Opsin

Overview
NameOpsin
Smed IDSMED30030594
Uniprot Best hitRhodopsin OS=Enteroctopus dofleini OX=267067 GN=RHO PE=2 SV=1 (E=5.56764e-99)
Length (bp)1880
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Opsin (SMED30030594) t-SNE clustered cells

Violin plots show distribution of expression levels for Opsin (SMED30030594) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Opsin (SMED30030594) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Opsin (SMED30030594) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Opsin ( opsin ) is expressed during Stage 7 and Stage 8 in the visual system, eye and photoreceptor neuron

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30030594

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30030594SMESG000074489.1 dd_Smed_v4_15036_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
neuronSMED30030594SMESG000074489.1 dd_Smed_v4_15036_0_1dd_Smed_v4PMID:29674431whole organismasexual adultfluorescence in situ hybridization evidence
reproductive organSMED30030594SMESG000074489.1 Contig54601newmark_estsPMID:28434803whole organismadult hermaphroditeRNA-sequencing evidence
reproductive organSMED30030594SMESG000074489.1 Contig54601uc_Smed_v2PMID:28434803whole organismadult hermaphroditeRNA-sequencing evidence
headSMED30030594SMESG000074489.1 SmedASXL_005730SmedAsxl_ww_GCZZ01PMID:27034770whole organismasexual adultRNA-sequencing evidence
eyeSMED30030594SMESG000074489.1 SmedASXL_005730SmedAsxl_ww_GCZZ01PMID:29158443whole organismasexual adultcolorimetric in situ hybridization evidence
photoreceptor neuronSMED30030594SMESG000074489.1 SMED30030594smed_20140614PMID:18287199whole organismasexual adultcolorimetric in situ hybridization evidence
photoreceptor neuronSMED30030594SMESG000074489.1 SMED30030594smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
photoreceptor neuronSMED30030594SMESG000074489.1 SMED30030594smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
photoreceptor neuronSMED30030594SMESG000074489.1 SMED30030594smed_20140614PMID:28976975whole organismasexual adultfluorescence in situ hybridization evidence
headSMED30030594SMESG000074489.1 dd_Smed_v6_15036_0_1dd_Smed_v6PMID:28171748whole organismasexual adultRNA-sequencing evidence
eyeSMED30030594SMESG000074489.1 AF112361smed_ncbi_20200123PMID:30485821whole organismasexual adultfluorescence in situ hybridization evidence
headSMED30030594SMESG000074489.1 OX_Smed_1.0.12568ox_Smed_v2PMID:24238224whole organismasexual adultRNA-sequencing evidence
photoreceptor neuronSMED30030594SMESG000074489.1 opsinsmed_ncbi_20200123PMID:22451003whole organismasexual adultcolorimetric in situ hybridization evidence
photoreceptor neuronSMED30030594SMESG000074489.1 opsinsmed_ncbi_20200123PMID:21852957whole organismasexual adultfluorescence in situ hybridization evidence
photoreceptor neuronSMED30030594SMESG000074489.1 opsinsmed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
photoreceptor neuronSMED30030594SMESG000074489.1 opsinsmed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
Homology
BLAST of Opsin vs. Ensembl Human
Match: OPN4 (opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449])

HSP 1 Score: 201.445 bits (511), Expect = 4.578e-57
Identity = 122/302 (40.40%), Postives = 184/302 (60.93%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAK---KADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY +G  I +VG++G+LGNL V+Y F  ++SLRTP NMFI++LA+ D   S     P+   SS   +W +G+  CE Y F G LFG  S+ T+  I+LDRY VI +P  T    + +RA  +L+ VWLY+L WS PPFFG+  YVPEG  TSC++DY++ +     + + +    F +P+ III+CY  I +A+R    E  +  Q   A          +   +++ + AKI ++++ L++LSW PY+ +AL+A  G    L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIR----ETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 361          
BLAST of Opsin vs. Ensembl Human
Match: OPN4 (opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449])

HSP 1 Score: 194.512 bits (493), Expect = 2.234e-54
Identity = 123/313 (39.30%), Postives = 184/313 (58.79%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASA-----------KSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAK---KADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY +G  I +VG++G+LGNL V+Y F  A           +SLRTP NMFI++LA+ D   S     P+   SS   +W +G+  CE Y F G LFG  S+ T+  I+LDRY VI +P  T    + +RA  +L+ VWLY+L WS PPFFG+  YVPEG  TSC++DY++ +     + + +    F +P+ III+CY  I +A+R    E  +  Q   A          +   +++ + AKI ++++ L++LSW PY+ +AL+A  G    L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRAVLRGVTVMMQSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIR----ETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 372          
BLAST of Opsin vs. Ensembl Human
Match: OPN4 (opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449])

HSP 1 Score: 194.512 bits (493), Expect = 2.242e-54
Identity = 123/313 (39.30%), Postives = 184/313 (58.79%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASA-----------KSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAK---KADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY +G  I +VG++G+LGNL V+Y F  A           +SLRTP NMFI++LA+ D   S     P+   SS   +W +G+  CE Y F G LFG  S+ T+  I+LDRY VI +P  T    + +RA  +L+ VWLY+L WS PPFFG+  YVPEG  TSC++DY++ +     + + +    F +P+ III+CY  I +A+R    E  +  Q   A          +   +++ + AKI ++++ L++LSW PY+ +AL+A  G    L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRAVLRGVTVMMQSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIR----ETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 372          
BLAST of Opsin vs. Ensembl Human
Match: OPN5 (opsin 5 [Source:HGNC Symbol;Acc:HGNC:19992])

HSP 1 Score: 141.354 bits (355), Expect = 1.879e-36
Identity = 101/290 (34.83%), Postives = 155/290 (53.45%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKF 1557
            + G Y++I+GI    GN  VLY+ +  K    P  +  ++LA+ DL  S V G P   IS F  RW +G + C  YG+ G  FG  S+ TM  +SLDRY  I         L  K A I L  +W Y+  W+T P  G G+YVPE F TSCT D+ L Q S G  +F + +     ++P  +I+F Y +I+  V+    E+     ++++SH   MK           K++++I   ++++W PYA++++ +  GR D +    + +P L AK++AMYNP IY +   KF
Sbjct:   35 VAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKL---------TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKF 313          
BLAST of Opsin vs. Ensembl Human
Match: OPN5 (opsin 5 [Source:HGNC Symbol;Acc:HGNC:19992])

HSP 1 Score: 141.354 bits (355), Expect = 1.879e-36
Identity = 101/290 (34.83%), Postives = 155/290 (53.45%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKF 1557
            + G Y++I+GI    GN  VLY+ +  K    P  +  ++LA+ DL  S V G P   IS F  RW +G + C  YG+ G  FG  S+ TM  +SLDRY  I         L  K A I L  +W Y+  W+T P  G G+YVPE F TSCT D+ L Q S G  +F + +     ++P  +I+F Y +I+  V+    E+     ++++SH   MK           K++++I   ++++W PYA++++ +  GR D +    + +P L AK++AMYNP IY +   KF
Sbjct:   35 VAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKL---------TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKF 313          
BLAST of Opsin vs. Ensembl Celegans
Match: gar-2 (Muscarinic acetylcholine receptor gar-2 [Source:UniProtKB/Swiss-Prot;Acc:Q09388])

HSP 1 Score: 82.8037 bits (203), Expect = 1.536e-17
Identity = 61/210 (29.05%), Postives = 109/210 (51.90%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSF-NTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGF---QTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKM 1311
            L+ +++  + I  V+GNL VL  +   K++R P N FI SLAI DL    + G P+ T     N  W WG + C+++  I  +    SI T+  I++DRY+ + +P       T  R +++++F+WL   I  +   FGYG +   G    +T C   ++T    N   N+GMYI  +   + ++++ Y+ I +A +   L+  +  +++
Sbjct:    7 LLALFMLFLSIVTVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLI-GLEGIPVYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTPGRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMT----NPYLNMGMYISYYWTTLFVMLYLYWGIYRAAKKLALKSDQKTKRL 211          
BLAST of Opsin vs. Ensembl Celegans
Match: gar-2 (Muscarinic acetylcholine receptor gar-2 [Source:UniProtKB/Swiss-Prot;Acc:Q09388])

HSP 1 Score: 83.9593 bits (206), Expect = 1.211e-16
Identity = 61/210 (29.05%), Postives = 109/210 (51.90%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSF-NTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGF---QTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKM 1311
            L+ +++  + I  V+GNL VL  +   K++R P N FI SLAI DL    + G P+ T     N  W WG + C+++  I  +    SI T+  I++DRY+ + +P       T  R +++++F+WL   I  +   FGYG +   G    +T C   ++T    N   N+GMYI  +   + ++++ Y+ I +A +   L+  +  +++
Sbjct:    7 LLALFMLFLSIVTVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLI-GLEGIPVYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTPGRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMT----NPYLNMGMYISYYWTTLFVMLYLYWGIYRAAKKLALKSDQKTKRL 211          
BLAST of Opsin vs. Ensembl Celegans
Match: gar-2 (Muscarinic acetylcholine receptor gar-2 [Source:UniProtKB/Swiss-Prot;Acc:Q09388])

HSP 1 Score: 83.5741 bits (205), Expect = 1.390e-16
Identity = 61/210 (29.05%), Postives = 109/210 (51.90%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSF-NTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGF---QTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKM 1311
            L+ +++  + I  V+GNL VL  +   K++R P N FI SLAI DL    + G P+ T     N  W WG + C+++  I  +    SI T+  I++DRY+ + +P       T  R +++++F+WL   I  +   FGYG +   G    +T C   ++T    N   N+GMYI  +   + ++++ Y+ I +A +   L+  +  +++
Sbjct:    7 LLALFMLFLSIVTVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLI-GLEGIPVYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTPGRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMT----NPYLNMGMYISYYWTTLFVMLYLYWGIYRAAKKLALKSDQKTKRL 211          
BLAST of Opsin vs. Ensembl Celegans
Match: gar-2 (Muscarinic acetylcholine receptor gar-2 [Source:UniProtKB/Swiss-Prot;Acc:Q09388])

HSP 1 Score: 83.5741 bits (205), Expect = 1.620e-16
Identity = 56/174 (32.18%), Postives = 90/174 (51.72%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSF-NTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGF---QTSCTFDYLTQSKGNIIFNIGMY 1203
            L+ +++  + I  V+GNL VL  +   K++R P N FI SLAI DL    + G P+ T     N  W WG + C+++  I  +    SI T+  I++DRY+ + +P       T  R +++++F+WL   I  +   FGYG +   G    +T C   ++T    N   N+GMY
Sbjct:    7 LLALFMLFLSIVTVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLI-GLEGIPVYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTPGRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMT----NPYLNMGMY 175          
BLAST of Opsin vs. Ensembl Celegans
Match: dop-2 (D2-like dopamine receptor long variant; DOPamine receptor [Source:UniProtKB/TrEMBL;Acc:G5EBI6])

HSP 1 Score: 68.9366 bits (167), Expect = 6.061e-12
Identity = 63/227 (27.75%), Postives = 112/227 (49.34%), Query Frame = 1
Query:  700 GVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQ-TMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMK--TGAKKADVQAA 1371
            G+ + ++ +  +LGNLLV+      ++L++  N  I+ LA+ DL  + +     + +   N  W  G L C+IY          SI  +A+IS DRY  ++ P Q + +S  +KR   ++  +WL SL  ++P  FG     P+     C F        N  F+I   + +F+IP  +++F Y +I+ A++  E       +K   +H  +M+  TG ++ D +AA
Sbjct:   41 GLSLIVIPLITLLGNLLVIISVLRYRALQSAINFLILGLAVADLLVAIIVMPYAVYVYVTNGDWYLGNLMCDIYMASDVCCSTASILLLAVISFDRYRAVSLPIQYSRQSQNVKRVWTLIAVIWLVSLTLASPMVFGVNVRPPDANPYECRF-------YNAEFSILSSMISFVIPCFLVLFVYIRIIIALKKREKAAKMRREKNTIAHGLTMRPDTGEEQVDEEAA 260          
BLAST of Opsin vs. Ensembl Fly
Match: Rh5 (gene:FBgn0014019 transcript:FBtr0342591)

HSP 1 Score: 188.734 bits (478), Expect = 9.931e-54
Identity = 116/319 (36.36%), Postives = 195/319 (61.13%), Query Frame = 1
Query:  628 EFESIVHPYWRTFDMVPEVYHYLVGVYIS--IVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFG-YGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1572
            E++ +VH +WR F   P  YH   G YI+  ++ +S + GN LV++IF+++KSLRTP N+ I++LAI DL F   N  P   I++       G L C+IY   GG+ G  +  T A I+ DRY  I+ P      L+  + +++++F WL++  +S  P F  +G Y PEGF T+C+FDYLT +  N +F   +++ +++IP+ +I+  YY++   VRVHE  + + A+KMN  S   +        +++ AK ++II  L++L+WTPY+++AL+   G +  + P+ + LP L  K+ +  +P++YA +HPK+R++LE
Sbjct:   32 EYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPID--GRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELE 344          
BLAST of Opsin vs. Ensembl Fly
Match: Rh5 (gene:FBgn0014019 transcript:FBtr0080291)

