFIASSESCAFPANAKLDFEVRPGEIVELSTGGIKSV---WQMKPNTPLAMCIFEYVYFARNDSEIEGQQVQTVREECGKTMALEDDLEADIVGNVPDSSLSAAIGYASQSGITYEPVLHRNSYVGRSFIEPNDEMRQNAIKMKFGVLKKKIHGQRIVLVDDSIVRGNTMRTLVKMLRDAGAKEVHLRIASPPVKFPCFMGINIPTTKELIAAEKTIPEICQFVGADSVRYLSVDGLVSSVQKGIERAANFSPGHCTACLTGKY 474          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Fly
Match: Prat2 (gene:FBgn0041194 transcript:FBtr0076946)

HSP 1 Score: 139.043 bits (349), Expect = 4.081e-35
Identity = 108/384 (28.12%), Postives = 172/384 (44.79%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLIL---QQATEEK--SWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNE------------IDFSDVTSIRYLRLEVLSNIISKNIEGKEVGNIGHCFHCFGGSH 1583
            G+  +A +G  +N  SL  ++L +   +   S  E++A  +    +  +E    +WP  I+  ++  P  YS+++M K++IY  RD YG +PL LG       ++  D        +     V++S+S     I A Y R+V PGEIIE+S NG +++ I  R      + C  EYV  +  + + E Q+V +   + G+ LA  S    D V S+P    A  +G+A  S LP  E            +  S  +  L V K      +NV GK+I LV DS +  +     I LL+ +G  E+H+R   PP+   C  GI++ + E             D     S+ YL +E L   +  N         G+C  C  G +
Sbjct:   83 GALAIAHNGELVNCESLRREVLERGVGLSTHSDSELIAQSLCCAPEDVSEHDGPNWPARIRHFMTLAPLSYSLVVMHKDKIYAVRDSYGNRPLCLG------KIVPVDAGHANINDQLAEGWVVSSESCGFLSIGARYVREVEPGEIIELSRNGYRTVDIVERPDYKRMAFCIFEYVYFARSDSMFEGQMVYSARLQCGRQLARESPLDADLVSSVPESGTAAAHGYARESGLPFGEVLCKNRYVGRTFIQPSTRLRQLGVAKKFGALAQNVEGKRIVLVDDSIVRGNTIGPIIKLLRDAGATEVHIRIASPPLQYPCYMGINIPTREELIANKLNADQLADHVGADSLAYLSVEGLVKAVQMNKAHVNPLKAGYCTACLTGEY 460          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Fly
Match: Prat2 (gene:FBgn0041194 transcript:FBtr0076945)

HSP 1 Score: 139.043 bits (349), Expect = 9.123e-35
Identity = 108/384 (28.12%), Postives = 172/384 (44.79%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLIL---QQATEEK--SWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNE------------IDFSDVTSIRYLRLEVLSNIISKNIEGKEVGNIGHCFHCFGGSH 1583
            G+  +A +G  +N  SL  ++L +   +   S  E++A  +    +  +E    +WP  I+  ++  P  YS+++M K++IY  RD YG +PL LG       ++  D        +     V++S+S     I A Y R+V PGEIIE+S NG +++ I  R      + C  EYV  +  + + E Q+V +   + G+ LA  S    D V S+P    A  +G+A  S LP  E            +  S  +  L V K      +NV GK+I LV DS +  +     I LL+ +G  E+H+R   PP+   C  GI++ + E             D     S+ YL +E L   +  N         G+C  C  G +
Sbjct:  160 GALAIAHNGELVNCESLRREVLERGVGLSTHSDSELIAQSLCCAPEDVSEHDGPNWPARIRHFMTLAPLSYSLVVMHKDKIYAVRDSYGNRPLCLG------KIVPVDAGHANINDQLAEGWVVSSESCGFLSIGARYVREVEPGEIIELSRNGYRTVDIVERPDYKRMAFCIFEYVYFARSDSMFEGQMVYSARLQCGRQLARESPLDADLVSSVPESGTAAAHGYARESGLPFGEVLCKNRYVGRTFIQPSTRLRQLGVAKKFGALAQNVEGKRIVLVDDSIVRGNTIGPIIKLLRDAGATEVHIRIASPPLQYPCYMGINIPTREELIANKLNADQLADHVGADSLAYLSVEGLVKAVQMNKAHVNPLKAGYCTACLTGEY 537          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Fly
Match: Prat (gene:FBgn0004901 transcript:FBtr0304705)

HSP 1 Score: 134.42 bits (337), Expect = 3.180e-33
Identity = 107/390 (27.44%), Postives = 179/390 (45.90%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLILQQATEEKS------WPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAFYH--------MSVSAEMAMLNVYK------ENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNEIDFSD------------VTSIRYLRLEVLSNIISKNIEGKEVGN-----IGHCFHCFGGSH 1583
            G+  +A +G  +N  SL  ++L +   +   S  E++A   L  A E+ S      WP  I+  +   P  YS++IM K++IY  RD YG +PL +G +  +N+        G  +  P    V++S+S     I A Y R+V PGEI+E+S +G +++ I  R      + C  EYV  +  + + E Q+V  V  + G+ L   +    D V S+P    A  +G+A  S +   E            +  S  +  L V K      ENV GK++ L+ DS +  +     I LL+ +G +E+H+R   PP+   C  GI++ + E   ++              S+ YL +E L   +   ++ ++ G+      GHC  C  G +
Sbjct:  156 GALALAHNGELVNNESLRREVLARGVGLSTHSDSELIAQ-SLCCAPEDVSELDGPNWPARIRHFMMLAPLSYSLVIMLKDKIYAVRDTYGNRPLCIGKIVPINAG------HGNNLDTPADGWVVSSESCGFLSIGARYVREVEPGEIVELSRSGYRTVDIVERPDFKRMAFCIFEYVYFARGDSIFEGQMVYTVRLQCGRQLWREAPVEADIVSSVPESGTAAAHGYARESGIEFAEVLCRNRYVGRTFIQPSTRLRQLGVAKKFGALSENVAGKRLVLIDDSIVRGNTIGPIIKLLRDAGAREVHIRIASPPLQYPCYMGINIPTREELIANKLNPDQLARHVGADSLAYLSVEGLVEAV--QLKHRDAGDSKSKGTGHCTACLTGEY 536          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Fly
Match: Prat (gene:FBgn0004901 transcript:FBtr0081764)

HSP 1 Score: 134.42 bits (337), Expect = 3.180e-33
Identity = 107/390 (27.44%), Postives = 179/390 (45.90%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLILQQATEEKS------WPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAFYH--------MSVSAEMAMLNVYK------ENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNEIDFSD------------VTSIRYLRLEVLSNIISKNIEGKEVGN-----IGHCFHCFGGSH 1583
            G+  +A +G  +N  SL  ++L +   +   S  E++A   L  A E+ S      WP  I+  +   P  YS++IM K++IY  RD YG +PL +G +  +N+        G  +  P    V++S+S     I A Y R+V PGEI+E+S +G +++ I  R      + C  EYV  +  + + E Q+V  V  + G+ L   +    D V S+P    A  +G+A  S +   E            +  S  +  L V K      ENV GK++ L+ DS +  +     I LL+ +G +E+H+R   PP+   C  GI++ + E   ++              S+ YL +E L   +   ++ ++ G+      GHC  C  G +
Sbjct:  156 GALALAHNGELVNNESLRREVLARGVGLSTHSDSELIAQ-SLCCAPEDVSELDGPNWPARIRHFMMLAPLSYSLVIMLKDKIYAVRDTYGNRPLCIGKIVPINAG------HGNNLDTPADGWVVSSESCGFLSIGARYVREVEPGEIVELSRSGYRTVDIVERPDFKRMAFCIFEYVYFARGDSIFEGQMVYTVRLQCGRQLWREAPVEADIVSSVPESGTAAAHGYARESGIEFAEVLCRNRYVGRTFIQPSTRLRQLGVAKKFGALSENVAGKRLVLIDDSIVRGNTIGPIIKLLRDAGAREVHIRIASPPLQYPCYMGINIPTREELIANKLNPDQLARHVGADSLAYLSVEGLVEAV--QLKHRDAGDSKSKGTGHCTACLTGEY 536          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Zebrafish
Match: ppat (phosphoribosyl pyrophosphate amidotransferase [Source:ZFIN;Acc:ZDB-GENE-041210-323])

