Opsin

Overview
NameOpsin
Smed IDSMED30030594
Uniprot Best hitRhodopsin OS=Enteroctopus dofleini GN=RHO PE=1 SV=1 (E=1.50265e-97)
Length (bp)1880
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Opsin (SMED30030594) t-SNE clustered cells

Violin plots show distribution of expression levels for Opsin (SMED30030594) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Opsin (SMED30030594) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Opsin (SMED30030594) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Opsin ( opsin ) is expressed during Stage 7 and Stage 8 in the eye, visual system and photoreceptor neuron

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Opsin vs. Ensembl Human
Match: OPN4 (opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449])

HSP 1 Score: 201.445 bits (511), Expect = 3.140e-56
Identity = 122/302 (40.40%), Postives = 184/302 (60.93%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAK---KADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY +G  I +VG++G+LGNL V+Y F  ++SLRTP NMFI++LA+ D   S     P+   SS   +W +G+  CE Y F G LFG  S+ T+  I+LDRY VI +P  T    + +RA  +L+ VWLY+L WS PPFFG+  YVPEG  TSC++DY++ +     + + +    F +P+ III+CY  I +A+R    E  +  Q   A          +   +++ + AKI ++++ L++LSW PY+ +AL+A  G    L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIR----ETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 361          
BLAST of Opsin vs. Ensembl Human
Match: OPN4 (opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449])

HSP 1 Score: 194.512 bits (493), Expect = 1.256e-53
Identity = 123/313 (39.30%), Postives = 184/313 (58.79%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASA-----------KSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAK---KADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY +G  I +VG++G+LGNL V+Y F  A           +SLRTP NMFI++LA+ D   S     P+   SS   +W +G+  CE Y F G LFG  S+ T+  I+LDRY VI +P  T    + +RA  +L+ VWLY+L WS PPFFG+  YVPEG  TSC++DY++ +     + + +    F +P+ III+CY  I +A+R    E  +  Q   A          +   +++ + AKI ++++ L++LSW PY+ +AL+A  G    L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRAVLRGVTVMMQSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIR----ETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 372          
BLAST of Opsin vs. Ensembl Human
Match: OPN4 (opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449])

HSP 1 Score: 194.512 bits (493), Expect = 1.265e-53
Identity = 123/313 (39.30%), Postives = 184/313 (58.79%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASA-----------KSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAK---KADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY +G  I +VG++G+LGNL V+Y F  A           +SLRTP NMFI++LA+ D   S     P+   SS   +W +G+  CE Y F G LFG  S+ T+  I+LDRY VI +P  T    + +RA  +L+ VWLY+L WS PPFFG+  YVPEG  TSC++DY++ +     + + +    F +P+ III+CY  I +A+R    E  +  Q   A          +   +++ + AKI ++++ L++LSW PY+ +AL+A  G    L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   65 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRAVLRGVTVMMQSRSLRTPANMFIINLAVSDFLMSFTQA-PVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIR----ETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 372          
BLAST of Opsin vs. Ensembl Human
Match: OPN5 (opsin 5 [Source:HGNC Symbol;Acc:HGNC:19992])

HSP 1 Score: 142.124 bits (357), Expect = 2.644e-36
Identity = 101/290 (34.83%), Postives = 155/290 (53.45%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKF 1557
            + G Y++I+GI    GN  VLY+ +  K    P  +  ++LA+ DL  S V G P   IS F  RW +G + C  YG+ G  FG  S+ TM  +SLDRY  I         L  K A I L  +W Y+  W+T P  G G+YVPE F TSCT D+ L Q S G  +F + +     ++P  +I+F Y +I+  V+    E+     ++++SH   MK           K++++I   ++++W PYA++++ +  GR D +    + +P L AK++AMYNP IY +   KF
Sbjct:   35 VAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKL---------TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKF 313          
BLAST of Opsin vs. Ensembl Human
Match: OPN5 (opsin 5 [Source:HGNC Symbol;Acc:HGNC:19992])

HSP 1 Score: 141.354 bits (355), Expect = 2.795e-36
Identity = 101/290 (34.83%), Postives = 155/290 (53.45%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKF 1557
            + G Y++I+GI    GN  VLY+ +  K    P  +  ++LA+ DL  S V G P   IS F  RW +G + C  YG+ G  FG  S+ TM  +SLDRY  I         L  K A I L  +W Y+  W+T P  G G+YVPE F TSCT D+ L Q S G  +F + +     ++P  +I+F Y +I+  V+    E+     ++++SH   MK           K++++I   ++++W PYA++++ +  GR D +    + +P L AK++AMYNP IY +   KF
Sbjct:   35 VAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKL---------TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKF 313          
BLAST of Opsin vs. Ensembl Celegans
Match: gar-2 (Probable muscarinic acetylcholine receptor gar-2 [Source:UniProtKB/Swiss-Prot;Acc:Q09388])

HSP 1 Score: 82.8037 bits (203), Expect = 2.503e-17
Identity = 61/210 (29.05%), Postives = 109/210 (51.90%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSF-NTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGF---QTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKM 1311
            L+ +++  + I  V+GNL VL  +   K++R P N FI SLAI DL    + G P+ T     N  W WG + C+++  I  +    SI T+  I++DRY+ + +P       T  R +++++F+WL   I  +   FGYG +   G    +T C   ++T    N   N+GMYI  +   + ++++ Y+ I +A +   L+  +  +++
Sbjct:    7 LLALFMLFLSIVTVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLI-GLEGIPVYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTPGRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMT----NPYLNMGMYISYYWTTLFVMLYLYWGIYRAAKKLALKSDQKTKRL 211          
BLAST of Opsin vs. Ensembl Celegans
Match: gar-2 (Probable muscarinic acetylcholine receptor gar-2 [Source:UniProtKB/Swiss-Prot;Acc:Q09388])

HSP 1 Score: 83.9593 bits (206), Expect = 1.110e-16
Identity = 61/210 (29.05%), Postives = 109/210 (51.90%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSF-NTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGF---QTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKM 1311
            L+ +++  + I  V+GNL VL  +   K++R P N FI SLAI DL    + G P+ T     N  W WG + C+++  I  +    SI T+  I++DRY+ + +P       T  R +++++F+WL   I  +   FGYG +   G    +T C   ++T    N   N+GMYI  +   + ++++ Y+ I +A +   L+  +  +++
Sbjct:    7 LLALFMLFLSIVTVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLI-GLEGIPVYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTPGRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMT----NPYLNMGMYISYYWTTLFVMLYLYWGIYRAAKKLALKSDQKTKRL 211          
BLAST of Opsin vs. Ensembl Celegans
Match: gar-2 (Probable muscarinic acetylcholine receptor gar-2 [Source:UniProtKB/Swiss-Prot;Acc:Q09388])

HSP 1 Score: 83.5741 bits (205), Expect = 1.273e-16
Identity = 61/210 (29.05%), Postives = 109/210 (51.90%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSF-NTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGF---QTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKM 1311
            L+ +++  + I  V+GNL VL  +   K++R P N FI SLAI DL    + G P+ T     N  W WG + C+++  I  +    SI T+  I++DRY+ + +P       T  R +++++F+WL   I  +   FGYG +   G    +T C   ++T    N   N+GMYI  +   + ++++ Y+ I +A +   L+  +  +++
Sbjct:    7 LLALFMLFLSIVTVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLI-GLEGIPVYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTPGRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMT----NPYLNMGMYISYYWTTLFVMLYLYWGIYRAAKKLALKSDQKTKRL 211          
BLAST of Opsin vs. Ensembl Celegans
Match: gar-2 (Probable muscarinic acetylcholine receptor gar-2 [Source:UniProtKB/Swiss-Prot;Acc:Q09388])

HSP 1 Score: 83.5741 bits (205), Expect = 1.482e-16
Identity = 56/174 (32.18%), Postives = 90/174 (51.72%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSF-NTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGF---QTSCTFDYLTQSKGNIIFNIGMY 1203
            L+ +++  + I  V+GNL VL  +   K++R P N FI SLAI DL    + G P+ T     N  W WG + C+++  I  +    SI T+  I++DRY+ + +P       T  R +++++F+WL   I  +   FGYG +   G    +T C   ++T    N   N+GMY
Sbjct:    7 LLALFMLFLSIVTVIGNLAVLLSYYLDKNIRQPTNYFIFSLAISDLLI-GLEGIPVYTAFYLNNNEWIWGDVLCDLWLSIDYIVCLASIYTVLGITVDRYYSVKKPATYRNWRTPGRVVLIIIFIWLVPSILFSVSIFGYGTFTGTGRILKETECYVQFMT----NPYLNMGMY 175          
BLAST of Opsin vs. Ensembl Celegans
Match: dop-2 (DOPamine receptor [Source:RefSeq peptide;Acc:NP_001024047])