HSP 1 Score: 188.734 bits (478), Expect = 9.931e-54
Identity = 116/319 (36.36%), Postives = 195/319 (61.13%), Query Frame = 1
Query:  628 EFESIVHPYWRTFDMVPEVYHYLVGVYIS--IVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFG-YGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1572
            E++ +VH +WR F   P  YH   G YI+  ++ +S + GN LV++IF+++KSLRTP N+ I++LAI DL F   N  P   I++       G L C+IY   GG+ G  +  T A I+ DRY  I+ P      L+  + +++++F WL++  +S  P F  +G Y PEGF T+C+FDYLT +  N +F   +++ +++IP+ +I+  YY++   VRVHE  + + A+KMN  S   +        +++ AK ++II  L++L+WTPY+++AL+   G +  + P+ + LP L  K+ +  +P++YA +HPK+R++LE
Sbjct:   32 EYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPID--GRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELE 344          
BLAST of Opsin vs. Ensembl Fly
Match: ninaE (gene:FBgn0002940 transcript:FBtr0083857)

HSP 1 Score: 188.348 bits (477), Expect = 1.146e-53
Identity = 127/378 (33.60%), Postives = 204/378 (53.97%), Query Frame = 1
Query:  535 VQSFANLGNKLLEN-ATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGN----IIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATK 1653
            ++SFA    +L  + A  +N S+   V    P+   ++ PYW  F  +  ++  ++  Y+ ++G+    GN +V+YIFA+ KSLRTP N+ +++LAI D      N  P++ I+ +   W  G + C+IY  +G  FG  SI +M +ISLDRY VI +     + +TI  A+  + ++W  S IW   P FG+  YVPEG  TSC  DYL +        I ++I +Y     +        Y+ I+ AV  HE  M + A+KMN     S +   K A+ + AK++++ + L+ ++WTPY +I  M L  + + L P        FAK++A YNP +Y I+HPK+R+ L++K PC +       K  D  S A+A++
Sbjct:    1 MESFAVAAAQLGPHFAPLSNGSVVDKV---TPDMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNT-PMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAG-RPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYS----YWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAWTPYLVINCMGLF-KFEGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATASE 368          
BLAST of Opsin vs. Ensembl Fly
Match: Rh3 (gene:FBgn0003249 transcript:FBtr0083876)

HSP 1 Score: 184.882 bits (468), Expect = 3.383e-52
Identity = 117/345 (33.91%), Postives = 195/345 (56.52%), Query Frame = 1
Query:  544 FANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFF-GYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1572
            F N+   L   A  + E+     W+  PE    +  +W T+   PE  +YL+G       +  +LGN LV+++F++AKSLRTP N+ +++LA  D  F  +   P+   +SF+  +A G L C+I+G IG   G  +  T A I+ DR+ VI +P +    +T  +AI M++F+++Y+  W    +   +G +VPEG+ TSCTFDYLT +    +F   ++  +F+ P  +I + Y QIV  V  HE  +   A+KMN  S  +++    + A+++ AK ++ I FL+  SWTPY +++L+   G +  L P    +P    K  A  +PF+YAI+HP++R++L+
Sbjct:   11 FGNVSTALRPEARLSAETRLLG-WNVPPEELRHIPEHWLTYPEPPESMNYLLGTLYIFFTLMSMLGNGLVIWVFSAAKSLRTPSNILVINLAFCD--FMMMVKTPIFIYNSFHQGYALGHLGCQIFGIIGSYTGIAAGATNAFIAYDRFNVITRPME--GKMTHGKAIAMIIFIYMYATPWVVACYTETWGRFVPEGYLTSCTFDYLTDNFDTRLFVACIFFFSFVCPTTMITYYYSQIVGHVFSHEKALRDQAKKMNVESLRSNVDKNKETAEIRIAKAAITICFLFFCSWTPYGVMSLIGAFGDKTLLTPGATMIPACACKMVACIDPFVYAISHPRYRMELQ 350          
BLAST of Opsin vs. Ensembl Fly
Match: Rh2 (gene:FBgn0003248 transcript:FBtr0083697)

HSP 1 Score: 181.8 bits (460), Expect = 3.593e-51
Identity = 112/316 (35.44%), Postives = 180/316 (56.96%), Query Frame = 1
Query:  625 PEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1572
            P+   +V+PYW  F  +  +   ++G++   + I    GN +V+YIF   KSLRTP N+ +++LA  D    A    P++ I+ +   W  G L C+IY   G LFG +SI +M +I+ DRY VI +       +TIK +I+ ++F+W+ ++ W+  P  G+  YVPEG  T+C+ DY+T+      + I   +  +  P+ +I + Y+ I+ AV  HE  M + A+KMN     S +   K A+ + AK+++  + L+ ++WTPY +I    L  + D L P T      FAKTSA+YNP +Y I+HPK+RI L+
Sbjct:   36 PDMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQS-PVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGING-TPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGLF-KIDGLTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVLK 348          
BLAST of Opsin vs. Ensembl Zebrafish
Match: opn4b (opsin 4b [Source:ZFIN;Acc:ZDB-GENE-080415-3])

HSP 1 Score: 229.18 bits (583), Expect = 1.069e-66
Identity = 143/374 (38.24%), Postives = 225/374 (60.16%), Query Frame = 1
Query:  634 ESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNAS---HPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQT 1746
            + + HP+  T D VP+  HY +G  I  VGI+G++GNLLV+Y F  ++SLRTP NMFI++LA+ D     V   P+   +S + RW +G+  CE+Y F G LFG  S+ T+ +I++DRYFVI +P  ++  ++ KRA+++L   W YS+ WS PPFFG+  YVPEG  TSC++DY+T S     + + ++   F IP+ +II+CY+ I KA+R    E  +   K+N       +  K    K + + AKI++I++ LY++SW+PY+ +AL A  G  D L PY   +P + AK SA++NP IYAI HPK+R  + K  PCL        ++R ++S+  +T+ S   S+   + S L      ++   + +++
Sbjct:   52 QDVRHPF-PTVD-VPDHAHYTIGSVILAVGITGMVGNLLVMYAFCKSRSLRTPANMFIINLAVTDFLM-CVTQTPIFFTTSLHKRWIFGEKGCELYAFCGALFGICSMITLMIIAVDRYFVITRPLASIGVMSRKRALLILSAAWAYSMGWSLPPFFGWSAYVPEGLLTSCSWDYMTFSPSVRAYTMLLFTFVFFIPLFVIIYCYFFIFKAIR----ETNRAVGKINGEGGPRDSIKKIHRMKNEWKMAKIALIVILLYVISWSPYSCVALTAFAGYADMLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRSAIAKYIPCLGVLLCVPRRDRFSSSSFISTRRSTLTSQSSETSSNLHRAGKARLSSVSDSES 418          
BLAST of Opsin vs. Ensembl Zebrafish
Match: opn4a (opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624])

HSP 1 Score: 227.639 bits (579), Expect = 7.729e-66
Identity = 133/314 (42.36%), Postives = 205/314 (65.29%), Query Frame = 1
Query:  634 ESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHP-TSMKTGAK-KADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            E  V+P+  T D VP+  HY +G  I  VGI+G+LGN LV+Y F+ +++LRTP N+FI++LAI D    A    P+   +S + RW +G+  CE+Y F G LFG  S+ T+ +I++DRYFVI +P  ++  L+ KRA+++L+  W+YSL WS PPFFG+  YVPEG  TSCT+DY+T +     + + ++I  F IP+ +II+CY+ I +++R       +   K+N  +   SMK   + K + + AKI++I++ +Y++SW+PY+ +AL A  G  D L PY   +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   60 EESVYPF-PTVD-VPDHAHYTIGAVILTVGITGMLGNFLVIYAFSRSRTLRTPANLFIINLAITDFLMCATQA-PIFFTTSMHKRWIFGEKGCELYAFCGALFGICSMITLMVIAVDRYFVITRPLASIGVLSQKRALLILLVAWVYSLGWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFIFVFFIPLIVIIYCYFFIFRSIRTTN----EAVGKINGDNKRDSMKRFQRLKNEWKMAKIALIVILMYVISWSPYSTVALTAFAGYSDFLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRLAI 366          
BLAST of Opsin vs. Ensembl Zebrafish
Match: opn4a (opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624])

HSP 1 Score: 227.254 bits (578), Expect = 8.222e-66
Identity = 133/314 (42.36%), Postives = 205/314 (65.29%), Query Frame = 1
Query:  634 ESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHP-TSMKTGAK-KADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            E  V+P+  T D VP+  HY +G  I  VGI+G+LGN LV+Y F+ +++LRTP N+FI++LAI D    A    P+   +S + RW +G+  CE+Y F G LFG  S+ T+ +I++DRYFVI +P  ++  L+ KRA+++L+  W+YSL WS PPFFG+  YVPEG  TSCT+DY+T +     + + ++I  F IP+ +II+CY+ I +++R       +   K+N  +   SMK   + K + + AKI++I++ +Y++SW+PY+ +AL A  G  D L PY   +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   59 EESVYPF-PTVD-VPDHAHYTIGAVILTVGITGMLGNFLVIYAFSRSRTLRTPANLFIINLAITDFLMCATQA-PIFFTTSMHKRWIFGEKGCELYAFCGALFGICSMITLMVIAVDRYFVITRPLASIGVLSQKRALLILLVAWVYSLGWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFIFVFFIPLIVIIYCYFFIFRSIRTTN----EAVGKINGDNKRDSMKRFQRLKNEWKMAKIALIVILMYVISWSPYSTVALTAFAGYSDFLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRLAI 365          
BLAST of Opsin vs. Ensembl Zebrafish
Match: opn4xa (opsin 4xa [Source:ZFIN;Acc:ZDB-GENE-110622-1])

HSP 1 Score: 221.09 bits (562), Expect = 4.466e-64
Identity = 146/417 (35.01%), Postives = 238/417 (57.07%), Query Frame = 1
Query:  628 EFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASA---------TKPSKYQSERESSMS---------QLDPEDDK-QVVETT-----------KNQTTSGHTNEAYESEQK 1788
            E + +   ++R  D VP+  HY+V  +++++G  GV+GNLLV+Y F S K LRTPPN FIM+LA+ D    A+   P+  I+     W +G++ C++Y F G LFG  S+  +  IS+DRY VI +P Q ++  + +R +I+++ VW+YSL WS  P  G+ +Y+PEG  TSCT+DY+T +  N  + + +    F IP+GII +CY+ +  A+R    ++ K+   +  +  T ++  + K + + AKI+ +++ +++LSW+PYA + L+A  G    L+PY+  +P + AK SA+YNPFIYAI   K+R  L +K PCL        K+   +++ S+         +  SK + +R SSMS         ++DP D K Q +  +           K QT   + N+   SE+K
Sbjct:    3 ESKDMDRGFFRKVD-VPDHAHYIVAFFVAVIGALGVIGNLLVMYAFFSNKKLRTPPNYFIMNLAVSDFLM-AITQSPIFFINCMYKEWVFGEMGCKMYAFCGALFGITSMINLLAISIDRYIVITKPLQAIRWTSGRRTLIIILVVWIYSLAWSLAPLIGWSSYIPEGLMTSCTWDYVTSTPANKSYTLMLCCFVFFIPLGIISYCYFFMFLAIRSASRDVEKLGSHVRKT--TLIQQQSIKTEWKLAKIAFVVIIVFVLSWSPYACVTLIAWAGYSHVLSPYSKAVPAVIAKASAIYNPFIYAIIRSKYRDTLAEKVPCLHFLAQSSRKDVSVSNSESSFREHMLSRQSSGSKAKFQRISSMSTADTVWSDVEIDPVDQKSQTIRNSQSASLLRDDKWKAQTKQDYQNDRESSEEK 415          
BLAST of Opsin vs. Ensembl Zebrafish
Match: opn4.1 (opsin 4.1 [Source:NCBI gene;Acc:352918])

HSP 1 Score: 217.238 bits (552), Expect = 7.047e-63
Identity = 121/299 (40.47%), Postives = 190/299 (63.55%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY++G  I IVGI+GV+GN LV+Y+F  +++LRT  NMFI++LA+ D   S V   P+   +S + RW +G+  CE+Y F G LFG  S+ T+  I+ DR   I QP   +  ++ ++A  +LV VWLYSL WS PPFFG+  YVPEG QTSC++DY+T +     + I +++  F IP+GII  CY+ I + +R    E+ ++      +H    +    + + + AK++++++ L+++SW+PY+++AL A  G    L PY   +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   59 VPDHAHYIIGSVILIVGITGVIGNALVVYVFCRSRTLRTAGNMFIVNLAVADFLMS-VTQSPVFFAASLHRRWVFGERPCELYAFCGALFGICSMMTLTAIAADRCLAITQPLALVSRVSRRKAGAVLVVVWLYSLGWSLPPFFGWSAYVPEGLQTSCSWDYMTFTPSVRAYTILLFVFVFFIPLGIIGSCYFAIFQTIRAAGKEIREL--DCGETHKVYERM---QNEWKMAKVALVVIVLFIISWSPYSVVALTATAGYSHFLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRVAI 351          
BLAST of Opsin vs. Ensembl Xenopus
Match: mcf2l (MCF.2 cell line derived transforming sequence-like [Source:Xenbase;Acc:XB-GENE-6042031])