HSP 1 Score: 154.836 bits (390), Expect = 2.806e-40
Identity = 121/398 (30.40%), Postives = 189/398 (47.49%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLI-LQQATEE---KSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGIL---SDMNS--VIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDS-PXXXXXXXXXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKS------NEIDFSDV------TSIRYLRLEVLSNIISKNIE--GKE--------VGNIGHCFHCFGGSH 1583
            G   VA +G  +N S+L   ++     +   S  E++  L+ L    EE     W   IK++++  P  YS+++M K+ IY  RD YG +PL +G L   S ++S    E D  G           V++S+S     I A Y R+V PGEI++IS NG++SL +  R  GD  + C  EYV  + P+ + E Q+V  V  + G+ LA  +    D V ++P  +     G+A+ S LP  E            +  +  +  L V K      +N  GK++ L+ DS      ++  I LLK++G  E+H+R   PPI   C  GI++ +      N+ +F D+      TS+RYL +E L + +   IE  GK+           IGHC  C  G +
Sbjct:  115 GKIAVAHNGELVNASALRKKVMRHGVGLSTCSDSELITQLLALTPPMEELDNPDWVARIKNLMTETPTSYSLLVMYKDVIYAVRDPYGNRPLCIGRLVPISKLHSSGAGEADTEGW----------VVSSESCSFQSIGAKYYREVKPGEIVQISKNGVESLSVVPRPEGDLPAFCIFEYVYFARPDSMFEGQMVYTVRQRCGRQLAIEAPTDADVVSTVPESATPAALGYAQQSGLPYVEVLCKNRYVGRTFIQPNTRLRQLGVAKKFGALTDNFAGKRVVLIDDSIVRGNTISPIIKLLKEAGATEVHIRVASPPIRFPCYMGINIPTKEELIANKPEFKDIAGYIGATSVRYLSVEGLLSAVQGGIESHGKDERISSTTKTTRIGHCTACLTGKY 502          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Zebrafish
Match: ppat (phosphoribosyl pyrophosphate amidotransferase [Source:ZFIN;Acc:ZDB-GENE-041210-323])

HSP 1 Score: 51.9878 bits (123), Expect = 2.908e-7
Identity = 35/113 (30.97%), Postives = 57/113 (50.44%), Query Frame = 3
Query:  483 ASDSKDLMDIYCPQL-GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLI-LQQATEE---KSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGIL 806
            A   +DL+ +    L G   VA +G  +N S+L   ++     +   S  E++  L+ L    EE     W   IK++++  P  YS+++M K+ IY  RD YG +PL +G L
Sbjct:   73 AFKPEDLLKLRYDTLHGKIAVAHNGELVNASALRKKVMRHGVGLSTCSDSELITQLLALTPPMEELDNPDWVARIKNLMTETPTSYSLLVMYKDVIYAVRDPYGNRPLCIGRL 185          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Xenopus
Match: ppat (phosphoribosyl pyrophosphate amidotransferase [Source:NCBI gene;Acc:394937])

HSP 1 Score: 142.51 bits (358), Expect = 6.696e-36
Identity = 108/397 (27.20%), Postives = 185/397 (46.60%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLIL----QQATEEKSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPI-----------------NEAFYHMSVSAEMAMLNVYKENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKS------NEIDFSDVT------SIRYLRLEVLSNIISKNIE----------GK-EVGNIGHCFHCFGGSH 1583
            G   VA +G  +N + L   ++     +   S  E++  L+     Q+      W   I+++++  P  YS+++M  + IY  RD YG +PL +G L  +N+        GK         V++S+S     I A Y R++LPGEI++IS  G+++L I  R  GD ++ C  EYV  + P+ + E Q+V +V  + GQ LA  +    D V ++P  +     G+AE   L                   N     + V+ +  +L+   +N +GK++ L+ DS +  +     I LL+ SG KE+H+R   PPI   C  GI++ +      N  +F+D+       S+ YL +E L+  + + ++          GK +  + GHC  C  G +
Sbjct:  115 GKIAVAHNGELVNAARLKRKVMRHGVGLSTSSDSELITQLLAFTPPQEEDHTADWIARIRNLMNETPTSYSLLVMHNDVIYAIRDPYGNRPLCIGRLMPVNNEGR-----GKIRSAETEGWVVSSESCSFLSIGAEYYREILPGEIVKISREGVQTLDIVPRTNGDPSAFCIFEYVYFARPDSIFEGQMVYSVRRRCGQQLAIEAPVEADLVSTVPESATPAALGYAEKCGLQYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLS---DNFVGKRVVLIDDSIVRGNTISPIIKLLRDSGAKEVHIRVASPPIKYPCYMGINIPTKEELIANRPEFNDLAGYIGADSVVYLSVEGLTAAVREGVKAFKDEQNGINGKTKSSSHGHCTACLTGEY 503          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Xenopus
Match: ppat (phosphoribosyl pyrophosphate amidotransferase [Source:NCBI gene;Acc:394937])

HSP 1 Score: 142.51 bits (358), Expect = 1.192e-35
Identity = 108/399 (27.07%), Postives = 188/399 (47.12%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLIL----QQATEEKSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPI-----------------NEAFYHMSVSAEMAMLNVYKENVIGKKIALVVDS-PXXXXXXXXXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKS------NEIDFSDVT------SIRYLRLEVLSNIISKNIE----------GK-EVGNIGHCFHCFGGSHAM 1589
            G   VA +G  +N + L   ++     +   S  E++  L+     Q+      W   I+++++  P  YS+++M  + IY  RD YG +PL +G L  +N+        GK   + +   V++S+S     I A Y R++LPGEI++IS  G+++L I  R  GD ++ C  EYV  + P+ + E Q+V +V  + GQ LA  +    D V ++P  +     G+AE   L                   N     + V+ +  +L+   +N +GK++ L+ DS      ++  I LL+ SG KE+H+R   PPI   C  GI++ +      N  +F+D+       S+ YL +E L+  + + ++          GK +  + GHC  C  G + +
Sbjct:  115 GKIAVAHNGELVNAARLKRKVMRHGVGLSTSSDSELITQLLAFTPPQEEDHTADWIARIRNLMNETPTSYSLLVMHNDVIYAIRDPYGNRPLCIGRLMPVNNEGR-----GKRSAETEG-WVVSSESCSFLSIGAEYYREILPGEIVKISREGVQTLDIVPRTNGDPSAFCIFEYVYFARPDSIFEGQMVYSVRRRCGQQLAIEAPVEADLVSTVPESATPAALGYAEKCGLQYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLS---DNFVGKRVVLIDDSIVRGNTISPIIKLLRDSGAKEVHIRVASPPIKYPCYMGINIPTKEELIANRPEFNDLAGYIGADSVVYLSVEGLTAAVREGVKAFKDEQNGINGKTKSSSHGHCTACLTGEYPL 504          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Xenopus
Match: ppat (phosphoribosyl pyrophosphate amidotransferase [Source:NCBI gene;Acc:394937])