HSP 1 Score: 68.9366 bits (167), Expect = 5.533e-12
Identity = 63/227 (27.75%), Postives = 112/227 (49.34%), Query Frame = 1
Query:  700 GVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQ-TMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMK--TGAKKADVQAA 1371
            G+ + ++ +  +LGNLLV+      ++L++  N  I+ LA+ DL  + +     + +   N  W  G L C+IY          SI  +A+IS DRY  ++ P Q + +S  +KR   ++  +WL SL  ++P  FG     P+     C F        N  F+I   + +F+IP  +++F Y +I+ A++  E       +K   +H  +M+  TG ++ D +AA
Sbjct:   41 GLSLIVIPLITLLGNLLVIISVLRYRALQSAINFLILGLAVADLLVAIIVMPYAVYVYVTNGDWYLGNLMCDIYMASDVCCSTASILLLAVISFDRYRAVSLPIQYSRQSQNVKRVWTLIAVIWLVSLTLASPMVFGVNVRPPDANPYECRF-------YNAEFSILSSMISFVIPCFLVLFVYIRIIIALKKREKAAKMRREKNTIAHGLTMRPDTGEEQVDEEAA 260          
BLAST of Opsin vs. Ensembl Fly
Match: Rh5 (Rhodopsin 5 [Source:FlyBase gene name;Acc:FBgn0014019])

HSP 1 Score: 188.734 bits (478), Expect = 6.628e-53
Identity = 116/319 (36.36%), Postives = 195/319 (61.13%), Query Frame = 1
Query:  628 EFESIVHPYWRTFDMVPEVYHYLVGVYIS--IVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFG-YGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1572
            E++ +VH +WR F   P  YH   G YI+  ++ +S + GN LV++IF+++KSLRTP N+ I++LAI DL F   N  P   I++       G L C+IY   GG+ G  +  T A I+ DRY  I+ P      L+  + +++++F WL++  +S  P F  +G Y PEGF T+C+FDYLT +  N +F   +++ +++IP+ +I+  YY++   VRVHE  + + A+KMN  S   +        +++ AK ++II  L++L+WTPY+++AL+   G +  + P+ + LP L  K+ +  +P++YA +HPK+R++LE
Sbjct:   32 EYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPID--GRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELE 344          
BLAST of Opsin vs. Ensembl Fly
Match: Rh5 (Rhodopsin 5 [Source:FlyBase gene name;Acc:FBgn0014019])

HSP 1 Score: 188.734 bits (478), Expect = 6.628e-53
Identity = 116/319 (36.36%), Postives = 195/319 (61.13%), Query Frame = 1
Query:  628 EFESIVHPYWRTFDMVPEVYHYLVGVYIS--IVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFG-YGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1572
            E++ +VH +WR F   P  YH   G YI+  ++ +S + GN LV++IF+++KSLRTP N+ I++LAI DL F   N  P   I++       G L C+IY   GG+ G  +  T A I+ DRY  I+ P      L+  + +++++F WL++  +S  P F  +G Y PEGF T+C+FDYLT +  N +F   +++ +++IP+ +I+  YY++   VRVHE  + + A+KMN  S   +        +++ AK ++II  L++L+WTPY+++AL+   G +  + P+ + LP L  K+ +  +P++YA +HPK+R++LE
Sbjct:   32 EYQHMVHAHWRGFREAPIYYH--AGFYIAFIVLMLSSIFGNGLVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTN-MPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPID--GRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELE 344          
BLAST of Opsin vs. Ensembl Fly
Match: ninaE (neither inactivation nor afterpotential E [Source:FlyBase gene name;Acc:FBgn0002940])

HSP 1 Score: 188.348 bits (477), Expect = 7.693e-53
Identity = 127/378 (33.60%), Postives = 204/378 (53.97%), Query Frame = 1
Query:  535 VQSFANLGNKLLEN-ATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGN----IIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATK 1653
            ++SFA    +L  + A  +N S+   V    P+   ++ PYW  F  +  ++  ++  Y+ ++G+    GN +V+YIFA+ KSLRTP N+ +++LAI D      N  P++ I+ +   W  G + C+IY  +G  FG  SI +M +ISLDRY VI +     + +TI  A+  + ++W  S IW   P FG+  YVPEG  TSC  DYL +        I ++I +Y     +        Y+ I+ AV  HE  M + A+KMN     S +   K A+ + AK++++ + L+ ++WTPY +I  M L  + + L P        FAK++A YNP +Y I+HPK+R+ L++K PC +       K  D  S A+A++
Sbjct:    1 MESFAVAAAQLGPHFAPLSNGSVVDKV---TPDMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNT-PMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAG-RPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYS----YWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAWTPYLVINCMGLF-KFEGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATASE 368          
BLAST of Opsin vs. Ensembl Fly
Match: Rh3 (Rhodopsin 3 [Source:FlyBase gene name;Acc:FBgn0003249])

HSP 1 Score: 184.882 bits (468), Expect = 2.011e-51
Identity = 117/345 (33.91%), Postives = 195/345 (56.52%), Query Frame = 1
Query:  544 FANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFF-GYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1572
            F N+   L   A  + E+     W+  PE    +  +W T+   PE  +YL+G       +  +LGN LV+++F++AKSLRTP N+ +++LA  D  F  +   P+   +SF+  +A G L C+I+G IG   G  +  T A I+ DR+ VI +P +    +T  +AI M++F+++Y+  W    +   +G +VPEG+ TSCTFDYLT +    +F   ++  +F+ P  +I + Y QIV  V  HE  +   A+KMN  S  +++    + A+++ AK ++ I FL+  SWTPY +++L+   G +  L P    +P    K  A  +PF+YAI+HP++R++L+
Sbjct:   11 FGNVSTALRPEARLSAETRLLG-WNVPPEELRHIPEHWLTYPEPPESMNYLLGTLYIFFTLMSMLGNGLVIWVFSAAKSLRTPSNILVINLAFCD--FMMMVKTPIFIYNSFHQGYALGHLGCQIFGIIGSYTGIAAGATNAFIAYDRFNVITRPME--GKMTHGKAIAMIIFIYMYATPWVVACYTETWGRFVPEGYLTSCTFDYLTDNFDTRLFVACIFFFSFVCPTTMITYYYSQIVGHVFSHEKALRDQAKKMNVESLRSNVDKNKETAEIRIAKAAITICFLFFCSWTPYGVMSLIGAFGDKTLLTPGATMIPACACKMVACIDPFVYAISHPRYRMELQ 350          
BLAST of Opsin vs. Ensembl Fly
Match: Rh2 (Rhodopsin 2 [Source:FlyBase gene name;Acc:FBgn0003248])

HSP 1 Score: 181.8 bits (460), Expect = 1.970e-50
Identity = 112/316 (35.44%), Postives = 180/316 (56.96%), Query Frame = 1
Query:  625 PEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1572
            P+   +V+PYW  F  +  +   ++G++   + I    GN +V+YIF   KSLRTP N+ +++LA  D    A    P++ I+ +   W  G L C+IY   G LFG +SI +M +I+ DRY VI +       +TIK +I+ ++F+W+ ++ W+  P  G+  YVPEG  T+C+ DY+T+      + I   +  +  P+ +I + Y+ I+ AV  HE  M + A+KMN     S +   K A+ + AK+++  + L+ ++WTPY +I    L  + D L P T      FAKTSA+YNP +Y I+HPK+RI L+
Sbjct:   36 PDMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQS-PVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGING-TPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGLF-KIDGLTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVLK 348          
BLAST of Opsin vs. Ensembl Zebrafish
Match: opn4b (opsin 4b [Source:ZFIN;Acc:ZDB-GENE-080415-3])