HSP 1 Score: 226.483 bits (576), Expect = 3.369e-66
Identity = 139/316 (43.99%), Postives = 204/316 (64.56%), Query Frame = 1
Query:  625 PEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            P++E  +H  + T D VP+  HY+VG  I  VGI+G+LGN LV+Y F  ++SLR+P NMFI++LAI D   S V   P+   +S + RW +G+  CE+Y F G LFG  S+ T+ +I+LDRYFVI +P  ++  ++ KRA+++L  VWLYSL WS PPFFG+  YVPEG  TSCT+DY+T +     + + ++   F IP+ III+CY  I KA++     + K+    N  SH    K    K + + AKI++I++ LY++SW+PY+ +AL+A  G    L PY   +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   51 PQYE--IHHVYPTVD-VPDHVHYVVGAVILAVGITGMLGNFLVIYAFCRSRSLRSPANMFIINLAITDFLMS-VTQAPVFFATSLHKRWIFGEKGCELYAFCGALFGITSMITLMVIALDRYFVITRPLTSIGVMSKKRAVLILSGVWLYSLAWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFCFVFFIPLFIIIYCYIFIFKAIKNTNRAVQKIGTDDNKESHKQYQKM---KNEWKMAKIALIVILLYVVSWSPYSTVALVAFAGYASVLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRMAI 359          
BLAST of Opsin vs. Ensembl Xenopus
Match: mcf2l (MCF.2 cell line derived transforming sequence-like [Source:Xenbase;Acc:XB-GENE-6042031])

HSP 1 Score: 226.483 bits (576), Expect = 3.380e-66
Identity = 139/316 (43.99%), Postives = 204/316 (64.56%), Query Frame = 1
Query:  625 PEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            P++E  +H  + T D VP+  HY+VG  I  VGI+G+LGN LV+Y F  ++SLR+P NMFI++LAI D   S V   P+   +S + RW +G+  CE+Y F G LFG  S+ T+ +I+LDRYFVI +P  ++  ++ KRA+++L  VWLYSL WS PPFFG+  YVPEG  TSCT+DY+T +     + + ++   F IP+ III+CY  I KA++     + K+    N  SH    K    K + + AKI++I++ LY++SW+PY+ +AL+A  G    L PY   +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   52 PQYE--IHHVYPTVD-VPDHVHYVVGAVILAVGITGMLGNFLVIYAFCRSRSLRSPANMFIINLAITDFLMS-VTQAPVFFATSLHKRWIFGEKGCELYAFCGALFGITSMITLMVIALDRYFVITRPLTSIGVMSKKRAVLILSGVWLYSLAWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFCFVFFIPLFIIIYCYIFIFKAIKNTNRAVQKIGTDDNKESHKQYQKM---KNEWKMAKIALIVILLYVVSWSPYSTVALVAFAGYASVLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRMAI 360          
BLAST of Opsin vs. Ensembl Xenopus
Match: mcf2l (MCF.2 cell line derived transforming sequence-like [Source:Xenbase;Acc:XB-GENE-6042031])

HSP 1 Score: 226.098 bits (575), Expect = 3.946e-66
Identity = 138/316 (43.67%), Postives = 202/316 (63.92%), Query Frame = 1
Query:  625 PEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            P   + +H  + T D VP+  HY+VG  I  VGI+G+LGN LV+Y F  ++SLR+P NMFI++LAI D   S V   P+   +S + RW +G+  CE+Y F G LFG  S+ T+ +I+LDRYFVI +P  ++  ++ KRA+++L  VWLYSL WS PPFFG+  YVPEG  TSCT+DY+T +     + + ++   F IP+ III+CY  I KA++     + K+    N  SH    K    K + + AKI++I++ LY++SW+PY+ +AL+A  G    L PY   +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   43 PPIVTTIHHVYPTVD-VPDHVHYVVGAVILAVGITGMLGNFLVIYAFCRSRSLRSPANMFIINLAITDFLMS-VTQAPVFFATSLHKRWIFGEKGCELYAFCGALFGITSMITLMVIALDRYFVITRPLTSIGVMSKKRAVLILSGVWLYSLAWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFCFVFFIPLFIIIYCYIFIFKAIKNTNRAVQKIGTDDNKESHKQYQKM---KNEWKMAKIALIVILLYVVSWSPYSTVALVAFAGYASVLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRMAI 353          
BLAST of Opsin vs. Ensembl Xenopus
Match: mcf2l (MCF.2 cell line derived transforming sequence-like [Source:Xenbase;Acc:XB-GENE-6042031])

HSP 1 Score: 226.098 bits (575), Expect = 1.100e-65
Identity = 138/316 (43.67%), Postives = 203/316 (64.24%), Query Frame = 1
Query:  625 PEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            P++E  +H  + T D VP+  HY+VG  I  VGI+G+LGN LV+Y F  ++SLR+P NMFI++LAI D   S     P+   +S + RW +G+  CE+Y F G LFG  S+ T+ +I+LDRYFVI +P  ++  ++ KRA+++L  VWLYSL WS PPFFG+  YVPEG  TSCT+DY+T +     + + ++   F IP+ III+CY  I KA++     + K+    N  SH    K    K + + AKI++I++ LY++SW+PY+ +AL+A  G    L PY   +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   51 PQYE--IHHVYPTVD-VPDHVHYVVGAVILAVGITGMLGNFLVIYAFCRSRSLRSPANMFIINLAITDFLMSVTQA-PVFFATSLHKRWIFGEKGCELYAFCGALFGITSMITLMVIALDRYFVITRPLTSIGVMSKKRAVLILSGVWLYSLAWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFCFVFFIPLFIIIYCYIFIFKAIKNTNRAVQKIGTDDNKESHKQYQKM---KNEWKMAKIALIVILLYVVSWSPYSTVALVAFAGYASVLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRMAI 359          
BLAST of Opsin vs. Ensembl Xenopus
Match: mcf2l (MCF.2 cell line derived transforming sequence-like [Source:Xenbase;Acc:XB-GENE-6042031])

HSP 1 Score: 223.402 bits (568), Expect = 1.742e-65
Identity = 136/310 (43.87%), Postives = 199/310 (64.19%), Query Frame = 1
Query:  643 VHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            +H  + T D VP+  HY+VG  I  VGI+G+LGN LV+Y F  ++SLR+P NMFI++LAI D   S     P+   +S + RW +G+  CE+Y F G LFG  S+ T+ +I+LDRYFVI +P  ++  ++ KRA+++L  VWLYSL WS PPFFG+  YVPEG  TSCT+DY+T +     + + ++   F IP+ III+CY  I KA++     + K+    N  SH    K    K + + AKI++I++ LY++SW+PY+ +AL+A  G    L PY   +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   23 IHHVYPTVD-VPDHVHYVVGAVILAVGITGMLGNFLVIYAFCRSRSLRSPANMFIINLAITDFLMSVTQA-PVFFATSLHKRWIFGEKGCELYAFCGALFGITSMITLMVIALDRYFVITRPLTSIGVMSKKRAVLILSGVWLYSLAWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFCFVFFIPLFIIIYCYIFIFKAIKNTNRAVQKIGTDDNKESHKQYQKM---KNEWKMAKIALIVILLYVVSWSPYSTVALVAFAGYASVLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRMAI 327          
BLAST of Opsin vs. Ensembl Mouse
Match: Opn4 (opsin 4 (melanopsin) [Source:MGI Symbol;Acc:MGI:1353425])

HSP 1 Score: 201.83 bits (512), Expect = 1.711e-57
Identity = 120/300 (40.00%), Postives = 186/300 (62.00%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNAS-HPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY +G  I +VG++G+LGNL V+Y F   + LRTP NMFI++LA+ D   S V   P+   SS   +W +G+  CE Y F G +FG  S+ T+  I++DRY VI +P  T+   + +R  ++L+ VWLY+L WS PPFFG+  YVPEG  TSC++DY+T +     + + ++   F +P+ IIIFCY  I +A+R    E  +  +    S      +    +++ + AK+++I++ L++LSW PY+ +AL+A  G    L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   64 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMS-VTQAPVFFASSLYKKWLFGETGCEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGRGSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMTFTPQVRAYTMLLFCFVFFLPLLIIIFCYIFIFRAIR----ETGRACEGCGESPLRQRRQWQRLQSEWKMAKVALIVILLFVLSWAPYSTVALVAFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 358          
BLAST of Opsin vs. Ensembl Mouse
Match: Opn4 (opsin 4 (melanopsin) [Source:MGI Symbol;Acc:MGI:1353425])

HSP 1 Score: 201.83 bits (512), Expect = 6.172e-57
Identity = 120/300 (40.00%), Postives = 186/300 (62.00%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNAS-HPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY +G  I +VG++G+LGNL V+Y F   + LRTP NMFI++LA+ D   S V   P+   SS   +W +G+  CE Y F G +FG  S+ T+  I++DRY VI +P  T+   + +R  ++L+ VWLY+L WS PPFFG+  YVPEG  TSC++DY+T +     + + ++   F +P+ IIIFCY  I +A+R    E  +  +    S      +    +++ + AK+++I++ L++LSW PY+ +AL+A  G    L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   64 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMS-VTQAPVFFASSLYKKWLFGETGCEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGRGSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMTFTPQVRAYTMLLFCFVFFLPLLIIIFCYIFIFRAIR----ETGRACEGCGESPLRQRRQWQRLQSEWKMAKVALIVILLFVLSWAPYSTVALVAFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 358          
BLAST of Opsin vs. Ensembl Mouse
Match: Rrh (retinal pigment epithelium derived rhodopsin homolog [Source:MGI Symbol;Acc:MGI:1097709])

HSP 1 Score: 143.28 bits (360), Expect = 1.689e-37
Identity = 92/293 (31.40%), Postives = 163/293 (55.63%), Query Frame = 1
Query:  688 HYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSM--KTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            H ++  Y+ + GI+ +L N++VL IF   K LRTP N  I++LA  D+  S++ G+P+   S  +  W +G   C+IY  +   FG +SI  + ++++DRY  I+ P    + +T    + M++  W+  L W+  P  G+ +Y P+    +CT ++       + + + + + NFI+P+ ++ +CYY + +++R++            AS  T+   +  A +ADV   K+SVI++ +++L+W+PY+I+ L A  G    + P  A +  LFAK+S  YNP IY   H KFR
Sbjct:   25 HSVIAAYLIVAGITSILSNVVVLGIFIKYKELRTPTNAVIINLAFTDIGVSSI-GYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVAMDRYLTISCP-DVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRNNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYA-----------ASDCTAHLHRDWADQADVT--KMSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKKFR 302          
BLAST of Opsin vs. Ensembl Mouse
Match: Rrh (retinal pigment epithelium derived rhodopsin homolog [Source:MGI Symbol;Acc:MGI:1097709])

HSP 1 Score: 143.28 bits (360), Expect = 1.689e-37
Identity = 92/293 (31.40%), Postives = 163/293 (55.63%), Query Frame = 1
Query:  688 HYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSM--KTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            H ++  Y+ + GI+ +L N++VL IF   K LRTP N  I++LA  D+  S++ G+P+   S  +  W +G   C+IY  +   FG +SI  + ++++DRY  I+ P    + +T    + M++  W+  L W+  P  G+ +Y P+    +CT ++       + + + + + NFI+P+ ++ +CYY + +++R++            AS  T+   +  A +ADV   K+SVI++ +++L+W+PY+I+ L A  G    + P  A +  LFAK+S  YNP IY   H KFR
Sbjct:   25 HSVIAAYLIVAGITSILSNVVVLGIFIKYKELRTPTNAVIINLAFTDIGVSSI-GYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVAMDRYLTISCP-DVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRNNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYA-----------ASDCTAHLHRDWADQADVT--KMSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKKFR 302          
BLAST of Opsin vs. Ensembl Mouse
Match: Opn5 (opsin 5 [Source:MGI Symbol;Acc:MGI:2662912])