HSP 1 Score: 132.88 bits (333), Expect = 1.423e-32
Identity = 106/397 (26.70%), Postives = 182/397 (45.84%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLIL----QQATEEKSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPI-----------------NEAFYHMSVSAEMAMLNVYKENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKS------NEIDFSDVT------SIRYLRLEVLSNIISKNIE----------GK-EVGNIGHCFHCFGGSH 1583
            G   VA +G  +N + L   ++     +   S  E++  L+     Q+      W   I+++++  P  YS+++M  + IY  RD YG +PL +G L  +N+       G   + +    NV      IL      Y R++LPGEI++IS  G+++L I  R  GD ++ C  EYV  + P+ + E Q+V +V  + GQ LA  +    D V ++P  +     G+AE   L                   N     + V+ +  +L+   +N +GK++ L+ DS +  +     I LL+ SG KE+H+R   PPI   C  GI++ +      N  +F+D+       S+ YL +E L+  + + ++          GK +  + GHC  C  G +
Sbjct:  115 GKIAVAHNGELVNAARLKRKVMRHGVGLSTSSDSELITQLLAFTPPQEEDHTADWIARIRNLMNETPTSYSLLVMHNDVIYAIRDPYGNRPLCIGRLMPVNNE------GRGKIDRILWLNV----DQILQISLGMYYREILPGEIVKISREGVQTLDIVPRTNGDPSAFCIFEYVYFARPDSIFEGQMVYSVRRRCGQQLAIEAPVEADLVSTVPESATPAALGYAEKCGLQYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLS---DNFVGKRVVLIDDSIVRGNTISPIIKLLRDSGAKEVHIRVASPPIKYPCYMGINIPTKEELIANRPEFNDLAGYIGADSVVYLSVEGLTAAVREGVKAFKDEQNGINGKTKSSSHGHCTACLTGEY 498          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Mouse
Match: Ppat (phosphoribosyl pyrophosphate amidotransferase [Source:MGI Symbol;Acc:MGI:2387203])