HSP 1 Score: 229.18 bits (583), Expect = 9.418e-66
Identity = 143/374 (38.24%), Postives = 225/374 (60.16%), Query Frame = 1
Query:  634 ESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNAS---HPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQT 1746
            + + HP+  T D VP+  HY +G  I  VGI+G++GNLLV+Y F  ++SLRTP NMFI++LA+ D     V   P+   +S + RW +G+  CE+Y F G LFG  S+ T+ +I++DRYFVI +P  ++  ++ KRA+++L   W YS+ WS PPFFG+  YVPEG  TSC++DY+T S     + + ++   F IP+ +II+CY+ I KA+R    E  +   K+N       +  K    K + + AKI++I++ LY++SW+PY+ +AL A  G  D L PY   +P + AK SA++NP IYAI HPK+R  + K  PCL        ++R ++S+  +T+ S   S+   + S L      ++   + +++
Sbjct:   52 QDVRHPF-PTVD-VPDHAHYTIGSVILAVGITGMVGNLLVMYAFCKSRSLRTPANMFIINLAVTDFLM-CVTQTPIFFTTSLHKRWIFGEKGCELYAFCGALFGICSMITLMIIAVDRYFVITRPLASIGVMSRKRALLILSAAWAYSMGWSLPPFFGWSAYVPEGLLTSCSWDYMTFSPSVRAYTMLLFTFVFFIPLFVIIYCYFFIFKAIR----ETNRAVGKINGEGGPRDSIKKIHRMKNEWKMAKIALIVILLYVISWSPYSCVALTAFAGYADMLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRSAIAKYIPCLGVLLCVPRRDRFSSSSFISTRRSTLTSQSSETSSNLHRAGKARLSSVSDSES 418          
BLAST of Opsin vs. Ensembl Zebrafish
Match: opn4a (opsin 4a (melanopsin) [Source:ZFIN;Acc:ZDB-GENE-070111-2])

HSP 1 Score: 227.639 bits (579), Expect = 6.278e-65
Identity = 133/314 (42.36%), Postives = 205/314 (65.29%), Query Frame = 1
Query:  634 ESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHP-TSMKTGAK-KADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            E  V+P+  T D VP+  HY +G  I  VGI+G+LGN LV+Y F+ +++LRTP N+FI++LAI D    A    P+   +S + RW +G+  CE+Y F G LFG  S+ T+ +I++DRYFVI +P  ++  L+ KRA+++L+  W+YSL WS PPFFG+  YVPEG  TSCT+DY+T +     + + ++I  F IP+ +II+CY+ I +++R       +   K+N  +   SMK   + K + + AKI++I++ +Y++SW+PY+ +AL A  G  D L PY   +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   60 EESVYPF-PTVD-VPDHAHYTIGAVILTVGITGMLGNFLVIYAFSRSRTLRTPANLFIINLAITDFLMCATQA-PIFFTTSMHKRWIFGEKGCELYAFCGALFGICSMITLMVIAVDRYFVITRPLASIGVLSQKRALLILLVAWVYSLGWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFIFVFFIPLIVIIYCYFFIFRSIRTTN----EAVGKINGDNKRDSMKRFQRLKNEWKMAKIALIVILMYVISWSPYSTVALTAFAGYSDFLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRLAI 366          
BLAST of Opsin vs. Ensembl Zebrafish
Match: opn4xa (opsin 4xa [Source:ZFIN;Acc:ZDB-GENE-110622-1])

HSP 1 Score: 221.09 bits (562), Expect = 3.699e-63
Identity = 146/417 (35.01%), Postives = 238/417 (57.07%), Query Frame = 1
Query:  628 EFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASA---------TKPSKYQSERESSMS---------QLDPEDDK-QVVETT-----------KNQTTSGHTNEAYESEQK 1788
            E + +   ++R  D VP+  HY+V  +++++G  GV+GNLLV+Y F S K LRTPPN FIM+LA+ D    A+   P+  I+     W +G++ C++Y F G LFG  S+  +  IS+DRY VI +P Q ++  + +R +I+++ VW+YSL WS  P  G+ +Y+PEG  TSCT+DY+T +  N  + + +    F IP+GII +CY+ +  A+R    ++ K+   +  +  T ++  + K + + AKI+ +++ +++LSW+PYA + L+A  G    L+PY+  +P + AK SA+YNPFIYAI   K+R  L +K PCL        K+   +++ S+         +  SK + +R SSMS         ++DP D K Q +  +           K QT   + N+   SE+K
Sbjct:    3 ESKDMDRGFFRKVD-VPDHAHYIVAFFVAVIGALGVIGNLLVMYAFFSNKKLRTPPNYFIMNLAVSDFLM-AITQSPIFFINCMYKEWVFGEMGCKMYAFCGALFGITSMINLLAISIDRYIVITKPLQAIRWTSGRRTLIIILVVWIYSLAWSLAPLIGWSSYIPEGLMTSCTWDYVTSTPANKSYTLMLCCFVFFIPLGIISYCYFFMFLAIRSASRDVEKLGSHVRKT--TLIQQQSIKTEWKLAKIAFVVIIVFVLSWSPYACVTLIAWAGYSHVLSPYSKAVPAVIAKASAIYNPFIYAIIRSKYRDTLAEKVPCLHFLAQSSRKDVSVSNSESSFREHMLSRQSSGSKAKFQRISSMSTADTVWSDVEIDPVDQKSQTIRNSQSASLLRDDKWKAQTKQDYQNDRESSEEK 415          
BLAST of Opsin vs. Ensembl Zebrafish
Match: opn4.1 (opsin 4.1 [Source:ZFIN;Acc:ZDB-GENE-030314-2])

HSP 1 Score: 217.238 bits (552), Expect = 5.781e-62
Identity = 121/299 (40.47%), Postives = 190/299 (63.55%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY++G  I IVGI+GV+GN LV+Y+F  +++LRT  NMFI++LA+ D   S V   P+   +S + RW +G+  CE+Y F G LFG  S+ T+  I+ DR   I QP   +  ++ ++A  +LV VWLYSL WS PPFFG+  YVPEG QTSC++DY+T +     + I +++  F IP+GII  CY+ I + +R    E+ ++      +H    +    + + + AK++++++ L+++SW+PY+++AL A  G    L PY   +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   59 VPDHAHYIIGSVILIVGITGVIGNALVVYVFCRSRTLRTAGNMFIVNLAVADFLMS-VTQSPVFFAASLHRRWVFGERPCELYAFCGALFGICSMMTLTAIAADRCLAITQPLALVSRVSRRKAGAVLVVVWLYSLGWSLPPFFGWSAYVPEGLQTSCSWDYMTFTPSVRAYTILLFVFVFFIPLGIIGSCYFAIFQTIRAAGKEIREL--DCGETHKVYERM---QNEWKMAKVALVVIVLFIISWSPYSVVALTATAGYSHFLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRVAI 351          
BLAST of Opsin vs. Ensembl Zebrafish
Match: opn4xb (opsin 4xb [Source:ZFIN;Acc:ZDB-GENE-070705-526])

HSP 1 Score: 194.512 bits (493), Expect = 9.750e-55
Identity = 125/301 (41.53%), Postives = 187/301 (62.13%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVR--VHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY++   I I+G  GV GN LV++ F S K LR+ PN FIM+LA+ D    A+   P+  I+     W +G+L C+IY F G LFG  S+  +  IS+DRY VI +P QT++  + +R  + ++ +WLYSL WS  P  G+ +Y+PEG  TSCT+DY++ S  N  + + +    F IP+ II++CY  +  +VR    +LEML  +QK +     SM++     + + AKI+ +++ +Y+LSW PYA + L+A  G +D L PY+  LP + AK+SA+YNPFIYAI H K+R  L
Sbjct:   13 VPDHVHYIIAFLILIIGTLGVSGNALVMFAFYSNKKLRSLPNYFIMNLAVSDFLM-AITQSPIFFINCLYKEWMFGELGCKIYAFCGALFGITSMINLLAISIDRYLVITKPLQTIQWNSKRRTGLAILCIWLYSLAWSLAPLIGWSSYIPEGLMTSCTWDYVSPSPANKSYTMMLCCFVFFIPLSIILYCYLFMFLSVRQASRDLEMLS-SQKSSFVKQQSMRS-----EWKLAKIAAVVIVVYVLSWAPYACVTLVAWAGHQDVLTPYSKTLPAVLAKSSAIYNPFIYAIIHNKYRATL 306          
BLAST of Opsin vs. Ensembl Xenopus
Match: OPN4 (opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449])