HSP 1 Score: 139.043 bits (349), Expect = 1.283e-35
Identity = 98/290 (33.79%), Postives = 154/290 (53.10%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKF 1557
            + G Y++I+GI    GN  VLY+ +  K    P  +  ++LA+ DL  S V G P   IS F  RW +G   C  YG+ G  FG  S+ TM  +SLDRY  I         L  K A I L  +W Y+  W+T P  G G+Y PE F TSCT D+ L Q S G  +F + +     ++P  +I+F Y +I+  V+    E+     ++++SH           +V+  K++++I   ++++W PYA++++ +  GR D +    + +P L AK++AMYNP IY +   +F
Sbjct:   35 VAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWFGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAVIWAYASFWTTMPLVGLGDYAPEPFGTSCTLDWWLAQASGGGQVFILSILFFCLLLPTAVIVFSYAKIIAKVKSSSKEVAHFDSRIHSSHVL---------EVKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYRF 313          
BLAST of Opsin vs. UniProt
Match: sp|P09241|OPSD_ENTDO (Rhodopsin OS=Enteroctopus dofleini OX=267067 GN=RHO PE=2 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 5.568e-99
Identity = 161/322 (50.00%), Postives = 236/322 (73.29%), Query Frame = 1
Query:  595 SLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            +L    W ++P  +  +HP+W  FD +P+  +Y VG++I +VGI G+LGN +V+Y+F+  KSL+TP NMFI++LA+ DL+FSA+NGFPL TIS+F  +W +GK+ C++YG +GG+FGF+SINTMA+IS+DRY VI +P    K ++ +RA +M++FVW++S++WS  P F +G YVPEG  TSC+FDYL+       F + MY   F++P+ II FCY+ IV +V  HE EM  MA+++NA      + GA  A+++ AKIS++I+  +MLSW+PYAIIAL+A  G  + + PY AELPVLFAK SA++NP +Y+++HPKFR
Sbjct:    6 TLVNQTWWYNPTVD--IHPHWAKFDPIPDAVYYSVGIFIGVVGIIGILGNGVVIYLFSKTKSLQTPANMFIINLAMSDLSFSAINGFPLKTISAFMKKWIFGKVACQLYGLLGGIFGFMSINTMAMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSIVWSVGPVFNWGAYVPEGILTSCSFDYLSTDPSTRSFILCMYFCGFMLPIIIIAFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISMVIITQFMLSWSPYAIIALLAQFGPAEWVTPYAAELPVLFAKASAIHNPIVYSVSHPKFR 324          
BLAST of Opsin vs. UniProt
Match: sp|O15973|OPSD1_MIZYE (Rhodopsin, GQ-coupled OS=Mizuhopecten yessoensis OX=6573 GN=SCOP1 PE=1 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 1.964e-90
Identity = 151/327 (46.18%), Postives = 236/327 (72.17%), Query Frame = 1
Query:  589 NESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            N S+T +   W+  ++  VH +W  F  V E +HY++GVYI+IVG+ G++GN  V+YIF++ KSLR+P N+F+++LA+ DL FSAVNGFPLLT+SSF+ +W +G L C++YGF+GG+FG +SINT+  IS+DRY VI +P Q  +++T ++  +M+V VW+ S++ S PPFFG+G Y+PEGFQTSCTFDYLT++     + + +Y+  F+IP+ II  CY  I++ VR H+ +ML + + M      +    A +++++ +KI++ +  L+++SW+PYAIIAL+A  G    + P  +ELP++ AK+S+M+NP +YA++HPKFR  L
Sbjct:   19 NRSMTPNT-GWEGPYDMSVHLHWTQFPPVTEEWHYIIGVYITIVGLLGIMGNTTVVYIFSNTKSLRSPSNLFVVNLAVSDLIFSAVNGFPLLTVSSFHQKWIFGSLFCQLYGFVGGVFGLMSINTLTAISIDRYVVITKPLQASQTMTRRKVHLMIVIVWVLSILLSIPPFFGWGAYIPEGFQTSCTFDYLTKTARTRTYIVVLYLFGFLIPLIIIGVCYVLIIRGVRRHDQKMLTITRSMKTEDARANNKRA-RSELRISKIAMTVTCLFIISWSPYAIIALIAQFGPAHWITPLVSELPMMLAKSSSMHNPVVYALSHPKFRKAL 343          
BLAST of Opsin vs. UniProt
Match: sp|P24603|OPSD_LOLFO (Rhodopsin OS=Loligo forbesii OX=6618 GN=RHO PE=2 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 6.278e-89
Identity = 163/361 (45.15%), Postives = 244/361 (67.59%), Query Frame = 1
Query:  613 WHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQ---SKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESS 1686
            W ++P  +  +HP+W+ FD VP   +Y +G++I+I GI G +GN +V+Y+F   KSL+TP NMFI++LA  D TFS VNGFPL+TIS F   W +G   C++YG IGG+FG +SI TM +IS+DRY VI +P    K ++ ++A IM++FVW++S IW+  P FG+G Y  EG   +C+FDY+T+   ++ NI   + MYI  F+ P+ +I FCY+ IV +V  HE EM  MA+++NA      + GA  A+++ AKIS++IV  ++LSW+PYA++AL+A  G  + + PY A+LPV+FAK SA++NP IY+++HPKFR ++   FP ++ CC    KE +    A A  P+  QS  E++
Sbjct:   11 WWYNPYMD--IHPHWKQFDQVPAAVYYSLGIFIAICGIIGCVGNGVVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFMKYWVFGNAACKVYGLIGGIFGLMSIMTMTMISIDRYNVIGRPMSASKKMSHRKAFIMIIFVWIWSTIWAIGPIFGWGAYTLEGVLCNCSFDYITRDTTTRSNI---LCMYIFAFMCPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-NAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPMIYSVSHPKFRERIASNFPWILTCCQYDEKEIEDDKDAEAEIPAGEQSGGETA 365          
BLAST of Opsin vs. UniProt
Match: sp|Q17094|OPSD_ALLSU (Rhodopsin (Fragment) OS=Alloteuthis subulata OX=54069 GN=RHO PE=3 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 6.929e-87
Identity = 162/357 (45.38%), Postives = 235/357 (65.83%), Query Frame = 1
Query:  613 WHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERES 1683
            W ++P  +  +H +W+ FD VP   +Y +G++I+I GI G  GN +V+Y+F   KSL+TP NMFI++LA  D TFS VNGFP++TIS F   W +G+  C++YG IGG+FG  SI TM +IS+DRY VI +P    K ++ ++A IM+VFVW++S IW+  P FG+G Y  EG   +C+FDY+T+        + MYI  F+ P+ +I FCY+ IV +V  HE EM  MA+++NA      + GA  A+++ AKIS++IV   +LSW+PYAI+AL+A  G  + + PY A+LPV+FAK SA++NP IY+++HPKFR  +   FP ++ CC    KE +    A A  P+  QS  ES
Sbjct:    4 WWYNPYMD--IHSHWKQFDQVPAAVYYSLGIFIAICGIIGCAGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPMMTISCFLKHWVFGQAACKVYGLIGGIFGLTSIMTMTMISIDRYNVIRRPMSASKKMSHRKAFIMIVFVWIWSTIWAIGPIFGWGAYQLEGVLCNCSFDYITRDASTRSNIVCMYIFAFMFPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISIVIVTQSLLSWSPYAIVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPMIYSVSHPKFREAIASNFPWILTCCQYDEKEIEDDKDAEAEIPAAEQSGGES 357          
BLAST of Opsin vs. UniProt
Match: sp|O16005|OPSD_SEPOF (Rhodopsin OS=Sepia officinalis OX=6610 GN=RHO PE=2 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 2.912e-82
Identity = 167/358 (46.65%), Postives = 241/358 (67.32%), Query Frame = 1
Query:  613 WHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESS 1686
            W ++P  E  VHP+W+ F+ VP+  +Y +G++I I GI G  GN +V+Y+F   KSL+TP NMFI++LA  D TFS VNGFPL+TIS F  +W +G   C++YGFIGG+FG +SI TM++IS+DRY VI +P    K ++ +RA +M++FVW++S +WS  P FG+G YV EG   +C+FDY+T+        + MYI  F  P+ II FCY+ IV AV  HE EM  MA+++NA      + GA  A+++ AKIS++IV  ++LSW+PYA++AL+A  G  + + PY A+LPV+FAK SA++NP IY+++HPKFR  + + FP +I CC    KE +    A    P+  QS  ES+
Sbjct:   11 WWYNPTME--VHPHWKQFNQVPDAVYYSLGIFIGICGIIGCTGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFIKKWVFGMAACKVYGFIGGIFGLMSIMTMSMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSTLWSIGPIFGWGAYVLEGVLCNCSFDYITRDSATRSNIVCMYIFAFCFPILIIFFCYFNIVMAVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPLIYSVSHPKFREAIAENFPWIITCCQFDEKEVEDDKDAETEIPATEQSGGESA 365          
BLAST of Opsin vs. TrEMBL
Match: gnl|BL_ORD_ID|20298524 (tr|A0A5K8CI78|A0A5K8CI78_SCHMD Rhabdomeric opsin OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 420/420 (100.00%), Postives = 420/420 (100.00%), Query Frame = 1
Query:  529 MSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQTTSGHTNEAYESEQK 1788
            MSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQTTSGHTNEAYESEQK
Sbjct:    1 MSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQTTSGHTNEAYESEQK 420          
BLAST of Opsin vs. TrEMBL
Match: gnl|BL_ORD_ID|19615153 (tr|A0A0F7CAN1|A0A0F7CAN1_DUGJA Opsin OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 324/344 (94.19%), Postives = 335/344 (97.38%), Query Frame = 1
Query:  529 MSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            M++ S   +G K+LENAT +N SL+KS WHWDPEFESIVHPYWRTFDMVPEVYHYLVGV+ISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFN RWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGN+IFNIGMYIGNF+IPVGIIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKIS+IIVFLY+LSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR
Sbjct:    1 MAIHSLVGIGQKILENATSDNASLSKSPWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVFISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNVIFNIGMYIGNFVIPVGIIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 344          
BLAST of Opsin vs. TrEMBL
Match: gnl|BL_ORD_ID|23083622 (tr|T1D132|T1D132_9PLAT Opsin OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 480.715 bits (1236), Expect = 6.967e-164
Identity = 271/326 (83.13%), Postives = 296/326 (90.80%), Query Frame = 1
Query:  808 MSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQTTSGHTNEAYESEQ 1785
            MSLAIGDLTF AVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTM LISLDRYFVIAQPFQ MK+LT+KRAI+M+V  W+YS IW++PPF+GYG+YVPEGFQTSCTFDYLTQSKGNIIFNIGMYI NF++PV IIIFCYYQIVKAVR+HELEMLKMA +MNA+HPTSMKTG+KKAD+QAAKISVIIVFLY+LSWTPYAIIALMALTG+RDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKK PCLICCCPPK KER+ TSA SATKP++YQSE+ES+MSQLD E         KNQ  S  TN  YE ++
Sbjct:    1 MSLAIGDLTFLAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMVLISLDRYFVIAQPFQGMKALTMKRAIVMVVLAWVYSFIWASPPFWGYGSYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFLLPVTIIIFCYYQIVKAVRLHELEMLKMAHQMNATHPTSMKTGSKKADIQAAKISVIIVFLYLLSWTPYAIIALMALTGKRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKLPCLICCCPPKAKEREMTSAVSATKPTRYQSEKESTMSQLDSE------APPKNQDGSCKTNNGYEEDK 320          
BLAST of Opsin vs. TrEMBL
Match: gnl|BL_ORD_ID|18804658 (tr|A0A5K8CJA0|A0A5K8CJA0_9PLAT Rhabdomeric opsin (Fragment) OS=Prostheceraeus vittatus OX=107736 PE=2 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 2.114e-157
Identity = 257/419 (61.34%), Postives = 326/419 (77.80%), Query Frame = 1
Query:  547 ANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQTTS---------GHTNEAYE 1776
            A+  + LL N +    + T + WHWD +FE+IVHP+WR+F  VPEVYHYLVGV+IS+VGI G++GNLLV+YIF+  KSLRT PN F+++LAI DLTFSAVNGFPLLT+SSFNTRWAWG+LTCE+YGFIGGLFGFISI+TMALI++DR+FVI QPF+ +KSLT  RA++M    W++ L+WS PPFFGYG+YVPEGFQTSCTFDYL+Q+KGNIIFN GMYI  F +PV  IIFCYY+IVKAVR+HELEM+ MA+K+     +  K+  KK+D+QAAK SV I  L+ LSW PYA++ALM+L GRRDHL P+T+E+PVLFAK+SA+YNP IYA+ HPKFR+QLEKKFP LICCCPPK KER+TTS  ++    +      SS+S +D +++        N+T +         G  N+A+E
Sbjct:    9 ASTPSSLLANGSLAPPNGTVAPWHWDADFEAIVHPHWRSFPPVPEVYHYLVGVFISVVGIWGIVGNLLVIYIFSVTKSLRTAPNFFVINLAISDLTFSAVNGFPLLTVSSFNTRWAWGRLTCEMYGFIGGLFGFISISTMALIAVDRFFVIVQPFEQLKSLTKTRALVMCSIAWIWGLLWSIPPFFGYGSYVPEGFQTSCTFDYLSQNKGNIIFNAGMYIFGFTLPVLTIIFCYYKIVKAVRMHELEMMAMAKKLK----SQFKSSDKKSDIQAAKTSVTIFVLFFLSWFPYALVALMSLVGRRDHLTPFTSEIPVLFAKSSAVYNPIIYALTHPKFRLQLEKKFPWLICCCPPKAKERETTSTTASKPAGRGAVSDTSSVSNMDSDNNVNRESMKGNETKNISSVEMTPKGQDNQAFE 423          
BLAST of Opsin vs. TrEMBL
Match: gnl|BL_ORD_ID|17679220 (tr|A0A5C2Q5B0|A0A5C2Q5B0_9PLAT Rhabdomeric opsin OS=Maritigrella crozieri OX=526434 PE=2 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 3.616e-157
Identity = 263/425 (61.88%), Postives = 330/425 (77.65%), Query Frame = 1
Query:  529 MSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESSMSQLDPED--DKQVVE--TTKN-----QTTSGHTNEAYE 1776
            M+ Q  A+  + LL N +    + T + WHWD +FE+IVHP+WR F  VPEVYHYLVGV+IS+VGI G++GNLLV+YIF+  KSLRT PN FI++LAI DLTFSAVNGFPLLT+SSFNTRWAWG+LTCE+YGFIGGLFGFISI TMALI++DR+FVI QPF+ +KSLT  RA++M    W++ L+WS PPFFGYG+YVPEGFQTSCTFDYL+Q+KGNIIFN GMYI  F +PV  IIFCYY+IVKAVR HELEM+ MA+K+     +  K+  KK+D+QAAK SV I  L+ LSW PYA++ALM+L GRRDHL P+T+E+PVLFAK+SA+YNP +YA+ HPKFR+QLEKKFP LICCCPPK KER+TTS  ++    +      SS+S +D ++  +K+ V+   TKN      T  G  N+A+E
Sbjct:    1 MAAQ-LASTPSSLLANGSLAPPNGTVAPWHWDADFEAIVHPHWRNFPPVPEVYHYLVGVFISVVGIWGIVGNLLVIYIFSVTKSLRTAPNFFIINLAISDLTFSAVNGFPLLTVSSFNTRWAWGRLTCEMYGFIGGLFGFISITTMALIAVDRFFVIVQPFEQLKSLTKTRALVMCSIAWIWGLLWSIPPFFGYGSYVPEGFQTSCTFDYLSQNKGNIIFNAGMYIFGFTLPVLTIIFCYYKIVKAVRQHELEMMAMAKKLK----SQFKSSDKKSDIQAAKTSVTIFVLFFLSWFPYALVALMSLVGRRDHLTPFTSEIPVLFAKSSAVYNPIVYALTHPKFRLQLEKKFPWLICCCPPKAKERETTSTTASKPAGRGAVSDTSSVSNMDSDNNVNKESVKGNETKNISAVEMTPKGQDNQAFE 420          
BLAST of Opsin vs. Ensembl Cavefish
Match: opn4b (opsin 4b [Source:ZFIN;Acc:ZDB-GENE-080415-3])