HSP 1 Score: 150.984 bits (380), Expect = 7.661e-39
Identity = 116/402 (28.86%), Postives = 182/402 (45.27%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLILQQATEEKS----WPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNE------------IDFSDVTSIRYLRLEVLSNIISKNIEG------------KEVGN-------IGHCFHCFGGSH 1583
            G   VA +G  +N + L   +L +   +   S  E++  L+     +EK     W   IK+++   P  YS++IM ++ IY  RD YG +PL +G L  ++     DV   +         V++S+S     I A Y  +V PGEI+EIS +G+++L I  R  GD  + C  EYV  + P+ + EDQ+V  V Y+ GQ LA  +    D V ++P  +     G+A    LP  E            +  +  +  L V K      +N  GK+I L+ DS +  +     I LLK+SG KE+H+R   PPI   C  GI++ + E             ++    S+ YL +E L + + + I+             +E GN        GHC  C  G +
Sbjct:  115 GKIAVAHNGELVNAARLRKKLLRQGIGLSTSSDSEMITQLLAYTPPQEKDDAPDWVARIKNLMKEAPAAYSLVIMHRDFIYAVRDPYGNRPLCIGRLMPVS-----DVNDKEKKSSETEGWVVSSESCSFLSIGARYCHEVKPGEIVEISRHGIRTLDIIPRSNGDPVAFCIFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVEADLVSTVPESATPAALGYATKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLIDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIKYPCFMGINIPTKEELIANKPEFDCLAEYLGANSVVYLSVEGLVSSVQQEIKFKKQKVKKHDIAIQENGNGLEYFEKTGHCTACLTGQY 511          
BLAST of Amidophosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|P35433|PUR1_RAT (Amidophosphoribosyltransferase OS=Rattus norvegicus OX=10116 GN=Ppat PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 5.133e-37
Identity = 113/405 (27.90%), Postives = 182/405 (44.94%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLIL----QQATEEKSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPI-----------------NEAFYHMSVSAEMAMLNVYKENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNE------------IDFSDVTSIRYLRLEVLSNIISKNIEG------------KEVGN-------IGHCFHCFGGSH 1583
            G   VA +G  +N + L   +L     +   S  E++  L+     Q+  +   W   IK+++   P  YS++IM ++ IY  RD YG +PL +G L  ++     D+   +         V++S+S     I A Y  +V PGEI+EIS +G+++L I  R  GD  + C  EYV  + P+ + EDQ+V  V Y+ GQ LA  +    D V ++P  +     G+A    LP                  N     + V+ +  +L+   +N  GK+I L+ DS +  +     I LLK+SG KE+H+R   PPI   C  GI++ + E             ++    S+ YL +E L + + + I+             +E GN        GHC  C  G +
Sbjct:  115 GKIAVAHNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPAAYSLVIMHRDVIYAVRDPYGNRPLCIGRLMPVS-----DINDKEKKSSETEGWVVSSESCSFLSIGARYCHEVKPGEIVEISRHGVRTLDIIPRSNGDPVAFCIFEYVYFARPDSMFEDQMVYTVRYRCGQQLAVEAPVEADLVSTVPESATPAALGYATKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLS---DNFKGKRIVLIDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIKHPCFMGINIPTKEELIANKPEFEYLAEYLGANSVVYLSVEGLVSSVQQEIKFKKQKVKKRDITIQENGNGLEYFEKTGHCTACLTGQY 511          
BLAST of Amidophosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|Q06203|PUR1_HUMAN (Amidophosphoribosyltransferase OS=Homo sapiens OX=9606 GN=PPAT PE=1 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.821e-35
Identity = 114/402 (28.36%), Postives = 181/402 (45.02%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLIL----QQATEEKSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNE------------IDFSDVTSIRYLRLEVLSNIISKNIEG------------KEVGN-------IGHCFHCFGGSH 1583
            G   VA +G  +N + L   +L     +   S  E++  L+     Q+  +   W   IK+++   P  YS++IM ++ IY  RD YG +PL +G L  ++     D+   +         V++S+S     I A Y R+VLPGEI+EIS + +++L I  R  G+  + C  EYV  + P+ + EDQ+V  V Y+ GQ LA  +    D V ++P  +      +A    LP  E            +  +  +  L V K      +N  GK+I LV DS +  +     I LLK+SG KE+H+R   PPI   C  GI++ + E             ++    S+ YL +E L + + + I+             +E GN        GHC  C  G +
Sbjct:  115 GKIAVAHNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVS-----DINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKY 511          
BLAST of Amidophosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|P28173|PUR1_CHICK (Amidophosphoribosyltransferase OS=Gallus gallus OX=9031 GN=PPAT PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 2.880e-35
Identity = 111/399 (27.82%), Postives = 186/399 (46.62%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLIL----QQATEEKSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPN-VLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPI-----------------NEAFYHMSVSAEMAMLNVYKENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKS------NEIDFSDVT------SIRYLRLEVLSNIISKNIEGKE------------VGNIGHCFHCFGGSH 1583
            G   VA +G   N   L   ++     +   S  E++  L+      +  +   W   IK++++  P  YS++IM K+ IY  RD YG +PL +G L      I    I GK     ++   V++S+S     I A Y R+VLPGEI++IS   +++L +  R  GD ++ C  EYV  + P+ + E Q+V +V  + GQ LA  +    D V ++P  +     G+A+   LP                  N     + V+ +  +L+   +N  GK++ ++ DS +  +     I LL++SG KE+H+R   PPI   C  GI++ +      N  +F D+       S+ YL +E L + + ++I+ ++            VG IGHC  C  G +
Sbjct:  115 GKIAVAHNGELTNAVRLRRKLMRHGVGLSTSSDSELITQLLAFTPPLENDDTADWVARIKNLMNETPTSYSLLIMHKDIIYAVRDPYGNRPLCIGRL------IPVGDINGKGKDNSETEGWVVSSESCSFLSIGAEYYREVLPGEIVKISRYDVQTLDVVPRPEGDPSAFCIFEYVYFARPDSIFEGQMVYSVRRRCGQQLAIEAPVEADLVSTVPESATPAALGYAQKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLS---DNFKGKRVVIIDDSIVRGNTISPIIKLLRESGAKEVHIRVASPPIRFPCYMGINIPTKEELIANRPEFHDLANYIGADSVVYLSVEGLVSSVQESIKARKENENSLKTQKSRVGKIGHCTACLTGDY 504          
BLAST of Amidophosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|Q27601|PUR1_DROME (Amidophosphoribosyltransferase OS=Drosophila melanogaster OX=7227 GN=Prat PE=1 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 3.188e-32
Identity = 107/390 (27.44%), Postives = 179/390 (45.90%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLILQQATEEKS------WPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAFYH--------MSVSAEMAMLNVYK------ENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNEIDFSD------------VTSIRYLRLEVLSNIISKNIEGKEVGN-----IGHCFHCFGGSH 1583
            G+  +A +G  +N  SL  ++L +   +   S  E++A   L  A E+ S      WP  I+  +   P  YS++IM K++IY  RD YG +PL +G +  +N+        G  +  P    V++S+S     I A Y R+V PGEI+E+S +G +++ I  R      + C  EYV  +  + + E Q+V  V  + G+ L   +    D V S+P    A  +G+A  S +   E            +  S  +  L V K      ENV GK++ L+ DS +  +     I LL+ +G +E+H+R   PP+   C  GI++ + E   ++              S+ YL +E L   +   ++ ++ G+      GHC  C  G +
Sbjct:  156 GALALAHNGELVNNESLRREVLARGVGLSTHSDSELIAQ-SLCCAPEDVSELDGPNWPARIRHFMMLAPLSYSLVIMLKDKIYAVRDTYGNRPLCIGKIVPINAG------HGNNLDTPADGWVVSSESCGFLSIGARYVREVEPGEIVELSRSGYRTVDIVERPDFKRMAFCIFEYVYFARGDSIFEGQMVYTVRLQCGRQLWREAPVEADIVSSVPESGTAAAHGYARESGIEFAEVLCRNRYVGRTFIQPSTRLRQLGVAKKFGALSENVAGKRLVLIDDSIVRGNTIGPIIKLLRDAGAREVHIRIASPPLQYPCYMGINIPTREELIANKLNPDQLARHVGADSLAYLSVEGLVEAV--QLKHRDAGDSKSKGTGHCTACLTGEY 536          
BLAST of Amidophosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|Q55038|PUR1_SYNE7 (Amidophosphoribosyltransferase OS=Synechococcus elongatus (strain PCC 7942 / FACHB-805) OX=1140 GN=purF PE=3 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 8.633e-31
Identity = 95/374 (25.40%), Postives = 163/374 (43.58%), Query Frame = 3
Query:  522 QLGSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLILQQATEEKSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAFYH--------------MSVSAEMAMLNVYKENVIGKKIALVVDS-PXXXXXXXXXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNEIDFSDVTSIRYLRLEV----LSNIISKNIEGKEVGNIGH-CFHCFGGSH 1583
            +LG   +A +G  +N   L  ++L KN  +   +  E++A  I++   E + W G I+       G +S+ I     +YG RD  G++PLVLG L + N    Y               VL+S++  L+ I A Y R + PGE++ I+D GL+S             LC  E +  + P+ L   + + +   ++GQ LA  +    D V  +P        GF+EA  +P  E                  M  +     LN  K+ + GK+IA++ DS          +  L+ +G  E+H+R   PP+   C +GID  + +   +   S+  +  ++    L+ +  + +      +IG+ C  CF G +
Sbjct:  119 RLGPVALAHNGNLVNTVELRQELLAKNHELTTTTDSELIAFAIMEAVAEGQDWRGAIESACRRSQGAFSLTIGTPEALYGTRDPNGIRPLVLGTL-ESNGQTRY---------------VLSSETCGLDIIGADYVRDIAPGEMVRITDAGLESWTWA---EAPQPKLCVFEMIYFARPDSLFHGESLYSYRRRIGQRLAKEAPADVDLVLGVPDSGIPAAIGFSEALGIPYAEGLIKNRYVGRTFIQPTQSMRETGIRMKLNPLKDVLAGKRIAIIDDSIVRGTTSRKLVKALRDAGATEVHMRISSPPVTHPCFYGIDTDTQDQLIAATRSVSEITEQIGVDSLAYLTEQGMLEATRESIGNFCTACFNGRY 473          
BLAST of Amidophosphoribosyltransferase vs. TrEMBL
Match: A0A1D2NFC0 (Amidophosphoribosyltransferase OS=Orchesella cincta OX=48709 GN=Ocin01_02755 PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.846e-40
Identity = 118/385 (30.65%), Postives = 182/385 (47.27%), Query Frame = 3
Query:  522 QLGSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLIL----QQATEEKSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDS-PXXXXXXXXXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNE------------IDFSDVTSIRYLRLEVLSNIISKNIEGKEVGNIGHCFHCFGGSH 1583
            Q G+  VA +G  +N  SL   +L +   +   S  E++   +     +   E  +WP  IK ++   P  YS+++M ++RIYG RD YG +PL LG L  +     Y  I G+   +     V++S+S     I A Y R+V PGEI+E++  G+KS+GI  R      + C  EYV  + P+ + E Q+V +V  + G+ LA  +    D V S+P    A  +G+A  S +   E            +  S  +  L V K      +NV GKKI L+ DS      +   I LL+ +G KE+H+R   PPI   C  GI++ + E             D     S+ YL +E L + ++ +I  K+   IGHC  C  G +
Sbjct:  165 QHGALAVAHNGELVNAESLRKKVLDRGLGLSTMSDSELITQALCLNPPEGEHEGPNWPARIKHVMKLSPLSYSLVLMYQDRIYGVRDPYGNRPLCLGKLVPVTKRKMYPRINGENEDENCEGWVISSESSGFLSIGARYLREVEPGEIVELTKYGVKSIGIVERQDDRLPAFCIFEYVYFARPDSIFEGQVVYSVRMQCGRELAKEAPCDADIVSSVPESGTAAAHGYARQSGIQFAEVLCKNRYVGRTFIQPSTRLRQLGVAKKFGALMDNVFGKKIVLIDDSIVRGNTIGPIIKLLRDAGAKEVHIRVASPPIKYPCYMGINIPTREELIANKLDAHQLADAVGADSLVYLSIEGLISAVTYSIREKDPKKIGHCIACLSGQY 549          
BLAST of Amidophosphoribosyltransferase vs. TrEMBL
Match: A0A067QL93 (Amidophosphoribosyltransferase OS=Zootermopsis nevadensis OX=136037 GN=L798_00398 PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 4.680e-39
Identity = 114/383 (29.77%), Postives = 182/383 (47.52%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLILQQATEEK----SWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNEIDFSD------------VTSIRYLRLEVLSNIISKNIEGKEVGNIGHCFHCFGGSH 1583
            G+  VA +G  +N  SL   +L +   +   S  E++   +     E +     WP  IK ++   P  YS++IM K+RIYG RD YG +PL +G +  +         G K   + +   V++S+S     I A Y R+V PGEI+E++ +G+K++GI  R      + C  EYV  +  + + E Q+V +V  + G+ LA  +    D V S+P    A  +GF+  SK+P  E            +  S  +  L V K      ENV+GKK+ LV DS +  +     I LL+ +G KE+H+R   PP++  C  GI++ + E   ++              S+ YL +E L   +   I  K    +GHC  C  G++
Sbjct:  124 GALAVAHNGEIVNCGSLRKMVLGRGVGLSTHSDSELITQALCLNPPEGEVNGPDWPARIKHLMQLAPLSYSLVIMQKDRIYGVRDPYGNRPLCIGKIVPLKLTN-----GNKNEDEMEEGWVISSESCGFLSIGARYEREVAPGEIVEMTKDGIKTIGIVERPNAKPQAFCIFEYVYFARSDSIFEGQMVYSVRMQCGRVLAREAHVNADIVSSVPESGTAAAHGFSRESKIPFAEVLCKNRYVGRTFIQPSTRLRQLGVAKKFGALSENVLGKKLVLVDDSIVRGNTIGPIIKLLRDAGAKEVHVRVASPPLLYPCYMGINIPTREELIANKLDPLKLAKHVGADSLAYLSVEGLVQAVRYRIAEKNASKVGHCTACLTGNY 501          
BLAST of Amidophosphoribosyltransferase vs. TrEMBL
Match: A0A5N5LAI9 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00092250 PE=4 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 2.600e-38
Identity = 117/395 (29.62%), Postives = 188/395 (47.59%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLI-LQQATEE---KSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDS-PXXXXXXXXXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKS------NEIDFSDV------TSIRYLRLEVLSNIISKNIE----------GKEVGNIGHCFHCFGGSHAM 1589
            G   VA +G  +N ++L   ++     +   S  E++  L+ L    EE     W   IK++++  P  YS++IM K+ IY  RD YG +PL +G L  ++ +  +   GG+         V++S+S     I A Y R+V PGEI++IS +G+KSL I  R  GD  + C  EYV  + P+ + E Q+V  V  + G+ LA  +    D V ++P  +     G+A+ S LP  E            +  +  +  L V K      +N  GK++ L+ DS      ++  I LLK++G  E+H+R   PPI   C  GI++ +      N+ +F D+      TS+RYL +E L   +   IE           K +  +GHC  C  G + +
Sbjct:   78 GKIAVAHNGELVNAAALRKKVMRHGVGLSTSSDSELITQLLCLTPPMEEVDTPDWVARIKNLMTETPTSYSLLIMHKDVIYAVRDPYGNRPLCIGRLVPISKL--HSSGGGE---GDTEGWVVSSESCSFQSIGAKYYREVQPGEIVQISRHGVKSLNIIPRPEGDPPAFCIFEYVYFARPDSIFEGQMVYTVRQRCGRQLAIEAPTDADVVSTVPESATPAALGYAQVSGLPYVEVLCKNRYVGRTFIQPNTRLRQLGVAKKFGALTDNFAGKRVVLIDDSIVRGNTISPIIKLLKEAGATEVHIRVASPPIRFPCYMGINIPTKEELIANKPEFKDIANYIGATSVRYLSVEGLVTAVQSGIESYEKEQISSSSKAIRKLGHCTACLTGKYPI 467          
BLAST of Amidophosphoribosyltransferase vs. TrEMBL
Match: A0A5C6MS30 (Amidophosphoribosyltransferase OS=Takifugu flavidus OX=433684 GN=D4764_07G0003180 PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 3.707e-38
Identity = 114/392 (29.08%), Postives = 189/392 (48.21%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLI-LQQATEEKSWPG-----IIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDS-PXXXXXXXXXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKS------NEIDFSDVT------SIRYLRLEVLSNIISKNIEGKEVG-------NIGHCFHCFGGSH 1583
            G   VA +G  IN  +L   ++     +   S  E++  L+ L    EE+  P      +IK+++S  P  YS+++M ++ IY  RD YG +PL +G +  ++ +  Y    G+   +     V++S+S     I A Y R+VLPGEI+++S +G+KSL +  R  GDA + C  EYV  + P+ + E Q+V  V  + G+ LA  S    D V ++P  +     G+A+ S LP  E            +  +  +  L V K      +N  GK++ L+ DS      ++  I LLK++G  E+H+R   PPI   C  GI++ +      N  +F D+       S++YL +E L + + + I  K+          +GHC  C  G +
Sbjct:   49 GKIAVAHNGELINAQALRKRVMRHGVGLSTGSDSELITQLLALTPPMEEQDTPDWVARPVIKNLMSETPTSYSLLVMFRDVIYAVRDPYGNRPLCIGRIVPVSKL--YSSGSGE---QDTEGWVVSSESCSFQSIGAKYYREVLPGEIVQLSKHGVKSLSVVARPEGDAPAFCIFEYVYFARPDTIFEGQMVYTVRQRCGRQLAIESPTDADVVSTVPESATPAALGYAQQSGLPYIEVLCKNRYVGRTFIQPNTRLRQLGVAKKFGALSDNFAGKRVVLIDDSIVRGNTISPIIKLLKEAGATEVHIRVASPPIRFPCYMGINIPTKEELIANRPEFKDIAGYIGADSVKYLTIEGLVSAVQEGIATKQENKVIVSQKRVGHCTACLTGKY 435          
BLAST of Amidophosphoribosyltransferase vs. TrEMBL
Match: A0A2J7PC74 (Amidophosphoribosyltransferase OS=Cryptotermes secundus OX=105785 GN=Prat PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 4.926e-38
Identity = 114/383 (29.77%), Postives = 184/383 (48.04%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLILQQATEEK----SWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNEIDFSD------------VTSIRYLRLEVLSNIISKNIEGKEVGNIGHCFHCFGGSH 1583
            G+  VA +G  +N  SL   +L +   +   S  E++   +     E +     WP  IK ++   P  YS++IM K+RIYG RD YG +PL +G +  +  V   D   G+     +   V++S+S     I A Y R+V PGEI+E++ +G+K++GI  R      + C  EYV  +  + + E Q+V +V  + G+ LA  +    D V S+P    A  +GF++ SK+P  E            +  S  +  L V K      ENV GKK+ L+ DS +  +     I LL+ +G KE+H+R   PP++  C  GI++ + E   ++              S+ YL +E L   ++  I  K    +GHC  C  G++
Sbjct:  135 GALAVAHNGELVNCGSLRKMVLGRGVGLSTHSDSELITQALCLNPPEGEVNGPDWPARIKHLMQLAPLSYSLVIMQKDRIYGVRDPYGNRPLCIGKIVPLK-VTNGDGNEGEM----EEGWVISSESCGFLSIGARYKREVHPGEIVEMTKDGIKTIGIVERPNAKPQAFCIFEYVYFARSDSIFEGQMVYSVRMQCGRVLAREACINADIVSSVPESGTAAAHGFSKESKIPFAEVLCKNRYVGRTFIQPSTRLRQLGVAKKFGALSENVCGKKLILIDDSIVRGNTIGPIIKLLRDAGAKEVHVRVASPPLLYPCYMGINIPTREELIANKLDPVKLARHVGADSLAYLSVEGLVQAVTYGIAEKNASKVGHCTACLTGNY 512          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Cavefish
Match: ppat (phosphoribosyl pyrophosphate amidotransferase [Source:NCBI gene;Acc:103037559])