HSP 1 Score: 222.246 bits (565), Expect = 3.523e-64
Identity = 139/316 (43.99%), Postives = 202/316 (63.92%), Query Frame = 1
Query:  625 PEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNA-SHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            P   + V+P   T D VP+  HY+VG  I  VGI+G+LGN LV+Y F  ++SLR+P NMFI++LAI D   S V   P+   +S + RW +G+  CE+Y F G LFG  S+ T+ +I+LDRYFVI +P  ++  ++ KRA+++L  VWLYSL WS PPFFG+  YVPEG  TSCT+DY+T +     + + ++   F IP+ III+CY  I KA++     + K+    N  SH    K    K + + AKI++I++ LY++SW+PY+ +AL+A  G    L PY   +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   53 PPVATKVYP---TVD-VPDHVHYVVGAVILAVGITGMLGNFLVIYAFCRSRSLRSPANMFIINLAITDFLMS-VTQAPVFFATSLHKRWIFGEKGCELYAFCGALFGITSMITLMVIALDRYFVITRPLTSIGVMSKKRAVLILSGVWLYSLAWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFCFVFFIPLFIIIYCYIFIFKAIKNTNRAVQKIGTDDNKESHKQYQKM---KNEWKMAKIALIVILLYVVSWSPYSTVALVAFAGYASVLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRMAI 360          
BLAST of Opsin vs. Ensembl Xenopus
Match: ENSXETT00000041634.3 (melanopsin-B-like [Source:Xenbase;Acc:XB-GENE-5957216])

HSP 1 Score: 182.185 bits (461), Expect = 2.353e-49
Identity = 115/297 (38.72%), Postives = 171/297 (57.58%), Query Frame = 1
Query:  676 PEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVR-VHELEMLKMAQKMNASHPTSMKTG-AKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            P    Y +G +I I+G  G++GNLLVLY F S K LRT PN FIM+LAI D   SA    P+  +SS +  W  G++ C +Y F G LFG  S+ T+  IS++RY VI +P Q+++  + KR + ++V VW+YS +WS  P  G+ +YVPEG + SCT+DY+T +  N  + + +    F IP+ II  CY+ +  A+R       ++  Q++ A   T    G  +K ++  + + VI+V     S T +    L +  G    L PY+  +P + AK SA+YNP IY I HPK+R
Sbjct:   18 PAQVLYTIGSFILIIGFVGIIGNLLVLYAFYSNKKLRTAPNYFIMNLAISDFLMSATQA-PVCFLSSLHREWILGEIGCNVYAFCGALFGITSMMTLLAISVNRYIVITKPLQSIQWSSKKRTLQVIVLVWMYSFMWSLAPLLGWSSYVPEGLRISCTWDYVTSTTSNKSYTMMLCCCVFFIPLIIISHCYFFMFLAIRSTGRQRSVQKEQQVEARGFTCSSGGIQRKRELGKSPLYVIVVLTLKGSITNH--YTLKSYMGHGKSLTPYSKTVPAVIAKASAIYNPIIYGIIHPKYR 311          
BLAST of Opsin vs. Ensembl Xenopus
Match: opn5 (opsin 5 [Source:Xenbase;Acc:XB-GENE-1018909])

HSP 1 Score: 131.339 bits (329), Expect = 1.607e-33
Identity = 99/330 (30.00%), Postives = 168/330 (50.91%), Query Frame = 1
Query:  574 NATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFD-YLTQS--KGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPK 1554
            N+++  ES       + P +E    P+        +++    GVY+  +GI   LGN  V+Y+  S K    P  +  ++LA+ DL  S V G P   +S F+ RW +G   C  YG+ G  FG  S+ T+ ++SLDRY  I    +    L  + A I L  +W Y+ +W+T P  G GNY PE F T+CT D +L Q+  KG  IF + M     + P  +I+F Y +I+  V+    E+     +   +H           +++  K++++I   ++++W PYA++++ +  G+ D +    + +P + AK+++MYNP IY +   K
Sbjct:    6 NSSYREES------GYIPHYERDSDPFASKLSREADIF---AGVYLMAIGILSTLGNGYVIYMACSRKKKLRPAEIMTINLAVCDLGIS-VTGKPFAIVSCFSHRWVFGWNACRWYGWAGFFFGCGSLITLTVVSLDRYLKICH-LRYGTWLKRRHAFIALAVIWAYATLWATLPLVGVGNYAPEPFGTTCTLDWWLAQASVKGQ-IFVLSMLFFCLLFPTMVIVFSYAKIIAKVKSSAKEVAHFDTRNQNNH---------TLEIKLTKVAMLICAGFLIAWFPYAVVSVWSAFGQPDSIPIELSVVPTMMAKSASMYNPIIYQVIDCK 314          
BLAST of Opsin vs. Ensembl Xenopus
Match: tmtops.2 (multiple tissue opsin, gene 2 [Source:Xenbase;Acc:XB-GENE-1018917])

HSP 1 Score: 125.561 bits (314), Expect = 1.617e-31
Identity = 87/284 (30.63%), Postives = 162/284 (57.04%), Query Frame = 1
Query:  688 HYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLT-IKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIY 1536
            H LV V++ ++G  G   NL+VL +F   K LR+P NM +M++++ DL    + G P    +S    W  G++ C  YGF+  LFG +S+ ++A++S +RY  + +   T   LT  K+A + ++  W+YSL+W+ PP FG+  Y PEG  T+C+ ++ ++   NI + + ++I    +P  +I++CY +++ A++          Q    S     K+ ++  + +   + +++V  ++L W PY ++AL+A  G+   ++P  + +P + AK+S +YNP IY
Sbjct:   39 HLLVAVFLGVIGSLGFFNNLVVLILFCQYKVLRSPINMLLMNISLSDLMV-CILGTPFSFAASTQGHWLIGEIGCIWYGFVNTLFGTVSLVSLAVLSYERYCTMLR--STEADLTNYKKAWLGILVSWIYSLVWTLPPLFGWSKYGPEGPGTTCSVNWHSRDANNISYIVCLFIFCLALPFAVIVYCYGRLLFAIK----------QVSGVS-----KSSSRAREQRVLIMVIVMVVCFLLCWLPYGVMALVATFGKPGIISPSASIIPSVLAKSSTVYNPIIY 304          
BLAST of Opsin vs. Ensembl Xenopus
Match: rho (rhodopsin [Source:Xenbase;Acc:XB-GENE-966887])

HSP 1 Score: 119.783 bits (299), Expect = 3.647e-29
Identity = 86/290 (29.66%), Postives = 153/290 (52.76%), Query Frame = 1
Query:  697 VGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSK--GNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            +  Y+ ++ + G   N + LY+    K LRTP N  +++L   +  F  + GF +   +S +  + +G+  C I GF   L G +++ ++ +++++RY V+ +P    +      AI+ +VF W+ +L  + PP FG+  Y+PEG Q SC  DY T      N  F + M+I +F IP+ +I FCY +++  V+       + A +   S  T      +KA+ +  ++ V++V  +++ W PYA +A    T +     P    +P  FAK+SA+YNP IY + + +FR
Sbjct:   40 LAAYMFLLILLGFPINFMTLYVTIQHKKLRTPLNYILLNLVFAN-HFMVLCGFTVTMYTSMHGYFIFGQTGCYIEGFFATLGGEMALWSLVVLAIERYVVVCKPMANFR-FGENHAIMGVVFTWIMALSCAAPPLFGWSRYIPEGMQCSCGVDYYTLKPEVNNESFVVYMFIVHFTIPLCVIFFCYGRLLCTVK-------EAAAQQQESATT------QKAEKEVTRMVVMMVIFFLICWVPYAYVAFYIFTHQGSDFGPVFMTVPAFFAKSSAIYNPVIYIVLNKQFR 314          
BLAST of Opsin vs. Ensembl Mouse
Match: Opn4 (opsin 4 (melanopsin) [Source:MGI Symbol;Acc:MGI:1353425])

HSP 1 Score: 201.83 bits (512), Expect = 1.166e-56
Identity = 120/300 (40.00%), Postives = 186/300 (62.00%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNAS-HPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY +G  I +VG++G+LGNL V+Y F   + LRTP NMFI++LA+ D   S V   P+   SS   +W +G+  CE Y F G +FG  S+ T+  I++DRY VI +P  T+   + +R  ++L+ VWLY+L WS PPFFG+  YVPEG  TSC++DY+T +     + + ++   F +P+ IIIFCY  I +A+R    E  +  +    S      +    +++ + AK+++I++ L++LSW PY+ +AL+A  G    L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   64 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMS-VTQAPVFFASSLYKKWLFGETGCEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGRGSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMTFTPQVRAYTMLLFCFVFFLPLLIIIFCYIFIFRAIR----ETGRACEGCGESPLRQRRQWQRLQSEWKMAKVALIVILLFVLSWAPYSTVALVAFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 358          
BLAST of Opsin vs. Ensembl Mouse
Match: Opn4 (opsin 4 (melanopsin) [Source:MGI Symbol;Acc:MGI:1353425])