HSP 1 Score: 237.269 bits (604), Expect = 1.208e-71
Identity = 139/357 (38.94%), Postives = 217/357 (60.78%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQ 1743
            VP+  HY +G  I ++GI+G+ GN LV+Y F  ++SLRTP NMFI++LAI D     +   P+  I+S N RW +G+  CE+Y F G LFG  S+ T+ +I++DRYFVI +P  ++  ++ KRA+ +LV  WLY++ WS PPFFG+  YVPEG  TSCT+DY+T +     + + +++  F IP+ +II+CY+ I +A+R       +  Q       +  K    K++ + AK+++I++ LY++SW+PY+ +AL A  G  D L PY   +P + AK SA++NP IYAI HPK+R  L K  PCL        ++R T+S+        + S R S+++    E    +  T+K++
Sbjct:   22 VPDHAHYTIGFVILVIGITGIAGNFLVMYAFCKSRSLRTPSNMFIINLAITDFMM-CITQTPIFFITSMNKRWIFGEKGCELYAFCGALFGMCSMITLMVIAVDRYFVITRPLASIGKMSHKRALFILVIAWLYTMCWSLPPFFGWSAYVPEGLMTSCTWDYMTFTPSVRAYTMLLFVFVFFIPLFVIIYCYFCIFRAIR----NTTRSWQCFGCLTNSIKKFHRMKSEWKMAKVALIVILLYVISWSPYSCVALTAFAGYADMLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRSALVKYIPCLGVLLCVPRRDRFTSSS--------FMSTRRSTVTSQSSETSNNLRHTSKSR 365          
BLAST of Opsin vs. Ensembl Cavefish
Match: opn4a (opsin 4 [Source:NCBI gene;Acc:103023553])

HSP 1 Score: 228.409 bits (581), Expect = 2.155e-66
Identity = 126/299 (42.14%), Postives = 196/299 (65.55%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY +G  I  +GI+G++GN LV+Y F+ +++LRTP NMFI++LAI D    A    P+   +S + RW +G+  CE+Y F G LFG  S+ T+ +I++DRYFVI +P  ++  L+ KRA+++L   W YSL WS PPFFG+  YVPEG  TSCT+DY+T +     + + ++I  F IP+ +II+CY+ I +A+R+   ++ K+    N +  T  K    + + + AK+++I++ LY++SW+PY+ +AL A  G  D L PY   +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   58 VPDHAHYTIGAVILAIGITGMVGNFLVIYAFSRSRTLRTPANMFIINLAITDFLMCATQS-PIFFTTSMHKRWIFGEKGCELYAFCGALFGICSMITLTVIAVDRYFVITRPLASIGVLSQKRALLILTCAWAYSLGWSLPPFFGWSAYVPEGLLTSCTWDYVTFTPSVRAYTMLLFIFVFFIPLIVIIYCYFFIFRAIRITNQDVEKI--NGNNTRDTIKKFQRLRNEWKMAKVALIVILLYVISWSPYSSVALTAFAGYADMLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRLAI 353          
BLAST of Opsin vs. Ensembl Cavefish
Match: opn4.1 (melanopsin-like [Source:NCBI gene;Acc:103036973])

HSP 1 Score: 223.402 bits (568), Expect = 3.488e-65
Identity = 129/304 (42.43%), Postives = 196/304 (64.47%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVR-----VHEL---EMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            VP+  HY++G  I +VG++GV+GN LV+Y+F  ++SLRTP N+ +++LA+ DL F ++   P+  ++S + RW +G+  CE+Y F GGLFG  S+ T+  I+ DR   I +P   +  ++ +RA  +LV VWLYSL WS PPFFG+  YVPEG QTSC++DY++ +     + I ++I  F IP+GII  CY  I +A+R     V EL   E  KM Q+M             K++ + AK++++++ L+++SW+PY+I+AL A  G   HL PY   +P + AK SA++NP IYAI HPK+R
Sbjct:   63 VPDHAHYIIGSVILLVGVTGVIGNALVIYVFCRSRSLRTPGNILVVNLAVADL-FMSLTQSPVFFVASLHRRWVFGEKACELYAFCGGLFGICSMMTLTAIAADRCLAITRPLALLGRVSRRRAGAVLVLVWLYSLGWSLPPFFGWSAYVPEGLQTSCSWDYMSFTPSVRAYTILLFIFVFFIPLGIIGGCYLAIFQAIRSARREVKELDSGETHKMFQRM-------------KSEWKMAKVALLVISLFVISWSPYSIVALTATAGYAHHLTPYMNSVPAVIAKASAIHNPIIYAITHPKYR 352          
BLAST of Opsin vs. Ensembl Cavefish
Match: opn4xa (melanopsin-B-like [Source:NCBI gene;Acc:103043301])

HSP 1 Score: 206.453 bits (524), Expect = 7.187e-59
Identity = 136/399 (34.09%), Postives = 225/399 (56.39%), Query Frame = 1
Query:  652 YWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASA----------TKPSKYQSERESSMS---------QLDPEDDK-QVVETTKNQTT-SGHTNEAYESEQ 1785
            ++R  D VP+  HY+V  ++ ++G  GV+GN LV+Y F   K LRTPPN FIM+LA+ D    A+   P+  ++     W +G+  C++Y F G LFG  S+  +  IS+DRY VI +P Q ++  + +R ++ ++ VW+YSL WS  P  G+ +Y+PEG  TSCT+DY+T +  N  + + +    F IP+GII +CY+ +  A+R    ++ ++   +  +  T ++  + + + + AK++ +++ +Y+LSW+PYA + L+A  G    L PY+  +P + AK SA+YNP IYAI H K+R  L +K PCL        KE  + S + +          +  SK + +R SSMS         +LDP D K Q + ++++     G     +  E+
Sbjct:   10 FFRKVD-VPDHAHYIVAFFVVVIGAVGVMGNALVMYAFFCNKKLRTPPNYFIMNLAVSDFLM-AITQSPIFFVNCMYKEWVFGETGCKMYAFCGALFGITSMINLLAISIDRYIVITKPLQAIRWTSKRRTLLSILLVWMYSLAWSLAPLLGWSSYIPEGLMTSCTWDYVTSTPANKSYTLMLCCFVFFIPLGIISYCYFFMFLAIRNTSRDVERLGTHVRKT--TLIQQQSIRTEWKLAKVAFVVIIVYVLSWSPYAFVTLIAWAGYSSILTPYSKAVPAVIAKASAIYNPIIYAIIHSKYRNTLAEKIPCLYFMAKQPRKECISISNSESSFRESMLSRQSSGSKAKFQRVSSMSTGDTVWSDVELDPMDHKIQTIRSSQSADRWQGKAKNCFSQEK 404          
BLAST of Opsin vs. Ensembl Cavefish
Match: opn4xb (opsin 4xb [Source:NCBI gene;Acc:563080])

HSP 1 Score: 158.303 bits (399), Expect = 1.315e-43
Identity = 105/271 (38.75%), Postives = 158/271 (58.30%), Query Frame = 1
Query:  646 HPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRR 1458
            H  +R  ++   V HY +   I IVG  GV GN LV++ F S + LRT PN FI++LA+ DL   A+   P+  I+  +T+W  G+L CEIY F G LFG  S+ T+  IS+DRY VI +P Q M+  +  R  I++  VW+YSL WS  P  G+  YVPEG  TSCT+DY + + GN  + + +    F IP+ II++CY  +  +VR     ++  +Q  N     S    + + + + A+I+ +++ +Y+LSW PYA + L+A  G R
Sbjct:    6 HGVFRKVEVQDHV-HYTLAFIILIVGTLGVAGNTLVIFAFCSNRKLRTLPNFFIINLAVSDL-LMALTQSPVFFINCLHTQWMMGELGCEIYAFCGALFGISSMITLLAISVDRYLVITRPLQAMQWNSKCRTFIIITLVWIYSLAWSLAPLIGWSAYVPEGLMTSCTWDYASPAAGNRSYTLSLCCCVFFIPLIIILYCYTCMFLSVRRTSRYLMLGSQVRNGG--VSRLQHSVRTEWKLAQIAGVVISVYVLSWAPYACVTLVASAGYR 272          
BLAST of Opsin vs. Ensembl Sea Lamprey
Match: opn4a (opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624])

HSP 1 Score: 215.698 bits (548), Expect = 4.403e-64
Identity = 130/348 (37.36%), Postives = 210/348 (60.34%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESSM-SQLDPEDD 1713
            +P   H+ +G  +  +G +G++GN LV+Y+F  +KSLR+P N+FI++LA  D  F ++   P+  ++S + RW +G+  CE+Y F G LFG  S+ T+ +I+ DRY V+ +P  ++ +++ +RA+ +   VW YSL WS PPFFG+  YVPEG  TSCT+DY+T +     + + ++   F IP+ +IIFCY +I  A++ +    +K     + S  +  +     A+ + AKI++I++ LY++SW+PY+ +AL+A  G  D L PY   +P + AK SA++NP +YAI HPK+R  + K  PCL        K   T S +S      +QS R S++ SQ+    D
Sbjct:    9 IPHHVHHTIGSVVIAIGFTGIIGNFLVIYVFCRSKSLRSPANIFIINLAFADF-FMSITQTPIFFVTSLHKRWIFGEKGCELYAFCGALFGIASMVTLMVIATDRYLVLTRPLASIGAMSKRRAMYITAAVWFYSLAWSLPPFFGWSAYVPEGLMTSCTWDYVTFTPAVRSYTMLLFCFVFFIPLIVIIFCYVRIFAAIK-NTNRAVKTLGDAHDSKESQKQQQRMNAEWKLAKIALIVILLYVVSWSPYSCVALVAWAGYADMLTPYMNSVPAIIAKASAIHNPIVYAITHPKYRQAIGKYVPCLRSLFGVVRKGSRTLSGSS------FQSTRHSTLSSQMSCSGD 348          
BLAST of Opsin vs. Ensembl Sea Lamprey
Match: opn3 (opsin 3 [Source:ZFIN;Acc:ZDB-GENE-080227-16])

HSP 1 Score: 132.109 bits (331), Expect = 6.093e-34
Identity = 89/295 (30.17%), Postives = 156/295 (52.88%), Query Frame = 1
Query:  685 YHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            +  L GV +  +G++G L NLL++ +F   K L+TP N+ ++++++ DL  S V G  L  +S    RW WG   C   GF   LFG +SI+T+  +S +RY  + +     + L    A   + + WLYS  W+  P  G+  YV E     C+ D+ + +  +  F +  ++G    P+ ++ FC+ +I  A+ + +   L +AQ     H         + + +AA++++++V  ++L W PYA++AL+   G  D +NP T+ +P  FAK+S  YNP +Y   + + R  L
Sbjct:    6 FRLLAGV-VGTIGVAGFLNNLLLVALFVGFKRLQTPTNLLLVNISLSDLLVS-VFGNTLTLVSCVRRRWVWGNGGCVWDGFSNSLFGIVSISTLTALSYERYARLIK----AQVLDFSWAWRAVTYTWLYSAAWTGAPLLGWSRYVLEKHGLGCSIDWASSNPPDAAFVLFFFLGCLAAPLLVMGFCFGRI--ALAITQFRYLHVAQV----HTAGRMAQTLRGESRAARLALLVVATFLLCWMPYAVLALLTAAGNGDLINPATSVIPSFFAKSSIAYNPILYVFLNKRVRPAL 288          
BLAST of Opsin vs. Ensembl Sea Lamprey
Match: parapinopsina (parapinopsin a [Source:ZFIN;Acc:ZDB-GENE-101129-1])