HSP 1 Score: 154.836 bits (390), Expect = 2.242e-40
Identity = 117/398 (29.40%), Postives = 187/398 (46.98%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLI-LQQATEEKS---WPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSV----IEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDS-PXXXXXXXXXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKS------NEIDFSDV------TSIRYLRLEVLSNIISKNIEG----KEVG-------NIGHCFHCFGGSH 1583
            G   VA +G  +N ++L   ++     +   S  E++  L+ L    EE     W   IK++++  P  YS+++M K+ IY  RD YG +PL +G L  ++ +     E D  G           V++S+S     I A Y R+V PGEI++IS +G+KSL +  R  GD  + C  EYV  + P+ + E Q+V  V  + G+ LA  +    D V ++P  +     G+A+ S LP  E            +  +  +  L V K      +N  GK++ L+ DS      ++  I LLK++G  E+H+R   PPI   C  GI++ +      N+ +F D+       S+RYL +E L   +   IEG    KE+         +GHC  C  G +
Sbjct:  115 GKIAVAHNGELVNAAALRKKVMRHGVGLSTSSDSELITQLLALTPPMEEDDTPDWVARIKNLMTETPTSYSLLVMHKDVIYAVRDPYGNRPLSIGRLVPISKLHSGSSEADTEGW----------VVSSESCSFQSIGAKYYREVQPGEIVQISKHGIKSLSVGPRPEGDPPAFCIFEYVYFARPDSIFEGQMVYTVRQRCGRQLAIEAPTEADVVSTVPESATPAALGYAQESGLPYVEVLCKNRYVGRTFIQPNTRLRQLGVAKKFGALTDNFAGKRVVLIDDSIVRGNTISPIIKLLKEAGAIEVHIRVASPPIRFPCYMGINIPTKEELIANKPEFEDIAGYIGAASVRYLTVEGLVAAVQSGIEGCGEKKEISPRTKTSKRVGHCTACLTGKY 502          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005777.1 (pep scaffold:Pmarinus_7.0:GL486334:3627:9666:-1 gene:ENSPMAG00000005213.1 transcript:ENSPMAT00000005777.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.487 bits (319), Expect = 9.036e-33
Identity = 93/342 (27.19%), Postives = 151/342 (44.15%), Query Frame = 3
Query:  690 IKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGIL------SDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDS-PXXXXXXXXXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNE------------IDFSDVTSIRYLRLEVLSNIISKNIEGKEVGN-----------IGHCFHCFGGSH 1583
            I++++      YS+++M  + IY  RD YG++PL LG L      S   + +E D  G           V++S+S     I A + ++V PGE++ I   G++SLG+  R   D  + C  EYV  + P+ + E Q+V  V ++ GQ LA  +    D V ++P  +     G+A+ S LP  E            +  +  +  L V K      EN  GK++ L+ DS      +   I LL++ G  E+H+R   PP+   C  GI++ + E                D  S+ YL +  L   + K I   + G+            GHC  C  G++
Sbjct:    2 IRNLMEETRAAYSLLVMHDDVIYAVRDPYGLRPLCLGQLVPASCMSSPGTNVEGDTEGW----------VVSSESCSFQSIGARFYQEVRPGEMVAIGRGGVRSLGVVPRPHADPPAFCIFEYVYFARPDSVFEGQMVYTVRHRCGQRLATEAPVAADLVSAVPESATPAALGYAQESGLPYVEVLCKNRYVGRTFIQPNTRLRQLGVAKKFGVLAENFAGKRVVLIDDSIVRGNTIAPIIKLLREGGASEVHVRVASPPVRHPCYMGINIPTREELIANKPQFNSLASHLDANSVEYLSVAGLQWAVQKGINADDRGHDGREGADGSAGSGHCTACLTGTY 333          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Yeast
Match: ADE4 (Phosphoribosylpyrophosphate amidotransferase (PRPPAT); catalyzes first step of the 'de novo' purine nucleotide biosynthetic pathway; also known as amidophosphoribosyltransferase [Source:SGD;Acc:S000004915])