HSP 1 Score: 201.83 bits (512), Expect = 3.726e-56
Identity = 120/300 (40.00%), Postives = 186/300 (62.00%), Query Frame = 1
Query:  673 VPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNAS-HPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            VP+  HY +G  I +VG++G+LGNL V+Y F   + LRTP NMFI++LA+ D   S V   P+   SS   +W +G+  CE Y F G +FG  S+ T+  I++DRY VI +P  T+   + +R  ++L+ VWLY+L WS PPFFG+  YVPEG  TSC++DY+T +     + + ++   F +P+ IIIFCY  I +A+R    E  +  +    S      +    +++ + AK+++I++ L++LSW PY+ +AL+A  G    L PY + +P + AK SA++NP IYAI HPK+R+ +
Sbjct:   64 VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMS-VTQAPVFFASSLYKKWLFGETGCEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGRGSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMTFTPQVRAYTMLLFCFVFFLPLLIIIFCYIFIFRAIR----ETGRACEGCGESPLRQRRQWQRLQSEWKMAKVALIVILLFVLSWAPYSTVALVAFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAI 358          
BLAST of Opsin vs. Ensembl Mouse
Match: Rrh (retinal pigment epithelium derived rhodopsin homolog [Source:MGI Symbol;Acc:MGI:1097709])

HSP 1 Score: 143.28 bits (360), Expect = 2.597e-37
Identity = 92/293 (31.40%), Postives = 163/293 (55.63%), Query Frame = 1
Query:  688 HYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSM--KTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            H ++  Y+ + GI+ +L N++VL IF   K LRTP N  I++LA  D+  S++ G+P+   S  +  W +G   C+IY  +   FG +SI  + ++++DRY  I+ P    + +T    + M++  W+  L W+  P  G+ +Y P+    +CT ++       + + + + + NFI+P+ ++ +CYY + +++R++            AS  T+   +  A +ADV   K+SVI++ +++L+W+PY+I+ L A  G    + P  A +  LFAK+S  YNP IY   H KFR
Sbjct:   25 HSVIAAYLIVAGITSILSNVVVLGIFIKYKELRTPTNAVIINLAFTDIGVSSI-GYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVAMDRYLTISCP-DVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRNNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYA-----------ASDCTAHLHRDWADQADVT--KMSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKKFR 302          
BLAST of Opsin vs. Ensembl Mouse
Match: Rrh (retinal pigment epithelium derived rhodopsin homolog [Source:MGI Symbol;Acc:MGI:1097709])

HSP 1 Score: 143.28 bits (360), Expect = 2.597e-37
Identity = 92/293 (31.40%), Postives = 163/293 (55.63%), Query Frame = 1
Query:  688 HYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSM--KTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            H ++  Y+ + GI+ +L N++VL IF   K LRTP N  I++LA  D+  S++ G+P+   S  +  W +G   C+IY  +   FG +SI  + ++++DRY  I+ P    + +T    + M++  W+  L W+  P  G+ +Y P+    +CT ++       + + + + + NFI+P+ ++ +CYY + +++R++            AS  T+   +  A +ADV   K+SVI++ +++L+W+PY+I+ L A  G    + P  A +  LFAK+S  YNP IY   H KFR
Sbjct:   25 HSVIAAYLIVAGITSILSNVVVLGIFIKYKELRTPTNAVIINLAFTDIGVSSI-GYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVAMDRYLTISCP-DVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRNNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYA-----------ASDCTAHLHRDWADQADVT--KMSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKKFR 302          
BLAST of Opsin vs. Ensembl Mouse
Match: Opn5 (opsin 5 [Source:MGI Symbol;Acc:MGI:2662912])