HSP 1 Score: 93.5893 bits (231), Expect = 5.109e-22
Identity = 61/200 (30.50%), Postives = 103/200 (51.50%), Query Frame = 1
Query:  961 TMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            T+ +++++RY V+ +P   +   T +  +  +   W ++L WS PP FG+G Y  EG  TSC  D+   S     +    +I  F +P+ II+FCY +++ A+  H++  L ++            T  +K  +      V++VF + L W PYA +A+  +      ++P TA +PV  AK+S  YNP IY   H +FR
Sbjct:    7 TVCVLAVERYVVVCKPLGGVHFGT-QHGLCGVAISWTWALAWSAPPLFGWGRYHYEGVGTSCAPDWADSSPSGRSYMTTYFIFCFALPMIIILFCYTKLMIAI--HKVSKLGLSAN---------DTAERKVGIMV----VVMVFAFFLCWLPYAALAIAVVIKPDLKVSPVTASIPVYLAKSSGAYNPIIYIFMHRQFR 190          
BLAST of Opsin vs. Ensembl Sea Lamprey
Match: qrfpr4 (pyroglutamylated RFamide peptide receptor 4 [Source:ZFIN;Acc:ZDB-GENE-091204-354])

HSP 1 Score: 80.4925 bits (197), Expect = 1.182e-16
Identity = 77/306 (25.16%), Postives = 146/306 (47.71%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVP-----EGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAV----RVHELEMLKMAQKMNASHPTSMK--TGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRD---HLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            +VG  +  + +SG   N LV+++ A  K+L T  N+F+ SLA+ DL  + V   P+  + +F + W  G   C++  FI       S+ TMA I+++R+  I  P ++    T  RA  ML  VWL  L  + P F+ +   V      +   T C+  + + ++    +   + +  F++P+  +   Y ++   +    RVH+          NA   + +   T +KK   +A K+ VI+V L+ + W P+ ++  +   G  +    +   T  +  LF  +++++NP +YA  +  ++ QL
Sbjct:   50 VVGALVFTLALSG---NALVIFVVARRKALHTVANVFVCSLAVSDLMIT-VFCIPITLMQNFFSNWIAGVALCKLVPFIQVTAVTTSMLTMACIAVERFQGILHPLRSRSRYTTARAASMLCGVWLVGLCVAAPMFYAHTVQVTYDVLYDVSHTGCSEQW-SHAEHRQAYTTTLLLVTFVLPLLTMTALYTRLAHELWVKTRVHD-------AVFNALQRSEINKITRSKK---RAVKMMVIVVILFAVCWAPFHVVNSLVPKGNLEMSFDMEAITLAMVQLFGFSNSLWNPIVYAALNQNYKKQL 340          
BLAST of Opsin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006872.1 (pep scaffold:Pmarinus_7.0:GL476537:253210:263579:1 gene:ENSPMAG00000006208.1 transcript:ENSPMAT00000006872.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 3.799e-15
Identity = 80/299 (26.76%), Postives = 135/299 (45.15%), Query Frame = 1
Query:  697 VGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQ-TMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPE-GFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNAS-HPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPY----AIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1572
            VG  +S++ +  +LGNL+V       K LRT   MFIMSLA  DL  + +   P   I     RW +G++ C+++     +F   SI T+  ISLDRY  ++ P + T+     K  + M   +W+YS + S  P     N +P   F +S    ++T    N  F +      F IP  ++   Y+ I +A R+    +  M+Q ++   HP S +    + + +A +   II+  ++L W PY      I   +      H+     ++       ++  NP +YA  +  F+  L 
Sbjct:   21 VGSLLSVIDLVTLLGNLVVFVCPVLEKRLRTVTYMFIMSLATADLLVACL-VMPFSIIYEVTGRWMFGRIFCKVWISFDVMFCTASIVTLCFISLDRYCSVSAPHRYTLPKEPKKICVAMTAAIWVYSSLISFLPVMRGWNEIPGLDFDSSRECVFVT----NRTFAVVASALAFYIPFLVMCTMYFFIYRASRLKAARI--MSQTLDIHYHPKSRRPNNLQLEHKATRTMSIIISAFVLCWLPYFFFNVFIGFYSNNEDSAHVVQMAFKVITWLGYCNSAINPMLYAFLNRDFQHALR 312          
BLAST of Opsin vs. Ensembl Nematostella
Match: NVOP29 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSR1])

HSP 1 Score: 116.701 bits (291), Expect = 6.313e-29
Identity = 87/270 (32.22%), Postives = 158/270 (58.52%), Query Frame = 1
Query:  763 FASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTI-SSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSK---GNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            F   +SLRT  N FI+ L + +L  ++++   L T+ S+ + +W +G L C  YG     F ++S+NT+A+ISLDRY+VI +P   +K +TIKRA+I +   ++Y+L++S P F  + ++  + F T C   YLT ++    +++++I   +  F+ P G++IFCY  I K+V+      +++  K N      +    +    + A++ ++++F+++  W PY I++     GRR  ++  T E+ +L AK+  +YNPFIYA  + +FR
Sbjct:   25 FYRYRSLRTSTNTFILHLGLCNLILASMD--LLFTLPSTASKKWMFGLLACRFYGLTYHFFCYVSLNTLAIISLDRYWVITKPAIGIK-ITIKRALICIAVSYVYTLVFSIPLFLQWESFEEKIFYTGC---YLTTTRLTVKSLLYSIVHGVFLFLFPFGLMIFCYGSIFKSVKRKGRYGVRLRSKKNKW----IFAIQRIPHWRTARMIIVVIFVFLACWLPYVIVSTCMSLGRRPQISLLTLEITLLVAKSGVIYNPFIYAALNLRFR 284          
BLAST of Opsin vs. Ensembl Nematostella
Match: NVOP241 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQJ5])

HSP 1 Score: 114.775 bits (286), Expect = 3.071e-28
Identity = 89/284 (31.34%), Postives = 154/284 (54.23%), Query Frame = 1
Query:  715 IVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMK-SLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTS-CTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            IVGI G LGN LV+++      LRT  N+FI++LA  DL  + ++   L   S+ + RW WGK  C  YGF+   F   S++T+A IS+DR+F I +P Q     +T  RA I+L+ +++Y L+++ PP  G+ ++  E F  S C   Y  Q+  ++ +++   +  +++P+ ++I CY +I  AVR      +  +  +    P       K+  +Q AK+ V+++F  M+ W PY  ++L+        + P  + + VL AK+  +YN  IY + + K +
Sbjct:    3 IVGILGTLGNSLVVFVLWKYPKLRTATNLFILNLAFCDLVMALLD-LSLSVASALSNRWLWGKSGCLGYGFLHYFFISNSVSTLAAISVDRFFYITKPGQIKAWRITRTRAGIILIIIYIYVLLFTFPPIAGWSSFTEEKFYFSGCFIKYSDQNPASMAYSVIASVFLYLMPLILMICCYSKIFMAVRKSTRRTMTNSNAVRKKFPI-----MKRTHIQTAKMIVVVIFFSMIVWVPYVAVSLIQAFTADSIITPTASHITVLVAKSCVIYNVLIYVVLNRKLK 280          
BLAST of Opsin vs. Ensembl Nematostella
Match: NVOP465 (Opsin; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZI5])

HSP 1 Score: 107.457 bits (267), Expect = 8.226e-26
Identity = 80/300 (26.67%), Postives = 150/300 (50.00%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAW---GKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAK--------KADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            ++G YI+I  I G + N +V+ IF S++ L T PN+ + S+++ D   + +      ++  +     W   GK+TC+ Y F     G+ SI  +A +++++   +  P     S   +R ++++  +W ++++W+  P  G+ +Y PE    SC+  + T    N+ + I + +  F+IP+  + FC+  I   +R             N SH  + + G+         +A  + AK++ ++V  ++ +WTPYA+++L    G    +      LP LFAK S+ YNP IY   + KFR
Sbjct:   14 VLGYYIAIFVI-GFVTNTIVVIIFISSQRLHTTPNLILFSMSVCDWLMATMAK----SVGIYGNARYWPTVGKVTCDYYAFATSAIGYASILHLAALAVEKRMAVVSPMT--NSFNGRRMLVIIATLWGFAILWAVFPLIGWSSYGPEPGYVSCSITWYTTDHNNVSYIICVSVLFFLIPIVTMTFCFASIYHTIR-------------NLSHEATARWGSDARATQETIRAKAKTAKMAFLMVMCFLFAWTPYAVVSLWTTFGDTHRIPALLGVLPSLFAKLSSCYNPIIYFFMYTKFR 293          
BLAST of Opsin vs. Ensembl Nematostella
Match: EDO42547 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S169])

HSP 1 Score: 101.293 bits (251), Expect = 2.079e-23
Identity = 75/286 (26.22%), Postives = 140/286 (48.95%), Query Frame = 1
Query:  712 SIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAI-IMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRV--HELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            S++    VLGN LV+Y+     SL++  N+ I +L++ D+  +  N  P   IS ++ RW + +  C++  F    FG  SI TMA+I+L+RYF + +  +  +    ++ + +     WL  ++++TPP +G+G Y      ++C+  +       +I  IG++          I  CYY+I K V++  H L          ASH  + +  A+  +++  K +  +V  Y++ W P + + +    G       Y   + +++   S+  NP IY I +P+FR
Sbjct:   26 SLILFLSVLGNSLVVYVVNKDPSLKSTTNLLIQNLSMTDIAMATTN-MPFWLISLYHGRWIFPQFVCDLDSFTMFAFGSASILTMAVIALNRYFKVVKANKYKRLFGSRKVVWVYCAATWLVGMMFATPPLYGWGLYEYHIQFSTCSLIWDLNRISFVIVFIGVF---VNSVTITIFVCYYKIYKTVKITSHNL----------ASHGGTAEAAARVTEIKVMKSTFAVVCCYLICWMPVSFVCVTETAGGVMPREVYAVVIFLMY--ISSCINPLIYGIMNPQFR 295          
BLAST of Opsin vs. Ensembl Nematostella
Match: NVOP11 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL78])

HSP 1 Score: 98.2117 bits (243), Expect = 1.086e-22
Identity = 82/295 (27.80%), Postives = 153/295 (51.86%), Query Frame = 1
Query:  685 YHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLT---CEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            YH +  +Y S++     + N +VL IF + +SLRT PNM ++S+A  D   + +       + ++     W  +    C  YGFI    G  S+  +  +S++R+  +  P    + +T  + ++++ F+W +S +W+  P  G+ +Y PE    +C+  +  Q   N+ + + +++  F +P+ I+I C+  I   VR    + ++   +  AS  ++ +T A  A+ + A +S I+V  ++ +W PYA+++L A  G    +    + LP + AKTSA YNP IY   + KFR
Sbjct:    7 YHAITVMY-SLLAAGAFVLNGIVLIIFLATRSLRTIPNMILLSMAWADWLMACLAD----AVGAYANANNWPSMVGGLCVYYGFITTALGLTSMIHLTALSVERFVTVTIPMT--RPITETQMLLVVTFLWAFSFLWAIFPLVGWSSYGPEPGYAACSIAWYRQDLNNMSYILCLFMFFFFLPIVIMIACFSSIYFTVRKLTRDSMR---RWGASSDSTQQTLA--AERKTAWMSFIMVLAFLFAWVPYAVVSLYASFGGVTTIPKLMSTLPAMLAKTSACYNPIIYFFMYSKFR 289          
BLAST of Opsin vs. Ensembl Medaka
Match: opn4a (melanopsin-A [Source:NCBI gene;Acc:101165418])