HSP 1 Score: 53.5286 bits (127), Expect = 5.678e-8
Identity = 74/336 (22.02%), Postives = 129/336 (38.39%), Query Frame = 3
Query:  540 VAIDGTFINQSSLLNDMLCKNQIIRRR----SSEEILANLILQQATEEKSWPGIIKDILSTFPG-------GYSII-IMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDN---GLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLA------FGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------------YHMSVSAEMAMLNVYKENVIGKKIALVVDS-PXXXXXXXXXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDV 1439
            +A +G  +N +SL   M   ++ + R     S  E+L N+   +  +   +    +D+     G       GY+ + ++A   ++G RD  G++PL+ G   + +   +Y               +LAS+S++    N T  R + PGE + I  N   G         +      L   EYV  + P+ +L+   V +    +G  LA          D+ D V  +P  ++      A     P  E F                  VS+    LN  +    GKK+ +V DS          + + K+SG  +++     P I  N  +GID+
Sbjct:  102 LAHNGNLVNTASLKRYM---DEDVHRHINTDSDSELLLNIFAAELEKHNKYRVNNEDVFHALEGVYRLCRGGYACVGLLAGFALFGFRDPNGIRPLLFGERENPDGTKDY---------------MLASESVVFKAHNFTKYRDLKPGEAVIIPKNCSKGEPEFKQVVPINSYRPDL--FEYVYFARPDSVLDGISVYHTRLAMGSKLAENILKQLKPEDI-DVVIPVPDTARTCALECANVLGKPYREGFVKNRYVGRTFIMPNQRERVSSVRRKLNPMESEFKGKKVLIVDDSIVRGTTSKEIVNMAKESGATKVYFASAAPAIRYNHIYGIDL 416          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Nematostella
Match: EDO29937 (Amidophosphoribosyltransferase [Source:UniProtKB/TrEMBL;Acc:A7T274])

HSP 1 Score: 128.642 bits (322), Expect = 9.493e-32
Identity = 106/390 (27.18%), Postives = 178/390 (45.64%), Query Frame = 3
Query:  534 FVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLILQQAT----EEKSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSP-----NVLA----SDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAFYH--------MSVSAEMAMLNVYK------ENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKS------NEIDFSDVT------SIRYLRLEVLSNIISKNIEGKEVGNIGHCFHCFGGSH 1583
              VA +G  IN +SL N ML +   +   S  E++  L+  + +        W   IK ++      YS+ IM K+ ++  RD YG +PL +G+L    S + +++     +   +S      +VLA    S+S     I A    +V PGEI++++ +G KSL I      +  + C  EYV  +  + + E Q+V  V  + G+ LA  S    D V +IP  +    +GF++ + +P  E            +  S  +  L+V K      EN  GK++ L+ DS +  +     I LLK++G  E+H+R   PP+   C  GI++ +      N++D   +       S+ YL LE L   +   I+  +   +GHC  C  G +
Sbjct:  116 IAVAHNGELINATSLRNRMLHQGIGLSTGSDTEVITQLLTTRPSCGEPNGADWVARIKYLMKQTQCAYSLAIMNKDSVFVVRDPYGNRPLCIGMLKKSVSSLNHELKRFNSLTNIESKINEEDDVLAWVASSESCSFPSIGAVLMHEVAPGEIVQLTPSGPKSLAIVPPERDNYPAFCIFEYVYFARADSMFEGQMVYTVRQRCGKQLAIESPVEADVVSTIPESATPAAFGFSQQTGIPYVEVLTKNRYVGRTFIQPSNRLRQLSVNKKFGPLTENFRGKRVVLLDDSIVRGNTIGPIIKLLKQAGAAEVHVRIASPPLKHPCYMGINIPTREELVANKMDAEQLAWKVGADSLVYLSLEGLETAVQSGIQETKGRKVGHCTACLSGKY 505          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Medaka
Match: ppat (phosphoribosyl pyrophosphate amidotransferase [Source:NCBI gene;Acc:101154934])

HSP 1 Score: 149.828 bits (377), Expect = 9.877e-39
Identity = 114/394 (28.93%), Postives = 182/394 (46.19%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLI-LQQATEE---KSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGIL---SDMNS--VIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDS-PXXXXXXXXXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKS------NEIDFSDVT------SIRYLRLEVLSNIISKNIE------GKEVGNIGHCFHCFGGSH 1583
            G   VA +G  +N  +L   ++     +   S  E++  L+ L    EE     W   IK++++  P  YS++IM K+ IY  RD YG +PL +G L   S ++S    E D  G           V++S+S     I A Y R+VLPGEI+ IS  G+++L +  R  GD  + C  EYV  + P+ + E Q+V  V  + G+ LA  +    D V ++P  +     G+A+ + LP  E            +  +  +  L V K      +N  GK++ LV DS      ++  I LL+++G KE+H+R   PPI   C  GI++ +      N+  F D+       S+ YL +E L   + + +       G     +GHC  C  G +
Sbjct:  114 GRIAVAHNGELVNSRALRTKVMRHGVGLSTCSDSELITQLLALTPPMEELDSPDWVARIKNLMTETPTSYSLLIMFKDVIYAVRDPYGNRPLCIGQLVPVSKLHSSGAGEEDTEGW----------VVSSESCSFQSIGAKYHREVLPGEIVRISKRGIETLNVVPRPEGDPPAFCIFEYVYFARPDSIFEGQMVYTVRQRCGRQLAIEAPTDVDLVSTVPESATPAALGYAQQAGLPYMEVLCKNRYVGRTFIQPNTRLRQLGVAKKFGVLTDNFAGKRVVLVDDSIVRGNTISPIIKLLREAGAKEVHIRVASPPIRFPCYMGINIPTKEELIANKPQFKDIAGYLGADSVEYLTVEGLVTAVQEGVAAMQDQMGSRKSRVGHCTACLTGKY 497          
BLAST of Amidophosphoribosyltransferase vs. Ensembl Medaka
Match: ppat (phosphoribosyl pyrophosphate amidotransferase [Source:NCBI gene;Acc:101154934])