HSP 1 Score: 139.043 bits (349), Expect = 1.668e-35
Identity = 98/290 (33.79%), Postives = 154/290 (53.10%), Query Frame = 1
Query:  694 LVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDY-LTQ-SKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKF 1557
            + G Y++I+GI    GN  VLY+ +  K    P  +  ++LA+ DL  S V G P   IS F  RW +G   C  YG+ G  FG  S+ TM  +SLDRY  I         L  K A I L  +W Y+  W+T P  G G+Y PE F TSCT D+ L Q S G  +F + +     ++P  +I+F Y +I+  V+    E+     ++++SH           +V+  K++++I   ++++W PYA++++ +  GR D +    + +P L AK++AMYNP IY +   +F
Sbjct:   35 VAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVV-GKPFTIISCFCHRWVFGWFGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICY-LSYGVWLKRKHAYICLAVIWAYASFWTTMPLVGLGDYAPEPFGTSCTLDWWLAQASGGGQVFILSILFFCLLLPTAVIVFSYAKIIAKVKSSSKEVAHFDSRIHSSHVL---------EVKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYRF 313          
BLAST of Opsin vs. UniProt
Match: sp|P09241|OPSD_ENTDO (Rhodopsin OS=Enteroctopus dofleini GN=RHO PE=1 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.503e-97
Identity = 161/322 (50.00%), Postives = 236/322 (73.29%), Query Frame = 1
Query:  595 SLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            +L    W ++P  +  +HP+W  FD +P+  +Y VG++I +VGI G+LGN +V+Y+F+  KSL+TP NMFI++LA+ DL+FSA+NGFPL TIS+F  +W +GK+ C++YG +GG+FGF+SINTMA+IS+DRY VI +P    K ++ +RA +M++FVW++S++WS  P F +G YVPEG  TSC+FDYL+       F + MY   F++P+ II FCY+ IV +V  HE EM  MA+++NA      + GA  A+++ AKIS++I+  +MLSW+PYAIIAL+A  G  + + PY AELPVLFAK SA++NP +Y+++HPKFR
Sbjct:    6 TLVNQTWWYNPTVD--IHPHWAKFDPIPDAVYYSVGIFIGVVGIIGILGNGVVIYLFSKTKSLQTPANMFIINLAMSDLSFSAINGFPLKTISAFMKKWIFGKVACQLYGLLGGIFGFMSINTMAMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSIVWSVGPVFNWGAYVPEGILTSCSFDYLSTDPSTRSFILCMYFCGFMLPIIIIAFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISMVIITQFMLSWSPYAIIALLAQFGPAEWVTPYAAELPVLFAKASAIHNPIVYSVSHPKFR 324          
BLAST of Opsin vs. UniProt
Match: sp|O15973|OPSD1_MIZYE (Rhodopsin, GQ-coupled OS=Mizuhopecten yessoensis GN=SCOP1 PE=1 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 4.349e-89
Identity = 151/327 (46.18%), Postives = 236/327 (72.17%), Query Frame = 1
Query:  589 NESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQL 1569
            N S+T +   W+  ++  VH +W  F  V E +HY++GVYI+IVG+ G++GN  V+YIF++ KSLR+P N+F+++LA+ DL FSAVNGFPLLT+SSF+ +W +G L C++YGF+GG+FG +SINT+  IS+DRY VI +P Q  +++T ++  +M+V VW+ S++ S PPFFG+G Y+PEGFQTSCTFDYLT++     + + +Y+  F+IP+ II  CY  I++ VR H+ +ML + + M      +    A +++++ +KI++ +  L+++SW+PYAIIAL+A  G    + P  +ELP++ AK+S+M+NP +YA++HPKFR  L
Sbjct:   19 NRSMTPNT-GWEGPYDMSVHLHWTQFPPVTEEWHYIIGVYITIVGLLGIMGNTTVVYIFSNTKSLRSPSNLFVVNLAVSDLIFSAVNGFPLLTVSSFHQKWIFGSLFCQLYGFVGGVFGLMSINTLTAISIDRYVVITKPLQASQTMTRRKVHLMIVIVWVLSILLSIPPFFGWGAYIPEGFQTSCTFDYLTKTARTRTYIVVLYLFGFLIPLIIIGVCYVLIIRGVRRHDQKMLTITRSMKTEDARANNKRA-RSELRISKIAMTVTCLFIISWSPYAIIALIAQFGPAHWITPLVSELPMMLAKSSSMHNPVVYALSHPKFRKAL 343          
BLAST of Opsin vs. UniProt
Match: sp|P24603|OPSD_LOLFO (Rhodopsin OS=Loligo forbesi GN=RHO PE=1 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 1.400e-87
Identity = 163/361 (45.15%), Postives = 244/361 (67.59%), Query Frame = 1
Query:  613 WHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQ---SKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESS 1686
            W ++P  +  +HP+W+ FD VP   +Y +G++I+I GI G +GN +V+Y+F   KSL+TP NMFI++LA  D TFS VNGFPL+TIS F   W +G   C++YG IGG+FG +SI TM +IS+DRY VI +P    K ++ ++A IM++FVW++S IW+  P FG+G Y  EG   +C+FDY+T+   ++ NI   + MYI  F+ P+ +I FCY+ IV +V  HE EM  MA+++NA      + GA  A+++ AKIS++IV  ++LSW+PYA++AL+A  G  + + PY A+LPV+FAK SA++NP IY+++HPKFR ++   FP ++ CC    KE +    A A  P+  QS  E++
Sbjct:   11 WWYNPYMD--IHPHWKQFDQVPAAVYYSLGIFIAICGIIGCVGNGVVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFMKYWVFGNAACKVYGLIGGIFGLMSIMTMTMISIDRYNVIGRPMSASKKMSHRKAFIMIIFVWIWSTIWAIGPIFGWGAYTLEGVLCNCSFDYITRDTTTRSNI---LCMYIFAFMCPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-NAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPMIYSVSHPKFRERIASNFPWILTCCQYDEKEIEDDKDAEAEIPAGEQSGGETA 365          
BLAST of Opsin vs. UniProt
Match: sp|Q17094|OPSD_ALLSU (Rhodopsin (Fragment) OS=Alloteuthis subulata GN=RHO PE=1 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 1.494e-85
Identity = 162/357 (45.38%), Postives = 235/357 (65.83%), Query Frame = 1
Query:  613 WHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERES 1683
            W ++P  +  +H +W+ FD VP   +Y +G++I+I GI G  GN +V+Y+F   KSL+TP NMFI++LA  D TFS VNGFP++TIS F   W +G+  C++YG IGG+FG  SI TM +IS+DRY VI +P    K ++ ++A IM+VFVW++S IW+  P FG+G Y  EG   +C+FDY+T+        + MYI  F+ P+ +I FCY+ IV +V  HE EM  MA+++NA      + GA  A+++ AKIS++IV   +LSW+PYAI+AL+A  G  + + PY A+LPV+FAK SA++NP IY+++HPKFR  +   FP ++ CC    KE +    A A  P+  QS  ES
Sbjct:    4 WWYNPYMD--IHSHWKQFDQVPAAVYYSLGIFIAICGIIGCAGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPMMTISCFLKHWVFGQAACKVYGLIGGIFGLTSIMTMTMISIDRYNVIRRPMSASKKMSHRKAFIMIVFVWIWSTIWAIGPIFGWGAYQLEGVLCNCSFDYITRDASTRSNIVCMYIFAFMFPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISIVIVTQSLLSWSPYAIVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPMIYSVSHPKFREAIASNFPWILTCCQYDEKEIEDDKDAEAEIPAAEQSGGES 357          
BLAST of Opsin vs. UniProt
Match: sp|O16005|OPSD_SEPOF (Rhodopsin OS=Sepia officinalis GN=RHO PE=2 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 5.534e-81
Identity = 167/358 (46.65%), Postives = 241/358 (67.32%), Query Frame = 1
Query:  613 WHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESS 1686
            W ++P  E  VHP+W+ F+ VP+  +Y +G++I I GI G  GN +V+Y+F   KSL+TP NMFI++LA  D TFS VNGFPL+TIS F  +W +G   C++YGFIGG+FG +SI TM++IS+DRY VI +P    K ++ +RA +M++FVW++S +WS  P FG+G YV EG   +C+FDY+T+        + MYI  F  P+ II FCY+ IV AV  HE EM  MA+++NA      + GA  A+++ AKIS++IV  ++LSW+PYA++AL+A  G  + + PY A+LPV+FAK SA++NP IY+++HPKFR  + + FP +I CC    KE +    A    P+  QS  ES+
Sbjct:   11 WWYNPTME--VHPHWKQFNQVPDAVYYSLGIFIGICGIIGCTGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFIKKWVFGMAACKVYGFIGGIFGLMSIMTMSMISIDRYNVIGRPMAASKKMSHRRAFLMIIFVWMWSTLWSIGPIFGWGAYVLEGVLCNCSFDYITRDSATRSNIVCMYIFAFCFPILIIFFCYFNIVMAVSNHEKEMAAMAKRLNAKELRKAQAGA-SAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLPVMFAKASAIHNPLIYSVSHPKFREAIAENFPWIITCCQFDEKEVEDDKDAETEIPATEQSGGESA 365          
BLAST of Opsin vs. TrEMBL
Match: tr|A0A0F7CAN1|A0A0F7CAN1_DUGJA (Opsin OS=Dugesia japonica PE=2 SV=1)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 324/344 (94.19%), Postives = 335/344 (97.38%), Query Frame = 1
Query:  529 MSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 1560
            M++ S   +G K+LENAT +N SL+KS WHWDPEFESIVHPYWRTFDMVPEVYHYLVGV+ISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFN RWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGN+IFNIGMYIGNF+IPVGIIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKIS+IIVFLY+LSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR
Sbjct:    1 MAIHSLVGIGQKILENATSDNASLSKSPWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVFISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNHRWAWGKLTCEIYGFIGGLFGFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNVIFNIGMYIGNFVIPVGIIIFCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISIIIVFLYLLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFR 344          
BLAST of Opsin vs. TrEMBL
Match: tr|T1D132|T1D132_9PLAT (Opsin OS=Dendrocoelum lacteum PE=2 SV=1)

HSP 1 Score: 480.715 bits (1236), Expect = 1.870e-162
Identity = 271/326 (83.13%), Postives = 296/326 (90.80%), Query Frame = 1
Query:  808 MSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESSMSQLDPEDDKQVVETTKNQTTSGHTNEAYESEQ 1785
            MSLAIGDLTF AVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTM LISLDRYFVIAQPFQ MK+LT+KRAI+M+V  W+YS IW++PPF+GYG+YVPEGFQTSCTFDYLTQSKGNIIFNIGMYI NF++PV IIIFCYYQIVKAVR+HELEMLKMA +MNA+HPTSMKTG+KKAD+QAAKISVIIVFLY+LSWTPYAIIALMALTG+RDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKK PCLICCCPPK KER+ TSA SATKP++YQSE+ES+MSQLD E         KNQ  S  TN  YE ++
Sbjct:    1 MSLAIGDLTFLAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLFGFISINTMVLISLDRYFVIAQPFQGMKALTMKRAIVMVVLAWVYSFIWASPPFWGYGSYVPEGFQTSCTFDYLTQSKGNIIFNIGMYICNFLLPVTIIIFCYYQIVKAVRLHELEMLKMAHQMNATHPTSMKTGSKKADIQAAKISVIIVFLYLLSWTPYAIIALMALTGKRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEKKLPCLICCCPPKAKEREMTSAVSATKPTRYQSEKESTMSQLDSE------APPKNQDGSCKTNNGYEEDK 320          
BLAST of Opsin vs. TrEMBL
Match: tr|A0A1I8IF11|A0A1I8IF11_9PLAT (Uncharacterized protein OS=Macrostomum lignano PE=4 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 1.335e-135
Identity = 237/392 (60.46%), Postives = 310/392 (79.08%), Query Frame = 1
Query:  613 WHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESSM-SQLDPEDDKQVVETTKNQTTSGHTNEAYESEQ 1785
            W WDPEFE+++HP+WR F  VPE++HYLVG+YIS+VGI G +GNLLVL+IF + K+LRTPPN+F+++LAI DL+FS + GFPLLTISSFN RWAWG+L CE+YGF GG+ GF+SI+T+ALIS+DRYFVIAQPF+ +K LT  RAI+M+ F W  +L+W+ PPFFGYG +VPEGFQTSCTFDYL+Q KGN+IFN  MY   F++P+ II FCYY+IV+AVR HELE++KMA KM      SMK+  +K+D++ AKI++I + LY+LSWTPYA +A ++L G+RDHLN YT+ELPVL AKTSA+YNP IY+++HPKFR  LEKKFP L+CCCPPK KER+ TS+A  +K S+  +E++S   SQ  PED            T G+ N+ YE+++
Sbjct: 1085 WAWDPEFEALIHPFWRQFPPVPELHHYLVGIYISVVGIIGDVGNLLVLFIFVTTKALRTPPNIFLVNLAISDLSFSVIMGFPLLTISSFNGRWAWGRLACELYGFFGGVLGFVSIHTLALISMDRYFVIAQPFEALKRLTYTRAIVMVFFAWSLALLWAIPPFFGYGYFVPEGFQTSCTFDYLSQDKGNLIFNGLMYSCGFVLPLSIIFFCYYKIVRAVRSHELELIKMATKMGGH---SMKSADQKSDLKTAKIALITISLYLLSWTPYATVAFLSLIGKRDHLNQYTSELPVLAAKTSAIYNPIIYSLSHPKFRAVLEKKFPWLLCCCPPKAKEREATSSA-GSKFSRRDTEKDSGFPSQRAPEDGAAAPPA----ITEGNENKGYETDR 1468          
BLAST of Opsin vs. TrEMBL
Match: tr|A0A1I8I7K6|A0A1I8I7K6_9PLAT (Uncharacterized protein OS=Macrostomum lignano PE=4 SV=1)