HSP 1 Score: 229.95 bits (585), Expect = 7.933e-68
Identity = 149/375 (39.73%), Postives = 231/375 (61.60%), Query Frame = 1
Query:  646 HPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAK-KADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXE-RDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQTTSGHTN 1764
            HP+  T D VP+  HY +G  I  +GI+G++GN LV+Y F+ ++SLRTP NMFI++LAI DL    V   P+   +S + RW +G+  CE+Y F G LFG  S+ T+ +I++DRYFVI +P  ++  L+ KRA+++L   W YSL WS PPFFG+  YVPEG  TSCT+DY+T +     + + ++I  F +P+ III+CY  I +A+R       +   K+N +   ++K+  + + + + AKI++I++ LY++SW+PY+ +AL A  G  D L PY   +P + AK SA++NP IYAI HPK+R+ L K  P L       PK+ R  +S+  +T+ S   S+     SQL  +   +   ++ + + SG T+
Sbjct:    7 HPF-PTVD-VPDHAHYTIGSVILAIGITGIIGNFLVIYAFSRSRSLRTPANMFIINLAITDLLM-CVTQSPIFFTTSMHKRWIFGEKGCELYAFCGALFGICSMITLTVIAIDRYFVITRPLTSIGVLSRKRALLILSAAWAYSLGWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFIFVFFLPLFIIIYCYVFIFRAIRSTN----RAVGKINGNTRDAVKSFNRLQNEWKMAKIALIVILLYVISWSPYSTVALTAFAGYADMLTPYMNSIPAVIAKASAIHNPIIYAITHPKYRMALAKYIPGLGVLLCIHPKDLRSASSSFVSTRRSTVTSQSSDISSQLRRQSTFKSRLSSLSDSESGLTD 374          
BLAST of Opsin vs. Ensembl Medaka
Match: opn4b (melanopsin-A-like [Source:NCBI gene;Acc:101157094])

HSP 1 Score: 220.705 bits (561), Expect = 6.925e-64
Identity = 142/398 (35.68%), Postives = 225/398 (56.53%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATK------------PSKYQ--SERESSMSQL-DPEDD---------------KQVVETTKNQTTSGHTNEAYE 1776
            VP+  HY +GV I  VGI+G++GN LV+Y F+ ++SLRTP N+FI++LA+ D     +   P+  I+S    W +GK  CE+Y F G LFG  S+ T+ +I++DR  VI +P  ++ +++ K+A+  +   W+YS+ WS PPFFG+  YVPEG  TSC++DY+T +     + + ++   F IP+ IIIFCY +I +A+R     + K+      +  ++ K    +++ + AKI++I++ L+++SW PY+  AL A  G  D L PY   +P + AK SA++NP IYAI HPK+R  + +  P L        +ER ++S+  +T+            PS+ Q  S+ ES  +   D EDD               KQV   ++    SG   E +E
Sbjct:   55 VPDHAHYTIGVVILAVGITGMVGNFLVIYAFSRSRSLRTPSNIFIINLAVTDFLM-CLTQTPIFFITSMYKHWIFGKKGCELYAFCGALFGICSMMTLMVIAVDRCVVITRPLASLGAMSNKKALSFVAAAWVYSMGWSLPPFFGWSAYVPEGLMTSCSWDYMTFTPSVRSYTMLLFTFVFFIPLFIIIFCYCRIFRAIRHTTRAIAKI--NCEGTRDSAKKFHKMRSEWKMAKIALIVILLFVISWAPYSCAALTAFAGYADLLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRSAISRYVPYLGALLCVTGRERYSSSSIHSTRRSTLTSQSECRGPSRPQTSSQSESDSAHFSDTEDDCSSRTPASRQLSADVKQVRRPSQRSKVSGQGTEKFE 449          
BLAST of Opsin vs. Ensembl Medaka
Match: opn4.1 (opsin 4.1 [Source:NCBI gene;Acc:352918])

HSP 1 Score: 212.616 bits (540), Expect = 6.828e-62
Identity = 114/300 (38.00%), Postives = 190/300 (63.33%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKM-AQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY++G  I +VG++G+LGN LV+Y+F  +K+LR+P N+ +++LA  D   S V   P   ++S +  W +G+  CE+Y F G LFG  S+ T+  I++DR  VI +P   +  ++ KR  + +V VWLYSL WS PPFFG+  YVPEG QTSC++DY+T +     + I +++  F +P+ +I  CY+ I +AV+    E+ ++   ++N ++         +++ + AK+++ ++ L+++SW PY+++AL A  G    L PY   +P + AK SA++NP IYA+ HPK+RI +
Sbjct:   24 VPDHAHYIIGCVILLVGMTGMLGNALVIYVFCRSKALRSPSNLLVVNLAAADFLMS-VTQSPAFFVASLHRGWVFGEFACELYAFCGALFGITSMMTLTAIAVDRCLVITRPVALLGGMSRKRVYVAMVAVWLYSLGWSLPPFFGWSAYVPEGLQTSCSWDYMTFTTSVRTYTIMLFVFVFFLPLTLIAACYWAIFRAVQQAGREVARLNCGEINKAYER------LRSEWKMAKVALGVIMLFVVSWAPYSVVALTATAGYAQLLTPYMNSVPAVIAKASAIHNPIIYALTHPKYRIAI 316          
BLAST of Opsin vs. Ensembl Medaka
Match: opn4xa (melanopsin-B [Source:NCBI gene;Acc:101158465])

HSP 1 Score: 211.846 bits (538), Expect = 7.082e-62
Identity = 117/303 (38.61%), Postives = 187/303 (61.72%), Query Frame = 1
Query:  652 YWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            ++R  D VP+  HY++  ++ ++G  GV GN LV+Y F+  K LRTPPN FIM+LA+ D    A+   P+  I+     W +G+  C++Y F G LFG  S+  +  IS+DRY VI +P Q++   + +R   ++  VWLYSL WS  P  G+ +Y+PEG  TSCT+DY+T +  N  + + +    F IP+GII +CY  +  A+R    ++ ++  ++  S  T ++  + + + + AKI+ +++ +++LSW+PYA + L+A  G    LNPY+  +P + AK SA+YNPFIYAI H K+R
Sbjct:    7 FYRHVD-VPDHVHYIIAFFVLVIGTVGVTGNALVMYAFSCNKKLRTPPNFFIMNLAVSDFLM-AITQSPIFFINCLYKGWIFGETGCKMYAFCGALFGISSMINLLAISIDRYIVITKPLQSIAWTSARRTCFIIALVWLYSLFWSLAPLLGWSSYIPEGLMTSCTWDYVTATPSNKSYTLMLCCFVFFIPLGIISYCYLCMFLAIRHTSRDVTQLGSQVRKS--TLIQQQSIRTEWKLAKIAFVVIIVFVLSWSPYACVTLIAWAGYASILNPYSKAVPAVIAKASAIYNPFIYAITHSKYR 305          
BLAST of Opsin vs. Ensembl Medaka
Match: opn4xb (melanopsin-A [Source:NCBI gene;Acc:101173945])

HSP 1 Score: 191.43 bits (485), Expect = 2.353e-53
Identity = 110/299 (36.79%), Postives = 182/299 (60.87%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY+V +++ ++G  G+ GN LV++ F S K LR  PN FIM+LAI D    A    P+  I+     W +G+  C++Y F G LFG  S+  +  IS++RY VI +P QT+   + ++  + +  VW YSL WS  P  G+ +Y+PEG  TSCT+DY+T +  N  + + +    F IP+GII++CY ++  ++R     + ++  ++  S  T ++    +++ + AKI+ +++ +Y+LSW+PYA + L++  G  D L+PY+  +P + AK S +YNP IYAI H K+R+ L
Sbjct:   16 VPDHAHYIVAMFVFVIGALGITGNALVMFAFYSNKKLRNLPNYFIMNLAISDFLM-AFTQSPIFFINCLYREWMFGETGCKVYAFCGALFGISSMINLLAISVERYLVITKPLQTIHWSSKRKTTLAIFLVWFYSLAWSLAPLVGWSSYIPEGLMTSCTWDYVTYTPANRSYTMMLCCFVFFIPLGIILYCYLRMFLSIRKTTRAVERLGTQVRKS--TVIQQKTIRSEWKLAKIAFVVIVVYVLSWSPYACVTLISWAGHADILSPYSKAVPAVIAKASTIYNPIIYAIIHNKYRMTL 311          
BLAST of Opsin vs. Planmine SMEST
Match: SMESG000074489.1 (SMESG000074489.1)

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 420/420 (100.00%), Postives = 420/420 (100.00%), Query Frame = 1
Query:  529 MSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQTTSGHTNEAYESEQK 1788
            MSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQTTSGHTNEAYESEQK
Sbjct:    1 MSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQTTSGHTNEAYESEQK 420          
BLAST of Opsin vs. Planmine SMEST
Match: SMESG000025307.1 (SMESG000025307.1)

HSP 1 Score: 140.969 bits (354), Expect = 9.408e-37
Identity = 105/339 (30.97%), Postives = 172/339 (50.74%), Query Frame = 1
Query:  676 PEVYHY-LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLT---QSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTG-RRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATK--PSKYQS 1671
            PE + Y + GVYI  +G+ G + N  V+ +F  +K L TP N+F+  L   D     + GFP L +SSF   W +    C +Y F   + G  SI  + +I+++R+  +  P QT+K++T+KR+I  ++  W   +I S PP  G+  YV EG Q SC+FD      QSK  I+  IG +    ++ +  II CY +I   VR    EM  +  K   S     +    K + +   +   +   ++LSW PYA++ ++AL     +  +     +P  FAK+  + NP IY +N+P+F+ +L K    L      K + + T + ++ T+  PS  Q+
Sbjct:   10 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTI-GFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYIMLLIGTF----LLILTAIIICYVKIFFKVRDQIKEMRIVYTK---SFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCILKQIPCKKKQSQTTQNLSTITRHVPSAVQT 340          
BLAST of Opsin vs. Planmine SMEST
Match: SMESG000025307.1 (SMESG000025307.1)

HSP 1 Score: 140.969 bits (354), Expect = 1.026e-36
Identity = 105/339 (30.97%), Postives = 172/339 (50.74%), Query Frame = 1
Query:  676 PEVYHY-LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLT---QSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTG-RRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATK--PSKYQS 1671
            PE + Y + GVYI  +G+ G + N  V+ +F  +K L TP N+F+  L   D     + GFP L +SSF   W +    C +Y F   + G  SI  + +I+++R+  +  P QT+K++T+KR+I  ++  W   +I S PP  G+  YV EG Q SC+FD      QSK  I+  IG +    ++ +  II CY +I   VR    EM  +  K   S     +    K + +   +   +   ++LSW PYA++ ++AL     +  +     +P  FAK+  + NP IY +N+P+F+ +L K    L      K + + T + ++ T+  PS  Q+
Sbjct:   15 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTI-GFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYIMLLIGTF----LLILTAIIICYVKIFFKVRDQIKEMRIVYTK---SFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCILKQIPCKKKQSQTTQNLSTITRHVPSAVQT 345          
BLAST of Opsin vs. Planmine SMEST
Match: SMESG000025308.1 (SMESG000025308.1)

HSP 1 Score: 111.309 bits (277), Expect = 3.961e-27
Identity = 77/259 (29.73%), Postives = 132/259 (50.97%), Query Frame = 1
Query:  787 TPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLT---QSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPY-TAELPVLFAKTSAMYNPFIYAINHP 1551
            TP N+FI  LA+ DL    + GFP LTIS F   W + +  C  Y F   + G  SI  + +++++R  VI++P + +K ++ KR+ ++++  W +++  S PP  G+  YV EG   SC++D      +SK  I+F IG++    ++ + IIIFCY  +   V+     M  M +          +    K       I++     ++LSW PYA++ ++++    +  N       P  FAK+  +YNP IY  ++P
Sbjct:    3 TPSNVFIFDLALSDLLI-CILGFPFLTISGFCKEWIFSEAGCSAYAFSMSVTGMHSIFILTILAVERLKVISRPLKMVKIVSKKRSFLLVLISWTFAIFVSIPPLLGWNRYVLEGLHISCSYDMFDGSWRSKSYIVFLIGIF----LVVLLIIIFCYLALFLKVQRQATSMRVMIKDSRDLLAERERQRENKLIWMGCNITLA----FVLSWGPYALVTILSIFKVLNEKNSLIIVTFPSFFAKSFTIYNPIIYIFSYP 252          
BLAST of Opsin vs. Planmine SMEST
Match: SMESG000025307.1 (SMESG000025307.1)