HSP 1 Score: 149.058 bits (375), Expect = 2.404e-38
Identity = 114/394 (28.93%), Postives = 182/394 (46.19%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLI-LQQATEE---KSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGIL---SDMNS--VIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAF--------YHMSVSAEMAMLNVYK------ENVIGKKIALVVDS-PXXXXXXXXXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKS------NEIDFSDVT------SIRYLRLEVLSNIISKNIE------GKEVGNIGHCFHCFGGSH 1583
            G   VA +G  +N  +L   ++     +   S  E++  L+ L    EE     W   IK++++  P  YS++IM K+ IY  RD YG +PL +G L   S ++S    E D  G           V++S+S     I A Y R+VLPGEI+ IS  G+++L +  R  GD  + C  EYV  + P+ + E Q+V  V  + G+ LA  +    D V ++P  +     G+A+ + LP  E            +  +  +  L V K      +N  GK++ LV DS      ++  I LL+++G KE+H+R   PPI   C  GI++ +      N+  F D+       S+ YL +E L   + + +       G     +GHC  C  G +
Sbjct:  115 GRIAVAHNGELVNSRALRTKVMRHGVGLSTCSDSELITQLLALTPPMEELDSPDWVARIKNLMTETPTSYSLLIMFKDVIYAVRDPYGNRPLCIGQLVPVSKLHSSGAGEEDTEGW----------VVSSESCSFQSIGAKYHREVLPGEIVRISKRGIETLNVVPRPEGDPPAFCIFEYVYFARPDSIFEGQMVYTVRQRCGRQLAIEAPTDVDLVSTVPESATPAALGYAQQAGLPYMEVLCKNRYVGRTFIQPNTRLRQLGVAKKFGVLTDNFAGKRVVLVDDSIVRGNTISPIIKLLREAGAKEVHIRVASPPIRFPCYMGINIPTKEELIANKPQFKDIAGYLGADSVEYLTVEGLVTAVQEGVAAMQDQMGSRKSRVGHCTACLTGKY 498          
BLAST of Amidophosphoribosyltransferase vs. Planmine SMEST
Match: SMESG000003663.1 (SMESG000003663.1)

HSP 1 Score: 524.242 bits (1349), Expect = 0.000e+0
Identity = 253/253 (100.00%), Postives = 253/253 (100.00%), Query Frame = 3
Query:  189 FHILILGGTPFYFPLFLVEFYRQFWFDICHNCSSQLNGNPFVRMNSIGKKCVLSARLPPSSQMKATIEQTLGKPFTVINSSDLMDWPDSDNRDCNMLIASDSKDLMDIYCPQLGSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLILQQATEEKSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPG 947
            FHILILGGTPFYFPLFLVEFYRQFWFDICHNCSSQLNGNPFVRMNSIGKKCVLSARLPPSSQMKATIEQTLGKPFTVINSSDLMDWPDSDNRDCNMLIASDSKDLMDIYCPQLGSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLILQQATEEKSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPG
Sbjct:    8 FHILILGGTPFYFPLFLVEFYRQFWFDICHNCSSQLNGNPFVRMNSIGKKCVLSARLPPSSQMKATIEQTLGKPFTVINSSDLMDWPDSDNRDCNMLIASDSKDLMDIYCPQLGSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLILQQATEEKSWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPG 260          
BLAST of Amidophosphoribosyltransferase vs. Planmine SMEST
Match: SMESG000003648.1 (SMESG000003648.1)

HSP 1 Score: 295.049 bits (754), Expect = 7.697e-98
Identity = 145/149 (97.32%), Postives = 146/149 (97.99%), Query Frame = 3
Query:  738 MAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFV 1184
            MAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDF+C IPSLS  FV
Sbjct:    1 MAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFICLIPSLSHTFV 149          
BLAST of Amidophosphoribosyltransferase vs. Planmine SMEST
Match: SMESG000003647.1 (SMESG000003647.1)

HSP 1 Score: 221.861 bits (564), Expect = 5.691e-70
Identity = 121/122 (99.18%), Postives = 121/122 (99.18%), Query Frame = 3
Query: 1236 MSVSAEMAMLNVYKENVIGKKIALVVDSPXXXXXXXXXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNEIDFSDVTSIRYLRLEVLSNIISKNIEGKEVGNIGHCFHCFGGSHAMLKSA 1601
            MSVSAEMAMLNVYKENVIGK IALVVDSPLNRDLNLAILLLKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNEIDFSDVTSIRYLRLEVLSNIISKNIEGKEVGNIGHCFHCFGGSHAMLKSA
Sbjct:    1 MSVSAEMAMLNVYKENVIGKTIALVVDSPLNRDLNLAILLLKKSGVKEIHLRFCCPPIVTNCPFGIDVKSNEIDFSDVTSIRYLRLEVLSNIISKNIEGKEVGNIGHCFHCFGGSHAMLKSA 122          
BLAST of Amidophosphoribosyltransferase vs. Planmine SMEST
Match: SMESG000000843.1 (SMESG000000843.1)