HSP 1 Score: 444.121 bits (1141), Expect = 4.510e-134
Identity = 237/392 (60.46%), Postives = 310/392 (79.08%), Query Frame = 1
Query:  613 WHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLEXXXXXXXXXXXXXXXERDTTSAASATKPSKYQSERESSM-SQLDPEDDKQVVETTKNQTTSGHTNEAYESEQ 1785
            W WDPEFE+++HP+WR F  VPE++HYLVG YIS+VGI G +GN+LVL+IF + K+LRTPPN+F+++LAI DL+FS + GFPLLTISSFN RWAWG+L CE+YGF GG+ GF+SI+T+ALIS+DRYFVIAQPF+ +K LT  RAI+M+ F WL +L+W+ PPFFGYG +VPEGFQTSCTFDYL+Q KGN+IFN  MY   F++P+ II FCYY+IV+AVR HELE++KMA KM      SMK+  +K+D++ AKI++I + LY+LSWTPYA +A ++L G+RDHLN YT+ELPVL AKTSA+YNP IY+++HPKFR  LEKKFP L+CCCPPK KER+ TS+A  +K S+  +E++S   SQ  PED            T G+ N+ YE+++
Sbjct: 1678 WAWDPEFEALIHPFWRQFPPVPELHHYLVGFYISVVGIIGDVGNMLVLFIFVTTKALRTPPNIFLVNLAISDLSFSVIMGFPLLTISSFNGRWAWGRLACELYGFFGGVLGFVSIHTLALISMDRYFVIAQPFEALKRLTYTRAIVMVFFAWLLALLWAIPPFFGYGYFVPEGFQTSCTFDYLSQDKGNLIFNGLMYSCGFVLPLSIIFFCYYKIVRAVRSHELELIKMATKMGGH---SMKSADQKSDLKTAKIALITISLYLLSWTPYATVAFLSLIGKRDHLNQYTSELPVLAAKTSAIYNPIIYSLSHPKFRAVLEKKFPWLLCCCPPKAKEREATSSA-GSKFSRRDTEKDSGFPSQRAPEDGA----AAPPAITEGNENKGYETDR 2061          
BLAST of Opsin vs. TrEMBL
Match: tr|A0A074ZMB6|A0A074ZMB6_9TREM (Uncharacterized protein OS=Opisthorchis viverrini GN=T265_04946 PE=3 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 9.119e-124
Identity = 190/321 (59.19%), Postives = 251/321 (78.19%), Query Frame = 1
Query:  610 VWHWDPEFESIVHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTPPNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEXXXXXXXXXXXXXXNTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWSTPPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYXXXXXXXXXXXXXCYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIVFLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAINHPKFRIQLE 1572
            +W  DPEF SIVHPYW  F +   +YHY VG +I+I+  + +LGN+LV+ +F+  K LRTP N+ I++LAI DL+FS +NGFPL TISS N RW WGKL C++YGFIGG+ GF S+ T A+I+LDRYFVIAQP Q    ++  RA +ML   W+++L+WS PPFFG G Y+PEGF TSCTFDYL+   GN++FN GMYI  F++P+ +I +CYYQIVK VR +E+E++KMAQK+NA +PTSMK+  KKADV+AAK S+I+V LY+++WTPYA++ LM L G+ D L+P  +ELPVLFAKTSA+YNP +YAI HPKFR++LE
Sbjct:   14 LWPDDPEFFSIVHPYWHKFPVPDPLYHYFVGAFITIMCTTAILGNILVITLFSLCKQLRTPANLLIINLAINDLSFSMINGFPLKTISSINQRWTWGKLACQLYGFIGGVAGFGSLTTNAMIALDRYFVIAQPIQAFTRMSYLRAFVMLAICWIWALLWSLPPFFGIGYYIPEGFHTSCTFDYLSTDLGNMLFNAGMYIFGFMMPLMVICYCYYQIVKTVRRNEIELMKMAQKLNAENPTSMKSTDKKADVEAAKTSIILVLLYLVAWTPYAVVCLMVLLGKMDDLSPIGSELPVLFAKTSAVYNPIVYAIRHPKFRMELE 334          
The following BLAST results are available for this feature:
BLAST of Opsin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
OPN43.140e-5640.40opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449][more]
OPN41.256e-5339.30opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449][more]
OPN41.265e-5339.30opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449][more]
OPN52.644e-3634.83opsin 5 [Source:HGNC Symbol;Acc:HGNC:19992][more]
OPN52.795e-3634.83opsin 5 [Source:HGNC Symbol;Acc:HGNC:19992][more]
back to top
BLAST of Opsin vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
gar-22.503e-1729.05Probable muscarinic acetylcholine receptor gar-2 ... [more]
gar-21.110e-1629.05Probable muscarinic acetylcholine receptor gar-2 ... [more]
gar-21.273e-1629.05Probable muscarinic acetylcholine receptor gar-2 ... [more]
gar-21.482e-1632.18Probable muscarinic acetylcholine receptor gar-2 ... [more]
dop-25.533e-1227.75DOPamine receptor [Source:RefSeq peptide;Acc:NP_0... [more]
back to top
BLAST of Opsin vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
Rh56.628e-5336.36Rhodopsin 5 [Source:FlyBase gene name;Acc:FBgn0014... [more]
Rh56.628e-5336.36Rhodopsin 5 [Source:FlyBase gene name;Acc:FBgn0014... [more]
ninaE7.693e-5333.60neither inactivation nor afterpotential E [Source:... [more]
Rh32.011e-5133.91Rhodopsin 3 [Source:FlyBase gene name;Acc:FBgn0003... [more]
Rh21.970e-5035.44Rhodopsin 2 [Source:FlyBase gene name;Acc:FBgn0003... [more]
back to top
BLAST of Opsin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
opn4b9.418e-6638.24opsin 4b [Source:ZFIN;Acc:ZDB-GENE-080415-3][more]
opn4a6.278e-6542.36opsin 4a (melanopsin) [Source:ZFIN;Acc:ZDB-GENE-07... [more]
opn4xa3.699e-6335.01opsin 4xa [Source:ZFIN;Acc:ZDB-GENE-110622-1][more]
opn4.15.781e-6240.47opsin 4.1 [Source:ZFIN;Acc:ZDB-GENE-030314-2][more]
opn4xb9.750e-5541.53opsin 4xb [Source:ZFIN;Acc:ZDB-GENE-070705-526][more]
back to top
BLAST of Opsin vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
OPN43.523e-6443.99opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449][more]
ENSXETT00000041634.32.353e-4938.72melanopsin-B-like [Source:Xenbase;Acc:XB-GENE-5957... [more]
opn51.607e-3330.00opsin 5 [Source:Xenbase;Acc:XB-GENE-1018909][more]
tmtops.21.617e-3130.63multiple tissue opsin, gene 2 [Source:Xenbase;Acc:... [more]
rho3.647e-2929.66rhodopsin [Source:Xenbase;Acc:XB-GENE-966887][more]
back to top
BLAST of Opsin vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Opn41.166e-5640.00opsin 4 (melanopsin) [Source:MGI Symbol;Acc:MGI:13... [more]
Opn43.726e-5640.00opsin 4 (melanopsin) [Source:MGI Symbol;Acc:MGI:13... [more]
Rrh2.597e-3731.40retinal pigment epithelium derived rhodopsin homol... [more]
Rrh2.597e-3731.40retinal pigment epithelium derived rhodopsin homol... [more]
Opn51.668e-3533.79opsin 5 [Source:MGI Symbol;Acc:MGI:2662912][more]
back to top
BLAST of Opsin vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P09241|OPSD_ENTDO1.503e-9750.00Rhodopsin OS=Enteroctopus dofleini GN=RHO PE=1 SV=... [more]
sp|O15973|OPSD1_MIZYE4.349e-8946.18Rhodopsin, GQ-coupled OS=Mizuhopecten yessoensis G... [more]
sp|P24603|OPSD_LOLFO1.400e-8745.15Rhodopsin OS=Loligo forbesi GN=RHO PE=1 SV=1[more]
sp|Q17094|OPSD_ALLSU1.494e-8545.38Rhodopsin (Fragment) OS=Alloteuthis subulata GN=RH... [more]
sp|O16005|OPSD_SEPOF5.534e-8146.65Rhodopsin OS=Sepia officinalis GN=RHO PE=2 SV=1[more]
back to top
BLAST of Opsin vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A0A0F7CAN1|A0A0F7CAN1_DUGJA0.000e+094.19Opsin OS=Dugesia japonica PE=2 SV=1[more]
tr|T1D132|T1D132_9PLAT1.870e-16283.13Opsin OS=Dendrocoelum lacteum PE=2 SV=1[more]
tr|A0A1I8IF11|A0A1I8IF11_9PLAT1.335e-13560.46Uncharacterized protein OS=Macrostomum lignano PE=... [more]
tr|A0A1I8I7K6|A0A1I8I7K6_9PLAT4.510e-13460.46Uncharacterized protein OS=Macrostomum lignano PE=... [more]
tr|A0A074ZMB6|A0A074ZMB6_9TREM9.119e-12459.19Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 4..23
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 66..391
e-value: 5.1E-84
score: 281.3
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 57..384
NoneNo IPR availableTMHMMTMhelixcoord: 302..324
NoneNo IPR availableTMHMMTMhelixcoord: 237..259
NoneNo IPR availableTMHMMTMhelixcoord: 76..98
NoneNo IPR availableTMHMMTMhelixcoord: 148..170
NoneNo IPR availableTMHMMTMhelixcoord: 191..213
NoneNo IPR availableTMHMMTMhelixcoord: 2..24
NoneNo IPR availableTMHMMTMhelixcoord: 111..133
NoneNo IPR availableTMHMMTMhelixcoord: 5..24
NoneNo IPR availableTMHMMTMhelixcoord: 15..36
NoneNo IPR availableTMHMMTMhelixcoord: 43..60
NoneNo IPR availableTMHMMTMhelixcoord: 24..46
NoneNo IPR availableTMHMMTMhelixcoord: 29..51
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 337..363
score: 28.98
coord: 75..99
score: 27.58
coord: 154..176
score: 31.16
coord: 299..323
score: 25.7
coord: 108..129
score: 29.78
coord: 190..211
score: 28.02
coord: 240..263
score: 26.6
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 81..370
e-value: 0.0017
score: -57.9
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 90..355
e-value: 1.1E-50
score: 172.2
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 160..176
IPR001760OpsinPRINTSPR00238OPSINcoord: 334..346
score: 38.27
coord: 96..108
score: 45.03
coord: 212..224
score: 52.1
IPR027430Visual pigments (opsins) retinal binding sitePROSITEPS00238OPSINcoord: 339..355
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 90..355
score: 42.559