HSP 1 Score: 98.9821 bits (245), Expect = 6.009e-23
Identity = 71/240 (29.58%), Postives = 122/240 (50.83%), Query Frame = 1
Query:  970 LISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLT---QSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTG-RRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATK--PSKYQS 1671
            +I+++R+  +  P QT+K++T+KR+I  ++  W   +I S PP  G+  YV EG Q SC+FD      QSK  I+  IG +    ++ +  II CY +I   VR    EM  +  K   S     +    K + +   +   +   ++LSW PYA++ ++AL     +  +     +P  FAK+  + NP IY +N+P+F+ +L K    L      K + + T + ++ T+  PS  Q+
Sbjct:   14 VIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYIMLLIGTF----LLILTAIIICYVKIFFKVRDQIKEMRIVYTK---SFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCILKQIPCKKKQSQTTQNLSTITRHVPSAVQT 246          
The following BLAST results are available for this feature:
BLAST of Opsin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OPN44.578e-5740.40opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449][more]
OPN42.234e-5439.30opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449][more]
OPN42.242e-5439.30opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449][more]
OPN51.879e-3634.83opsin 5 [Source:HGNC Symbol;Acc:HGNC:19992][more]
OPN51.879e-3634.83opsin 5 [Source:HGNC Symbol;Acc:HGNC:19992][more]
back to top
BLAST of Opsin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gar-21.536e-1729.05Muscarinic acetylcholine receptor gar-2 [Source:U... [more]
gar-21.211e-1629.05Muscarinic acetylcholine receptor gar-2 [Source:U... [more]
gar-21.390e-1629.05Muscarinic acetylcholine receptor gar-2 [Source:U... [more]
gar-21.620e-1632.18Muscarinic acetylcholine receptor gar-2 [Source:U... [more]
dop-26.061e-1227.75D2-like dopamine receptor long variant; DOPamine r... [more]
back to top
BLAST of Opsin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rh59.931e-5436.36gene:FBgn0014019 transcript:FBtr0342591[more]
Rh59.931e-5436.36gene:FBgn0014019 transcript:FBtr0080291[more]
ninaE1.146e-5333.60gene:FBgn0002940 transcript:FBtr0083857[more]
Rh33.383e-5233.91gene:FBgn0003249 transcript:FBtr0083876[more]
Rh23.593e-5135.44gene:FBgn0003248 transcript:FBtr0083697[more]
back to top
BLAST of Opsin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
opn4b1.069e-6638.24opsin 4b [Source:ZFIN;Acc:ZDB-GENE-080415-3][more]
opn4a7.729e-6642.36opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624... [more]
opn4a8.222e-6642.36opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624... [more]
opn4xa4.466e-6435.01opsin 4xa [Source:ZFIN;Acc:ZDB-GENE-110622-1][more]
opn4.17.047e-6340.47opsin 4.1 [Source:NCBI gene;Acc:352918][more]
back to top
BLAST of Opsin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcf2l3.369e-6643.99MCF.2 cell line derived transforming sequence-like... [more]
mcf2l3.380e-6643.99MCF.2 cell line derived transforming sequence-like... [more]
mcf2l3.946e-6643.67MCF.2 cell line derived transforming sequence-like... [more]
mcf2l1.100e-6543.67MCF.2 cell line derived transforming sequence-like... [more]
mcf2l1.742e-6543.87MCF.2 cell line derived transforming sequence-like... [more]
back to top
BLAST of Opsin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Opn41.711e-5740.00opsin 4 (melanopsin) [Source:MGI Symbol;Acc:MGI:13... [more]
Opn46.172e-5740.00opsin 4 (melanopsin) [Source:MGI Symbol;Acc:MGI:13... [more]
Rrh1.689e-3731.40retinal pigment epithelium derived rhodopsin homol... [more]
Rrh1.689e-3731.40retinal pigment epithelium derived rhodopsin homol... [more]
Opn51.283e-3533.79opsin 5 [Source:MGI Symbol;Acc:MGI:2662912][more]
back to top
BLAST of Opsin vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P09241|OPSD_ENTDO5.568e-9950.00Rhodopsin OS=Enteroctopus dofleini OX=267067 GN=RH... [more]
sp|O15973|OPSD1_MIZYE1.964e-9046.18Rhodopsin, GQ-coupled OS=Mizuhopecten yessoensis O... [more]
sp|P24603|OPSD_LOLFO6.278e-8945.15Rhodopsin OS=Loligo forbesii OX=6618 GN=RHO PE=2 S... [more]
sp|Q17094|OPSD_ALLSU6.929e-8745.38Rhodopsin (Fragment) OS=Alloteuthis subulata OX=54... [more]
sp|O16005|OPSD_SEPOF2.912e-8246.65Rhodopsin OS=Sepia officinalis OX=6610 GN=RHO PE=2... [more]
back to top
BLAST of Opsin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|202985240.000e+0100.00tr|A0A5K8CI78|A0A5K8CI78_SCHMD Rhabdomeric opsin O... [more]
gnl|BL_ORD_ID|196151530.000e+094.19tr|A0A0F7CAN1|A0A0F7CAN1_DUGJA Opsin OS=Dugesia ja... [more]
gnl|BL_ORD_ID|230836226.967e-16483.13tr|T1D132|T1D132_9PLAT Opsin OS=Dendrocoelum lacte... [more]
gnl|BL_ORD_ID|188046582.114e-15761.34tr|A0A5K8CJA0|A0A5K8CJA0_9PLAT Rhabdomeric opsin (... [more]
gnl|BL_ORD_ID|176792203.616e-15761.88tr|A0A5C2Q5B0|A0A5C2Q5B0_9PLAT Rhabdomeric opsin O... [more]
back to top
BLAST of Opsin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
opn4b1.208e-7138.94opsin 4b [Source:ZFIN;Acc:ZDB-GENE-080415-3][more]
opn4a2.155e-6642.14opsin 4 [Source:NCBI gene;Acc:103023553][more]
opn4.13.488e-6542.43melanopsin-like [Source:NCBI gene;Acc:103036973][more]
opn4xa7.187e-5934.09melanopsin-B-like [Source:NCBI gene;Acc:103043301][more]
opn4xb1.315e-4338.75opsin 4xb [Source:NCBI gene;Acc:563080][more]
back to top
BLAST of Opsin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
opn4a4.403e-6437.36opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624... [more]
opn36.093e-3430.17opsin 3 [Source:ZFIN;Acc:ZDB-GENE-080227-16][more]
parapinopsina5.109e-2230.50parapinopsin a [Source:ZFIN;Acc:ZDB-GENE-101129-1][more]
qrfpr41.182e-1625.16pyroglutamylated RFamide peptide receptor 4 [Sourc... [more]
ENSPMAT00000006872.13.799e-1526.76pep scaffold:Pmarinus_7.0:GL476537:253210:263579:1... [more]
back to top
BLAST of Opsin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Opsin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
NVOP296.313e-2932.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVOP2413.071e-2831.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVOP4658.226e-2626.67Opsin; Predicted protein [Source:UniProtKB/TrEMBL... [more]
EDO425472.079e-2326.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVOP111.086e-2227.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Opsin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
opn4a7.933e-6839.73melanopsin-A [Source:NCBI gene;Acc:101165418][more]
opn4b6.925e-6435.68melanopsin-A-like [Source:NCBI gene;Acc:101157094][more]
opn4.16.828e-6238.00opsin 4.1 [Source:NCBI gene;Acc:352918][more]
opn4xa7.082e-6238.61melanopsin-B [Source:NCBI gene;Acc:101158465][more]
opn4xb2.353e-5336.79melanopsin-A [Source:NCBI gene;Acc:101173945][more]
back to top
BLAST of Opsin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074489.10.000e+0100.00SMESG000074489.1[more]
SMESG000025307.19.408e-3730.97SMESG000025307.1[more]
SMESG000025307.11.026e-3630.97SMESG000025307.1[more]
SMESG000025308.13.961e-2729.73SMESG000025308.1[more]
SMESG000025307.16.009e-2329.58SMESG000025307.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030594 ID=SMED30030594|Name=Opsin|organism=Schmidtea mediterranea sexual|type=transcript|length=1880bp
AATAAAATGAAATTTATAATGCCATTGGTATTTACACTGTGGTTAATAAC
GATAATAATCAGAATTTTTAATGATAAATATAGTAAACGATAACTAGTAA
CGGTAACCCTAATAATGAATGCTATATTACATATAGTAGTGTTACCAAAA
TTTTGGAATTTAAAATAATAAGTTTATTATGAGTGACCATGATAATAAAA
AAGATTTTTAAATAAAATGATAATATTACTATATAGTCGGTTATAGTTCC
GATTAGTCTACTATCGTAGACGTAATAAAAAGAGTTTAGTAACCTAATTT
TCAATGTTTTTTGAAAGTTGCTCGTCTCTATGGCAACTTATTATCGTAAG
GAAAATTTTCTACTTCACTATGATATTTTCGGAGTGAATTTATTGATTTA
CATTCAAGGACTTTCACTATTGCATTTACTGAAGCGATCGTTTCATTTGG
AACTCATATTTTCGCCCCTAATCGTTCTGGAATTTATTATTTATGATCCT
TTATCTGACCTTAAAAATTTTCATATTCATGAGTGTCCAATCTTTTGCCA
ATTTGGGAAATAAGCTCCTAGAAAATGCTACCTTCAATAATGAATCCCTT
ACAAAGTCAGTATGGCATTGGGATCCTGAATTTGAATCAATTGTCCATCC
GTACTGGCGGACTTTTGATATGGTGCCAGAAGTTTATCATTATTTAGTTG
GAGTGTATATTTCTATTGTTGGAATATCGGGAGTTCTGGGAAATCTTCTT
GTTCTTTACATATTTGCAAGCGCCAAAAGTTTAAGAACTCCTCCAAATAT
GTTTATAATGAGTTTAGCAATTGGAGATTTGACATTTTCTGCTGTGAATG
GCTTCCCCTTACTTACTATTTCAAGTTTTAACACTCGATGGGCTTGGGGA
AAATTAACGTGTGAGATTTATGGTTTCATCGGTGGTCTTTTTGGGTTTAT
ATCCATCAACACAATGGCACTAATTTCTCTGGATAGGTATTTTGTTATTG
CCCAACCATTTCAAACAATGAAATCCCTGACAATCAAAAGAGCAATAATC
ATGTTGGTTTTCGTATGGCTTTATTCATTAATTTGGTCAACACCGCCATT
TTTTGGATATGGAAATTATGTGCCGGAAGGATTTCAAACGTCTTGTACAT
TCGACTATTTGACCCAATCAAAAGGTAACATAATATTCAATATTGGGATG
TACATAGGAAATTTCATAATTCCCGTTGGAATAATTATATTTTGCTATTA
TCAAATTGTCAAAGCAGTGCGAGTACATGAATTAGAAATGTTAAAAATGG
CTCAAAAGATGAATGCATCTCATCCAACTTCCATGAAAACGGGTGCAAAA
AAGGCTGATGTTCAAGCTGCAAAGATTTCTGTCATAATTGTCTTTTTATA
TATGTTATCATGGACACCATATGCAATAATTGCCCTTATGGCTCTCACAG
GGCGTAGAGATCATCTGAATCCATACACTGCAGAATTGCCGGTACTCTTT
GCTAAGACCTCAGCTATGTACAACCCATTTATATACGCAATAAATCATCC
AAAATTTCGAATTCAGCTGGAAAAGAAATTTCCATGTTTGATTTGTTGCT
GTCCACCAAAACCAAAAGAAAGGGACACTACAAGTGCAGCATCAGCAACG
AAACCGAGTAAATATCAGAGTGAAAGAGAAAGTTCAATGTCTCAACTGGA
TCCTGAAGACGATAAACAAGTCGTAGAAACCACCAAGAATCAAACCACAA
GTGGACATACAAATGAAGCTTACGAGAGTGAACAGAAGTAGTTGATGAAA
CTAAATTATTCTATTTTTAATGACACTAGATCTTTATAATAATTTTATTT
AAGGGAATGAGCACTGAATTTTGCGCAAAT
back to top

protein sequence of SMED30030594-orf-1

>SMED30030594-orf-1 ID=SMED30030594-orf-1|Name=SMED30030594-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=433bp
MILYLTLKIFIFMSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESI
VHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTP
PNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLF
GFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWST
PPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIF
CYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIV
FLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAI
NHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSERESSMS
QLDPEDDKQVVETTKNQTTSGHTNEAYESEQK*
back to top
Aliases
The feature 'Opsin' has the following synonyms
Synonym
opsin
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
PLANA:0000124visual system
PLANA:0000017photoreceptor neuron
PLANA:0000036eye
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR001760Opsin
IPR027430Retinal_BS
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007601visual perception
GO:0007165signal transduction
GO:0007602phototransduction
GO:0018298protein-chromophore linkage
GO:0050896response to stimulus
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
GO:0009881photoreceptor activity
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000007Stage 7
PLANA:0000008Stage 8
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 292..316
score: 25.7
coord: 101..122
score: 29.78
coord: 183..204
score: 28.02
coord: 330..356
score: 28.98
coord: 147..169
score: 31.16
coord: 68..92
score: 27.58
coord: 233..256
score: 26.6
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 74..363
e-value: 0.0017
score: -57.9
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 83..348
e-value: 1.1E-50
score: 172.4
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 153..169
IPR001760OpsinPRINTSPR00238OPSINcoord: 205..217
score: 52.1
coord: 89..101
score: 45.03
coord: 327..339
score: 38.27
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 43..387
e-value: 2.6E-104
score: 350.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 377..432
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 379..398
NoneNo IPR availablePANTHERPTHR24240:SF72MELANOPSINcoord: 57..401
NoneNo IPR availablePANTHERPTHR24240OPSINcoord: 57..401
NoneNo IPR availableCDDcd153377tmA_Opsin_Gq_invertebratescoord: 67..356
e-value: 8.2456E-159
score: 447.923
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.664
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 50..377
NoneNo IPR availableTMHMMTMhelixcoord: 69..91
NoneNo IPR availableTMHMMTMhelixcoord: 230..252
NoneNo IPR availableTMHMMTMhelixcoord: 295..317
NoneNo IPR availableTMHMMTMhelixcoord: 184..206
NoneNo IPR availableTMHMMTMhelixcoord: 104..126
NoneNo IPR availableTMHMMTMhelixcoord: 141..163
IPR027430Visual pigments (opsins) retinal binding sitePROSITEPS00238OPSINcoord: 332..348
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 83..348
score: 42.559