HSP 1 Score: 142.124 bits (357), Expect = 2.087e-36
Identity = 105/354 (29.66%), Postives = 169/354 (47.74%), Query Frame = 3
Query:  528 GSFVVAIDGTFINQSSLLNDMLCKNQIIRRRSSEEILANLILQQATEEK----SWPGIIKDILSTFPGGYSIIIMAKNRIYGARDCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKINATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEMLLEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPINEAFY--------------HMSVSAEMAMLNVYKENVIGKKIALVVDSPXXXXXXX-XXXXXKKSGVKEIHLRFCCPPIVTNCPFGIDVKS-NEIDFSDVTSIRYLRLEVLSNIISKNIE 1529
            G F VA +G  +N S L   +L +   +   +  E++  ++ Q     +    +WP  I+ ++      YS++I++ ++IY  RD YG +PL LG L + N      +       K     V++S+S +   I A  +R+VLPGEI+E+  NG KS GI  R  G+  + C  EY+  S P+  LE Q V  V ++ G+ LA  SS   D V  +P  + A   GF++ S +   E                 H+     +      +EN  GK++ L+ DS +  +     +  LKK G KE+HLR   PPI   C  GI++ + +E+ F+ V S         ++I++KN E
Sbjct:  110 GQFAVAHNGELVNGSILKKKILQQGIGLSSGTDSEVITQILCQTPKCGEPYGVNWPSRIQHLMLQTQLAYSLVILSNDKIYAVRDPYGNRPLCLGYLCNQNRKSTASLSEENDFTK-HVGYVISSESCVFGSIGAELNREVLPGEIVEVDRNGFKSCGIVPRNQGNP-AFCIFEYIYFSRPDSFLEGQQVNAVRFRCGEQLARESSIEADVVSGVPESATAAALGFSKQSGIDYMEVLTRNRYVGRTFIQPSKHLRKIGVIKKFGFLQENFSGKRVILIDDSIVRGNTIAPLVSELKKFGAKEVHLRIASPPIKHPCYMGINIPTEDELIFNTVGS---------ADILAKNSE 452          
The following BLAST results are available for this feature:
BLAST of Amidophosphoribosyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PPAT3.792e-3628.36phosphoribosyl pyrophosphate amidotransferase [Sou... [more]
back to top
BLAST of Amidophosphoribosyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ppat-15.837e-2323.33Amidophosphoribosyltransferase [Source:UniProtKB/... [more]
back to top
BLAST of Amidophosphoribosyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Prat24.081e-3528.13gene:FBgn0041194 transcript:FBtr0076946[more]
Prat29.123e-3528.13gene:FBgn0041194 transcript:FBtr0076945[more]
Prat3.180e-3327.44gene:FBgn0004901 transcript:FBtr0304705[more]
Prat3.180e-3327.44gene:FBgn0004901 transcript:FBtr0081764[more]
back to top
BLAST of Amidophosphoribosyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ppat2.806e-4030.40phosphoribosyl pyrophosphate amidotransferase [Sou... [more]
ppat2.908e-730.97phosphoribosyl pyrophosphate amidotransferase [Sou... [more]
back to top
BLAST of Amidophosphoribosyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ppat6.696e-3627.20phosphoribosyl pyrophosphate amidotransferase [Sou... [more]
ppat1.192e-3527.07phosphoribosyl pyrophosphate amidotransferase [Sou... [more]
ppat1.423e-3226.70phosphoribosyl pyrophosphate amidotransferase [Sou... [more]
back to top
BLAST of Amidophosphoribosyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ppat7.661e-3928.86phosphoribosyl pyrophosphate amidotransferase [Sou... [more]
back to top
BLAST of Amidophosphoribosyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35433|PUR1_RAT5.133e-3727.90Amidophosphoribosyltransferase OS=Rattus norvegicu... [more]
sp|Q06203|PUR1_HUMAN1.821e-3528.36Amidophosphoribosyltransferase OS=Homo sapiens OX=... [more]
sp|P28173|PUR1_CHICK2.880e-3527.82Amidophosphoribosyltransferase OS=Gallus gallus OX... [more]
sp|Q27601|PUR1_DROME3.188e-3227.44Amidophosphoribosyltransferase OS=Drosophila melan... [more]
sp|Q55038|PUR1_SYNE78.633e-3125.40Amidophosphoribosyltransferase OS=Synechococcus el... [more]
back to top
BLAST of Amidophosphoribosyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1D2NFC01.846e-4030.65Amidophosphoribosyltransferase OS=Orchesella cinct... [more]
A0A067QL934.680e-3929.77Amidophosphoribosyltransferase OS=Zootermopsis nev... [more]
A0A5N5LAI92.600e-3829.62Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A5C6MS303.707e-3829.08Amidophosphoribosyltransferase OS=Takifugu flavidu... [more]
A0A2J7PC744.926e-3829.77Amidophosphoribosyltransferase OS=Cryptotermes sec... [more]
back to top
BLAST of Amidophosphoribosyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ppat2.242e-4029.40phosphoribosyl pyrophosphate amidotransferase [Sou... [more]
back to top
BLAST of Amidophosphoribosyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005777.19.036e-3327.19pep scaffold:Pmarinus_7.0:GL486334:3627:9666:-1 ge... [more]
back to top
BLAST of Amidophosphoribosyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ADE45.678e-822.02Phosphoribosylpyrophosphate amidotransferase (PRPP... [more]
back to top
BLAST of Amidophosphoribosyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO299379.493e-3227.18Amidophosphoribosyltransferase [Source:UniProtKB/... [more]
back to top
BLAST of Amidophosphoribosyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ppat9.877e-3928.93phosphoribosyl pyrophosphate amidotransferase [Sou... [more]
ppat2.404e-3828.93phosphoribosyl pyrophosphate amidotransferase [Sou... [more]
back to top
BLAST of Amidophosphoribosyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000003663.10.000e+0100.00SMESG000003663.1[more]
SMESG000003648.17.697e-9897.32SMESG000003648.1[more]
SMESG000003647.15.691e-7099.18SMESG000003647.1[more]
SMESG000000843.12.087e-3629.66SMESG000000843.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030613 ID=SMED30030613|Name=Amidophosphoribosyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1790bp
CTTCCGATCTGTAAATATTTTAATAAAAATTTAACGTGATAAAATCACAT
TTTTTATTTAATTATATTTGATTAGGTAATTAAATATTAATATCAGTTTT
TAATAAATAAATTTAATTATTTCTTACCTTTAACTTAAATATTGTTTCCC
ATTCCAGCTAATGATAAAATGATTGAAATTTGTAAAGGTTTCATATTTTA
ATTTTGGGGGGGACGCCATTTTATTTCCCATTGTTTCTGGTTGAATTCTA
TCGGCAGTTTTGGTTTGATATTTGTCACAATTGCTCATCACAACTTAATG
GGAATCCATTTGTCAGAATGAATTCTATCGGAAAGAAGTGCGTGTTGAGC
GCCAGGCTGCCCCCGTCCAGTCAAATGAAGGCGACGATCGAGCAAACCCT
TGGAAAACCGTTTACGGTGATAAATTCCTCGGATTTAATGGACTGGCCTG
ATAGTGATAATCGAGATTGCAATATGCTGATAGCGAGTGACAGCAAGGAT
TTGATGGATATTTATTGCCCACAGCTTGGTAGCTTTGTGGTGGCCATTGA
CGGCACGTTCATCAATCAGTCCAGTCTCCTGAATGACATGCTCTGCAAGA
ATCAGATCATCAGGAGGAGGTCCAGTGAAGAAATTTTAGCAAATTTGATA
CTGCAACAAGCAACCGAGGAAAAATCTTGGCCTGGCATCATAAAAGATAT
TTTAAGCACTTTTCCCGGGGGATACAGCATCATTATTATGGCCAAGAATC
GTATATATGGGGCCAGAGATTGTTATGGAGTGAAGCCCCTTGTGTTGGGA
ATTCTCAGTGACATGAACTCTGTGATTGAGTATGATGTCATTGGTGGAAA
ACCAGTCGTCAAGCCTAAGTCTCCAAATGTTCTTGCTTCCGATAGTTTAA
TATTGAATAAAATCAACGCCACTTACAGCCGGCAAGTGCTTCCTGGGGAA
ATTATTGAAATTTCTGACAATGGACTCAAATCGCTCGGCATTTGTTATAG
ACTAACAGGAGATGCTACGTCTCTCTGTTCGATGGAGTACGTGTCATTGT
CTCTGCCAGAGATGCTGCTCGAGGATCAGATAGTTCAAAACGTCCATTAT
AAATTAGGCCAATCATTGGCATTTGGTTCATCAGATGTTCCGGATTTCGT
TTGCTCAATACCTAGCCTATCTCAAGCATTTGTTTATGGTTTTGCTGAGG
CCAGTAAGCTCCCGATAAACGAGGCTTTCTACCACATGTCAGTCTCGGCT
GAAATGGCCATGTTGAATGTGTATAAGGAAAACGTCATCGGTAAGAAAAT
TGCGCTGGTTGTCGACAGTCCGTTGAATCGTGACCTGAATTTGGCGATAT
TATTGCTTAAGAAATCCGGAGTGAAAGAGATTCATTTGAGATTTTGTTGC
CCGCCGATCGTCACAAACTGCCCGTTTGGTATAGATGTCAAGTCTAATGA
GATTGACTTCTCTGATGTGACAAGCATTCGGTATCTCAGACTGGAGGTGT
TATCAAATATCATTTCTAAGAACATCGAAGGAAAAGAAGTAGGAAATATT
GGACATTGTTTTCATTGTTTTGGGGGGTCTCATGCCATGCTGAAATCCGC
ATAAAGGGACTTATAAAGAAAAAAACAAGCATAATACTTTTGTTTGCTAT
TTACCGCCTTGTTAACGTTTGCCTTGTTATTTTTATTGGTAATATTTTGT
TTTAATTGATACGTTTTCTTGCCTGTCGAATACCTGCACGCGCCTTGTCA
GACAACTTATAGTTTAGTATTTCAATTTCTTTTTTATTCT
back to top

protein sequence of SMED30030613-orf-1

>SMED30030613-orf-1 ID=SMED30030613-orf-1|Name=SMED30030613-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=429bp
MNSIGKKCVLSARLPPSSQMKATIEQTLGKPFTVINSSDLMDWPDSDNRD
CNMLIASDSKDLMDIYCPQLGSFVVAIDGTFINQSSLLNDMLCKNQIIRR
RSSEEILANLILQQATEEKSWPGIIKDILSTFPGGYSIIIMAKNRIYGAR
DCYGVKPLVLGILSDMNSVIEYDVIGGKPVVKPKSPNVLASDSLILNKIN
ATYSRQVLPGEIIEISDNGLKSLGICYRLTGDATSLCSMEYVSLSLPEML
LEDQIVQNVHYKLGQSLAFGSSDVPDFVCSIPSLSQAFVYGFAEASKLPI
NEAFYHMSVSAEMAMLNVYKENVIGKKIALVVDSPLNRDLNLAILLLKKS
GVKEIHLRFCCPPIVTNCPFGIDVKSNEIDFSDVTSIRYLRLEVLSNIIS
KNIEGKEVGNIGHCFHCFGGSHAMLKSA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006189'de novo' IMP biosynthetic process
GO:0006164purine nucleotide biosynthetic process
GO:0009113purine nucleobase biosynthetic process
GO:0009116nucleoside metabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR029055Ntn_hydrolases_N
IPR017932GATase_2_dom
IPR029057PRTase-like
Vocabulary: molecular function
TermDefinition
GO:0004044amidophosphoribosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0046872metal ion binding
GO:0051536iron-sulfur cluster binding