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR001760Opsin
IPR027430Retinal_BS
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007601visual perception
GO:0007165signal transduction
GO:0007602phototransduction
GO:0018298protein-chromophore linkage
GO:0050896response to stimulus
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
GO:0009881photoreceptor activity
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000007Stage 7
PLANA:0000008Stage 8
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000036eye
PLANA:0000124visual system
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30030594 ID=SMED30030594|Name=Opsin|organism=Schmidtea mediterranea sexual|type=transcript|length=1880bp
AATAAAATGAAATTTATAATGCCATTGGTATTTACACTGTGGTTAATAAC
GATAATAATCAGAATTTTTAATGATAAATATAGTAAACGATAACTAGTAA
CGGTAACCCTAATAATGAATGCTATATTACATATAGTAGTGTTACCAAAA
TTTTGGAATTTAAAATAATAAGTTTATTATGAGTGACCATGATAATAAAA
AAGATTTTTAAATAAAATGATAATATTACTATATAGTCGGTTATAGTTCC
GATTAGTCTACTATCGTAGACGTAATAAAAAGAGTTTAGTAACCTAATTT
TCAATGTTTTTTGAAAGTTGCTCGTCTCTATGGCAACTTATTATCGTAAG
GAAAATTTTCTACTTCACTATGATATTTTCGGAGTGAATTTATTGATTTA
CATTCAAGGACTTTCACTATTGCATTTACTGAAGCGATCGTTTCATTTGG
AACTCATATTTTCGCCCCTAATCGTTCTGGAATTTATTATTTATGATCCT
TTATCTGACCTTAAAAATTTTCATATTCATGAGTGTCCAATCTTTTGCCA
ATTTGGGAAATAAGCTCCTAGAAAATGCTACCTTCAATAATGAATCCCTT
ACAAAGTCAGTATGGCATTGGGATCCTGAATTTGAATCAATTGTCCATCC
GTACTGGCGGACTTTTGATATGGTGCCAGAAGTTTATCATTATTTAGTTG
GAGTGTATATTTCTATTGTTGGAATATCGGGAGTTCTGGGAAATCTTCTT
GTTCTTTACATATTTGCAAGCGCCAAAAGTTTAAGAACTCCTCCAAATAT
GTTTATAATGAGTTTAGCAATTGGAGATTTGACATTTTCTGCTGTGAATG
GCTTCCCCTTACTTACTATTTCAAGTTTTAACACTCGATGGGCTTGGGGA
AAATTAACGTGTGAGATTTATGGTTTCATCGGTGGTCTTTTTGGGTTTAT
ATCCATCAACACAATGGCACTAATTTCTCTGGATAGGTATTTTGTTATTG
CCCAACCATTTCAAACAATGAAATCCCTGACAATCAAAAGAGCAATAATC
ATGTTGGTTTTCGTATGGCTTTATTCATTAATTTGGTCAACACCGCCATT
TTTTGGATATGGAAATTATGTGCCGGAAGGATTTCAAACGTCTTGTACAT
TCGACTATTTGACCCAATCAAAAGGTAACATAATATTCAATATTGGGATG
TACATAGGAAATTTCATAATTCCCGTTGGAATAATTATATTTTGCTATTA
TCAAATTGTCAAAGCAGTGCGAGTACATGAATTAGAAATGTTAAAAATGG
CTCAAAAGATGAATGCATCTCATCCAACTTCCATGAAAACGGGTGCAAAA
AAGGCTGATGTTCAAGCTGCAAAGATTTCTGTCATAATTGTCTTTTTATA
TATGTTATCATGGACACCATATGCAATAATTGCCCTTATGGCTCTCACAG
GGCGTAGAGATCATCTGAATCCATACACTGCAGAATTGCCGGTACTCTTT
GCTAAGACCTCAGCTATGTACAACCCATTTATATACGCAATAAATCATCC
AAAATTTCGAATTCAGCTGGAAAAGAAATTTCCATGTTTGATTTGTTGCT
GTCCACCAAAACCAAAAGAAAGGGACACTACAAGTGCAGCATCAGCAACG
AAACCGAGTAAATATCAGAGTGAAAGAGAAAGTTCAATGTCTCAACTGGA
TCCTGAAGACGATAAACAAGTCGTAGAAACCACCAAGAATCAAACCACAA
GTGGACATACAAATGAAGCTTACGAGAGTGAACAGAAGTAGTTGATGAAA
CTAAATTATTCTATTTTTAATGACACTAGATCTTTATAATAATTTTATTT
AAGGGAATGAGCACTGAATTTTGCGCAAAT
back to top

protein sequence of SMED30030594-orf-1

>SMED30030594-orf-1 ID=SMED30030594-orf-1|Name=SMED30030594-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=433bp
MILYLTLKIFIFMSVQSFANLGNKLLENATFNNESLTKSVWHWDPEFESI
VHPYWRTFDMVPEVYHYLVGVYISIVGISGVLGNLLVLYIFASAKSLRTP
PNMFIMSLAIGDLTFSAVNGFPLLTISSFNTRWAWGKLTCEIYGFIGGLF
GFISINTMALISLDRYFVIAQPFQTMKSLTIKRAIIMLVFVWLYSLIWST
PPFFGYGNYVPEGFQTSCTFDYLTQSKGNIIFNIGMYIGNFIIPVGIIIF
CYYQIVKAVRVHELEMLKMAQKMNASHPTSMKTGAKKADVQAAKISVIIV
FLYMLSWTPYAIIALMALTGRRDHLNPYTAELPVLFAKTSAMYNPFIYAI
NHPKFRIQLEKKFPCLICCCPPKPKERDTTSAASATKPSKYQSERESSMS
QLDPEDDKQVVETTKNQTTSGHTNEAYESEQK*
back to top
Aliases
The feature 'Opsin' has the following synonyms
Synonym
opsin